Query         psy17596
Match_columns 105
No_of_seqs    102 out of 243
Neff          4.6 
Searched_HMMs 46136
Date          Fri Aug 16 18:06:57 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17596.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17596hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00925 Cyt_c_Oxidase_VIa Cyto 100.0 1.9E-46   4E-51  255.5   7.3   78   25-103     9-86  (86)
  2 PF02046 COX6A:  Cytochrome c o 100.0 1.6E-42 3.5E-47  246.6   5.2   93    6-98     10-115 (116)
  3 KOG3469|consensus              100.0 8.2E-42 1.8E-46  242.1   3.7  104    1-105     3-112 (112)
  4 PLN02595 cytochrome c oxidase  100.0   6E-29 1.3E-33  174.0   7.2   88    1-94      1-101 (102)
  5 PF13124 DUF3963:  Protein of u  52.6      20 0.00044   21.3   2.7   23   28-50     15-38  (40)
  6 PF12622 NpwBP:  mRNA biogenesi  45.6      12 0.00026   22.9   1.1   14   85-98      1-14  (48)
  7 PHA03066 Hypothetical protein;  35.3      20 0.00043   25.7   1.0   25   69-94     38-62  (110)
  8 PF02939 UcrQ:  UcrQ family;  I  34.4 1.4E+02  0.0031   19.9   5.0   33   25-57     31-66  (80)
  9 PF15018 InaF-motif:  TRP-inter  24.3      61  0.0013   19.1   1.6   17   37-53     15-31  (38)
 10 smart00704 ZnF_CDGSH CDGSH-typ  23.6      51  0.0011   19.0   1.2   14   75-88     20-33  (38)
 11 PF05961 Chordopox_A13L:  Chord  22.3 1.6E+02  0.0034   19.5   3.4   40   37-78      8-47  (68)
 12 PF02180 BH4:  Bcl-2 homology r  21.5      38 0.00083   18.6   0.4   11   74-84     16-26  (27)
 13 cd01850 CDC_Septin CDC/Septin.  21.4      35 0.00076   26.8   0.3   11   74-84    219-229 (276)
 14 PF11119 DUF2633:  Protein of u  20.5 1.6E+02  0.0034   19.0   3.1   24   35-58     16-39  (59)

No 1  
>cd00925 Cyt_c_Oxidase_VIa Cytochrome c oxidase subunit VIa.   Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit VIa is expressed in two tissue-specific isoforms in mammals but not fish. VIa-H is the heart and skeletal muscle isoform; VIa-L is the liver or non-muscle isoform.  Mammalian VIa-H induces a slip in CcO (decrease in proton/electron stoichiometry) at high intramitochondrial ATP/ADP ratios, while VIa-L induces a permanent slip i
Probab=100.00  E-value=1.9e-46  Score=255.54  Aligned_cols=78  Identities=54%  Similarity=1.035  Sum_probs=74.0

Q ss_pred             CchhHHhHHHHHHHhHHHHHHHHHHHHHHhhhhhhhccCCCCCCCCcccccccCCCCCCCCCCCCccCCCcCCCCCCCc
Q psy17596         25 NPDAVKLWRNLTYFGALPCCALVGVYVYLEHQAEEEHHVRPEFVKREYLYIRNRRFPWGDGNHSLFHNKHVNALPEGYE  103 (105)
Q Consensus        25 ~~~~~~~Wk~iS~~v~~P~i~l~~~n~y~~~~~h~~Hh~~PE~~~Y~yl~iR~K~FPWGDG~~tLFhNp~~N~lp~gyE  103 (105)
                      +++++++||+||++||+|||+||++|+|+++++|++ +++|||++|+|||||+|+||||||||||||||+||+||+|||
T Consensus         9 ~~~~~~~WkkiS~~va~P~v~l~~~n~y~~~~eh~~-~~~pe~~~Y~yl~IR~K~FpWGDG~~tlFhN~~vN~lp~gye   86 (86)
T cd00925           9 AAGTSELWKKISFYVALPAVALCMLNAYLKHKEHEE-HERPEFVEYEHLNIRTKPFPWGDGNKTLFHNPHVNALPTGYE   86 (86)
T ss_pred             ccchhhhhhhhhhhhHHHHHHHHHHHHHhhhhcccc-cCCCCCCCCccceeecCCCCCCCCCcccccCCCcCCCCCCCC
Confidence            347799999999999999999999999999998765 679999999999999999999999999999999999999998


No 2  
>PF02046 COX6A:  Cytochrome c oxidase subunit VIa;  InterPro: IPR001349 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits is known as VIa in vertebrates and fungi. Mammals have two tissue-specific isoforms of VIa, a liver and a heart form. Only one form is found in fish [].; GO: 0004129 cytochrome-c oxidase activity, 0005743 mitochondrial inner membrane, 0005751 mitochondrial respiratory chain complex IV; PDB: 2DYR_G 2EIM_G 2Y69_T 1OCC_G 3AG4_G 3AG2_G 3ASN_G 3ABL_G 1V55_T 2EIJ_T ....
Probab=100.00  E-value=1.6e-42  Score=246.59  Aligned_cols=93  Identities=49%  Similarity=0.853  Sum_probs=50.1

Q ss_pred             HHHHHHhhccccchhc-------cc-C-CchhHHhHHHHHHHhHHHHHHHHHHHHHHhhhhhhhc--c--CCCCCCCCcc
Q psy17596          6 GQMMMRKFSTSPAMKS-------AA-G-NPDAVKLWRNLTYFGALPCCALVGVYVYLEHQAEEEH--H--VRPEFVKREY   72 (105)
Q Consensus         6 ~~~~~~~~~~~~~r~~-------~~-~-~~~~~~~Wk~iS~~v~~P~i~l~~~n~y~~~~~h~~H--h--~~PE~~~Y~y   72 (105)
                      ++..+|++++++++..       ++ + +++++++||+||++||||+|+|+++|+|.++.+|++|  |  ++|||++|||
T Consensus        10 ~~~~~R~~s~~~~~~~~f~~~~~a~~~ha~~~~~~Wk~iS~~v~iP~i~l~~~n~~~l~~~H~eH~~h~~~~pe~~~Y~y   89 (116)
T PF02046_consen   10 RRAARRFFSTSAARASAFLAERSASEEHAEETAKLWKKISFFVAIPAIALCMLNAYYLEKEHHEHREHLPERPEFVPYPY   89 (116)
T ss_dssp             ----------------------TSSSSTSSSSHHHHHHHHHHTHHHHHHHHHHHHH-HSTS-----------------TT
T ss_pred             cccccccccccccccccccchhhhcccchhhhhHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccccCCCCCCCCCCcc
Confidence            4455666666544321       11 2 4588999999999999999999999999888887764  2  6899999999


Q ss_pred             cccccCCCCCCCCCCCCccCCCcCCC
Q psy17596         73 LYIRNRRFPWGDGNHSLFHNKHVNAL   98 (105)
Q Consensus        73 l~iR~K~FPWGDG~~tLFhNp~~N~l   98 (105)
                      ||||+|+||||||||||||||+||+|
T Consensus        90 l~iR~K~FPWGDG~~tLFhNp~~N~l  115 (116)
T PF02046_consen   90 LRIRTKPFPWGDGNHTLFHNPHVNAL  115 (116)
T ss_dssp             SS--SS--SSTTSSS-TT--TTT-EB
T ss_pred             ceecCCCCCCCCCCcCCccCCCcCCC
Confidence            99999999999999999999999987


No 3  
>KOG3469|consensus
Probab=100.00  E-value=8.2e-42  Score=242.14  Aligned_cols=104  Identities=45%  Similarity=0.818  Sum_probs=92.6

Q ss_pred             ChhhHHHHHHHhhccccchhc----ccC--CchhHHhHHHHHHHhHHHHHHHHHHHHHHhhhhhhhccCCCCCCCCcccc
Q psy17596          1 MASRLGQMMMRKFSTSPAMKS----AAG--NPDAVKLWRNLTYFGALPCCALVGVYVYLEHQAEEEHHVRPEFVKREYLY   74 (105)
Q Consensus         1 m~~~~~~~~~~~~~~~~~r~~----~~~--~~~~~~~Wk~iS~~v~~P~i~l~~~n~y~~~~~h~~Hh~~PE~~~Y~yl~   74 (105)
                      |++.+.++..++++.++.|.+    ++.  .++.+++|++||+|+++||++||++|+|+.+++|.+ |++||++.|+|||
T Consensus         3 l~~~~~rSv~r~~~~ks~~~~~~~~~~~~~~e~~s~~Wkkit~~~alP~~al~~~n~y~~~~~~~e-~~~~e~~~Y~fl~   81 (112)
T KOG3469|consen    3 LAVPLTRSVTRRLGLKSARHMYRRAAVAGFKEGGSRTWKKITFFVALPAVALAMYNAYLGHGHHPE-HERPEFRAYEFLN   81 (112)
T ss_pred             cchhhcccccccccccccccccchhhhhhhcchhhhhhhheeeeeeccHHHHHHHHHHHhhccCcc-cCCccccccchhh
Confidence            455667889999988777765    222  345579999999999999999999999999999877 8899999999999


Q ss_pred             cccCCCCCCCCCCCCccCCCcCCCCCCCcCC
Q psy17596         75 IRNRRFPWGDGNHSLFHNKHVNALPEGYEED  105 (105)
Q Consensus        75 iR~K~FPWGDG~~tLFhNp~~N~lp~gyE~e  105 (105)
                      ||+|+|||||||+||||||+||+||+|||+|
T Consensus        82 iR~K~fpWgdG~~tLfhN~~vn~l~~~~E~d  112 (112)
T KOG3469|consen   82 IRNKPFPWGDGNKTLFHNPHVNPLPTGYEHD  112 (112)
T ss_pred             hhcCCCCCCCCcchhccCcccccCcccccCC
Confidence            9999999999999999999999999999986


No 4  
>PLN02595 cytochrome c oxidase subunit VI protein
Probab=99.95  E-value=6e-29  Score=174.00  Aligned_cols=88  Identities=31%  Similarity=0.609  Sum_probs=61.6

Q ss_pred             ChhhHHHHHHHhhcc--------ccchhccc--CCc--hhHHhHHHHHHHhHHHHHHHHHHHHHHhhhhhhhccCCCCCC
Q psy17596          1 MASRLGQMMMRKFST--------SPAMKSAA--GNP--DAVKLWRNLTYFGALPCCALVGVYVYLEHQAEEEHHVRPEFV   68 (105)
Q Consensus         1 m~~~~~~~~~~~~~~--------~~~r~~~~--~~~--~~~~~Wk~iS~~v~~P~i~l~~~n~y~~~~~h~~Hh~~PE~~   68 (105)
                      ||..+.|+.++++..        ...|+.++  +|+  +++++||+|||++++||++   +|+|+++++|++ +++|  +
T Consensus         1 ma~~~~~~~l~~~~~~~~~~~~~~~~r~~~a~~~h~~a~~a~~WkklS~~~v~~c~~---lnaY~l~~eH~~-~e~p--~   74 (102)
T PLN02595          1 MATAIVRSALSRAVTRAAPKTSVAPKRNFSSSAGHDDAYEAAKWEKITYLGIASCTA---LAVYVLSKGHHH-GEDP--P   74 (102)
T ss_pred             ChHHHHHHHHHHHHHhhccCcccccccccccccCCCcchhhhhhhhhhHHHhHHHHH---HHHHHhhhcccc-CCCC--C
Confidence            666666665555431        12233322  233  5899999999997554432   378888877644 3444  5


Q ss_pred             CCcccccccCCCCCC-CCCCCCccCCC
Q psy17596         69 KREYLYIRNRRFPWG-DGNHSLFHNKH   94 (105)
Q Consensus        69 ~Y~yl~iR~K~FPWG-DG~~tLFhNp~   94 (105)
                      +|+|||||+|+|||| ||++++|||.+
T Consensus        75 ~Y~yLrIRtK~FPWG~DG~~e~~hn~~  101 (102)
T PLN02595         75 AYPYMHIRNKEFPWGPDGLFEVKHNKE  101 (102)
T ss_pred             CCCcceeecCCCCCCCCcccccccccC
Confidence            999999999999999 99999999975


No 5  
>PF13124 DUF3963:  Protein of unknown function (DUF3963)
Probab=52.55  E-value=20  Score=21.29  Aligned_cols=23  Identities=35%  Similarity=0.684  Sum_probs=17.2

Q ss_pred             hHHhH-HHHHHHhHHHHHHHHHHH
Q psy17596         28 AVKLW-RNLTYFGALPCCALVGVY   50 (105)
Q Consensus        28 ~~~~W-k~iS~~v~~P~i~l~~~n   50 (105)
                      ...+| |+||++.|+-.|+|.+++
T Consensus        15 diqkwirnit~cfal~vv~lvslw   38 (40)
T PF13124_consen   15 DIQKWIRNITFCFALLVVVLVSLW   38 (40)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34566 789999988777777665


No 6  
>PF12622 NpwBP:  mRNA biogenesis factor
Probab=45.62  E-value=12  Score=22.90  Aligned_cols=14  Identities=21%  Similarity=0.470  Sum_probs=12.4

Q ss_pred             CCCCCccCCCcCCC
Q psy17596         85 GNHSLFHNKHVNAL   98 (105)
Q Consensus        85 G~~tLFhNp~~N~l   98 (105)
                      |.+|.|.||..|++
T Consensus         1 ~~kSiyydP~~NP~   14 (48)
T PF12622_consen    1 PEKSIYYDPELNPL   14 (48)
T ss_pred             CCcceecCCccCCC
Confidence            56899999999986


No 7  
>PHA03066 Hypothetical protein; Provisional
Probab=35.28  E-value=20  Score=25.73  Aligned_cols=25  Identities=24%  Similarity=0.361  Sum_probs=19.8

Q ss_pred             CCcccccccCCCCCCCCCCCCccCCC
Q psy17596         69 KREYLYIRNRRFPWGDGNHSLFHNKH   94 (105)
Q Consensus        69 ~Y~yl~iR~K~FPWGDG~~tLFhNp~   94 (105)
                      ++...+.|.-.|||- .+-+||.+|.
T Consensus        38 e~~~ik~~d~~~P~~-~~t~lF~~~~   62 (110)
T PHA03066         38 ENAIIKQRNDEFPTT-LNTIIFTDPE   62 (110)
T ss_pred             HHHHHHhhhccCCcc-cceEEecCCC
Confidence            344577788899995 5889999987


No 8  
>PF02939 UcrQ:  UcrQ family;  InterPro: IPR004205 The ubiquinol-cytochrome C reductase complex (cytochrome bc1 complex) is a respiratory multi-enzyme complex [], which recognises a mitochondrial targeting presequence. The bc1 complex contains 11 subunits: 3 respiratory subunits (cytochrome b, cytochrome c1 and Rieske protein), 2 core proteins and 6 low molecular weight proteins. This family represents the 9.5 kDa subunit of the complex. This subunit together with cytochrome B binds to ubiquinone.; GO: 0008121 ubiquinol-cytochrome-c reductase activity; PDB: 1L0N_G 1SQQ_G 1PP9_G 1PPJ_T 2FYU_G 2BCC_G 1BCC_G 2A06_G 1NTZ_G 2YBB_g ....
Probab=34.36  E-value=1.4e+02  Score=19.88  Aligned_cols=33  Identities=12%  Similarity=0.214  Sum_probs=22.1

Q ss_pred             CchhHHhHHHHH---HHhHHHHHHHHHHHHHHhhhh
Q psy17596         25 NPDAVKLWRNLT---YFGALPCCALVGVYVYLEHQA   57 (105)
Q Consensus        25 ~~~~~~~Wk~iS---~~v~~P~i~l~~~n~y~~~~~   57 (105)
                      +.+--+.||++.   ++|++|+|+.-.+..+-.+..
T Consensus        31 ~~~i~N~~RR~~~q~~~v~ppfi~~y~i~~Wa~~~~   66 (80)
T PF02939_consen   31 SKGIFNTFRRFRSQVLYVAPPFIVGYLIYDWANEEN   66 (80)
T ss_dssp             TTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HhhHhHHHHHHHHHhHHHhhHHHHHHHHHHHHHHHH
Confidence            445566777664   677889888877766655443


No 9  
>PF15018 InaF-motif:  TRP-interacting helix
Probab=24.34  E-value=61  Score=19.10  Aligned_cols=17  Identities=18%  Similarity=0.380  Sum_probs=12.1

Q ss_pred             HHhHHHHHHHHHHHHHH
Q psy17596         37 YFGALPCCALVGVYVYL   53 (105)
Q Consensus        37 ~~v~~P~i~l~~~n~y~   53 (105)
                      ++|+++++.|+.++.+.
T Consensus        15 ~~VSl~Ai~LsiYY~f~   31 (38)
T PF15018_consen   15 FSVSLAAIVLSIYYIFF   31 (38)
T ss_pred             HHHHHHHHHHHHHHhee
Confidence            45678888888777653


No 10 
>smart00704 ZnF_CDGSH CDGSH-type zinc finger. Function unknown.
Probab=23.56  E-value=51  Score=19.04  Aligned_cols=14  Identities=43%  Similarity=0.930  Sum_probs=12.0

Q ss_pred             cccCCCCCCCCCCC
Q psy17596         75 IRNRRFPWGDGNHS   88 (105)
Q Consensus        75 iR~K~FPWGDG~~t   88 (105)
                      -++|.+|+=||.|.
T Consensus        20 ~~S~~~PfCDGsH~   33 (38)
T smart00704       20 GRSKNFPYCDGSHK   33 (38)
T ss_pred             CCCCCCCccCCccc
Confidence            58899999999874


No 11 
>PF05961 Chordopox_A13L:  Chordopoxvirus A13L protein;  InterPro: IPR009236 This family consists of A13L proteins from the Chordopoxviruses. A13L or p8 is one of the three most abundant membrane proteins of the intracellular mature Vaccinia virus [].
Probab=22.26  E-value=1.6e+02  Score=19.54  Aligned_cols=40  Identities=10%  Similarity=0.071  Sum_probs=18.4

Q ss_pred             HHhHHHHHHHHHHHHHHhhhhhhhccCCCCCCCCcccccccC
Q psy17596         37 YFGALPCCALVGVYVYLEHQAEEEHHVRPEFVKREYLYIRNR   78 (105)
Q Consensus        37 ~~v~~P~i~l~~~n~y~~~~~h~~Hh~~PE~~~Y~yl~iR~K   78 (105)
                      +.+|+.+|++..+-+|..-..- . +..|.-..||.+.-++.
T Consensus         8 i~ICVaii~lIlY~iYnr~~~~-q-~~~~~~e~y~~~~~~kT   47 (68)
T PF05961_consen    8 IIICVAIIGLILYGIYNRKKTT-Q-NTNPSTENYEKMENLKT   47 (68)
T ss_pred             HHHHHHHHHHHHHHHHhccccc-C-CCCCchhhcCCccccch
Confidence            3445545555555555544332 1 22221156777665443


No 12 
>PF02180 BH4:  Bcl-2 homology region 4;  InterPro: IPR003093 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon.  All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 1AF3_A 2PON_B 1YSN_A 3PL7_B 3R85_A 2O2N_A 2P1L_C 1R2G_A 2O1Y_A 1BXL_A ....
Probab=21.50  E-value=38  Score=18.63  Aligned_cols=11  Identities=18%  Similarity=0.737  Sum_probs=8.6

Q ss_pred             ccccCCCCCCC
Q psy17596         74 YIRNRRFPWGD   84 (105)
Q Consensus        74 ~iR~K~FPWGD   84 (105)
                      +++.|-|+|++
T Consensus        16 KLsQrgy~w~~   26 (27)
T PF02180_consen   16 KLSQRGYVWEE   26 (27)
T ss_dssp             HHHHTTSTSTT
T ss_pred             HhhhcCCCCCC
Confidence            57788888876


No 13 
>cd01850 CDC_Septin CDC/Septin.  Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells.  They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis.  In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments.  Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.
Probab=21.42  E-value=35  Score=26.77  Aligned_cols=11  Identities=45%  Similarity=1.334  Sum_probs=9.2

Q ss_pred             ccccCCCCCCC
Q psy17596         74 YIRNRRFPWGD   84 (105)
Q Consensus        74 ~iR~K~FPWGD   84 (105)
                      .+|.+.||||-
T Consensus       219 ~~~~R~y~WG~  229 (276)
T cd01850         219 KVRGRKYPWGV  229 (276)
T ss_pred             EEEEecCCccE
Confidence            47889999994


No 14 
>PF11119 DUF2633:  Protein of unknown function (DUF2633);  InterPro: IPR022576  This family is conserved largely in Proteobacteria. Several members are named as YfgG. The function is not known. 
Probab=20.53  E-value=1.6e+02  Score=18.96  Aligned_cols=24  Identities=8%  Similarity=0.213  Sum_probs=15.1

Q ss_pred             HHHHhHHHHHHHHHHHHHHhhhhh
Q psy17596         35 LTYFGALPCCALVGVYVYLEHQAE   58 (105)
Q Consensus        35 iS~~v~~P~i~l~~~n~y~~~~~h   58 (105)
                      |||.+.+.-++..+++++..|++-
T Consensus        16 ISfiIlfgRl~Y~~I~a~~hHq~k   39 (59)
T PF11119_consen   16 ISFIILFGRLIYSAIGAWVHHQDK   39 (59)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHH
Confidence            556555555677777777665553


Done!