Query         psy17601
Match_columns 64
No_of_seqs    104 out of 763
Neff          6.5 
Searched_HMMs 46136
Date          Fri Aug 16 18:16:27 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17601.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17601hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0605|consensus               99.6   2E-15 4.2E-20  110.4   5.6   62    2-63    100-161 (550)
  2 KOG0608|consensus               99.4 5.6E-13 1.2E-17  100.6   5.1   62    2-63    588-649 (1034)
  3 KOG0612|consensus               98.4 3.6E-07 7.7E-12   72.3   3.6   55    9-63     40-95  (1317)
  4 KOG0598|consensus               98.1 9.4E-07   2E-11   62.7   1.2   25   39-63     21-45  (357)
  5 KOG0616|consensus               98.0 6.7E-06 1.4E-10   58.1   3.7   44   20-63     17-64  (355)
  6 KOG0694|consensus               97.9   4E-06 8.6E-11   63.5   1.6   26   38-63    363-388 (694)
  7 KOG0580|consensus               97.8   1E-05 2.2E-10   55.7   1.6   27   37-63     16-42  (281)
  8 KOG0696|consensus               97.8 9.7E-06 2.1E-10   60.0   1.4   26   39-64    345-370 (683)
  9 KOG0690|consensus               97.5 3.7E-05 7.9E-10   55.6   1.0   27   37-63    162-188 (516)
 10 KOG0591|consensus               97.3 4.1E-05   9E-10   54.2  -0.8   27   38-64     14-40  (375)
 11 cd05628 STKc_NDR1 Catalytic do  97.2 0.00017 3.6E-09   49.2   1.1   22   43-64      1-22  (363)
 12 cd05599 STKc_NDR_like Catalyti  97.1 0.00017 3.6E-09   48.8   1.0   22   43-64      1-22  (364)
 13 cd05621 STKc_ROCK2 Catalytic d  97.1 0.00044 9.5E-09   47.7   2.9   35   29-63     29-63  (370)
 14 cd05626 STKc_LATS2 Catalytic d  97.1 0.00019 4.2E-09   49.2   1.0   22   43-64      1-22  (381)
 15 cd05598 STKc_LATS Catalytic do  97.1 0.00022 4.8E-09   48.6   1.1   22   43-64      1-22  (376)
 16 cd05625 STKc_LATS1 Catalytic d  97.1 0.00022 4.8E-09   48.8   1.0   22   43-64      1-22  (382)
 17 KOG1035|consensus               97.0 0.00018 3.9E-09   57.7   0.3   22   42-63    478-499 (1351)
 18 cd05088 PTKc_Tie2 Catalytic do  97.0 0.00027 5.9E-09   46.8   1.1   26   38-63      2-27  (303)
 19 cd05596 STKc_ROCK Catalytic do  97.0 0.00036 7.7E-09   48.0   1.7   29   36-64     36-64  (370)
 20 PHA02882 putative serine/threo  97.0 0.00028   6E-09   46.7   1.0   23   41-63     10-32  (294)
 21 cd05624 STKc_MRCK_beta Catalyt  97.0 0.00029 6.3E-09   47.4   1.1   22   43-64      1-22  (331)
 22 cd05627 STKc_NDR2 Catalytic do  97.0  0.0003 6.6E-09   47.8   1.1   21   43-63      1-21  (360)
 23 PLN03225 Serine/threonine-prot  97.0 0.00038 8.2E-09   51.3   1.6   28   37-64    126-153 (566)
 24 cd05103 PTKc_VEGFR2 Catalytic   97.0 0.00033 7.1E-09   47.4   1.1   23   41-63      5-27  (343)
 25 PLN03224 probable serine/threo  96.9  0.0005 1.1E-08   50.5   1.9   27   37-63    139-165 (507)
 26 PTZ00263 protein kinase A cata  96.9 0.00039 8.4E-09   46.8   0.9   29   36-64     11-39  (329)
 27 cd05102 PTKc_VEGFR3 Catalytic   96.9  0.0004 8.6E-09   46.5   0.9   24   40-63      4-27  (338)
 28 cd05114 PTKc_Tec_Rlk Catalytic  96.9 0.00037   8E-09   44.6   0.7   24   40-63      1-24  (256)
 29 cd05597 STKc_DMPK_like Catalyt  96.9 0.00044 9.5E-09   46.6   1.1   21   43-63      1-21  (331)
 30 cd07862 STKc_CDK6 Catalytic do  96.8 0.00059 1.3E-08   44.4   1.5   22   43-64      1-22  (290)
 31 cd05622 STKc_ROCK1 Catalytic d  96.8  0.0011 2.3E-08   45.8   2.8   29   36-64     36-64  (371)
 32 cd05046 PTK_CCK4 Pseudokinase   96.8 0.00047   1E-08   44.4   1.0   24   40-63      2-25  (275)
 33 PTZ00426 cAMP-dependent protei  96.8 0.00044 9.6E-09   47.1   0.9   27   37-63     24-50  (340)
 34 cd05612 STKc_PRKX_like Catalyt  96.8 0.00058 1.3E-08   45.0   1.4   22   43-64      1-22  (291)
 35 PTZ00284 protein kinase; Provi  96.8 0.00051 1.1E-08   48.6   1.0   23   42-64    128-150 (467)
 36 cd06617 PKc_MKK3_6 Catalytic d  96.8 0.00059 1.3E-08   44.0   1.2   22   43-64      1-22  (283)
 37 cd05623 STKc_MRCK_alpha Cataly  96.8 0.00056 1.2E-08   46.0   1.1   21   43-63      1-21  (332)
 38 cd07871 STKc_PCTAIRE3 Catalyti  96.8 0.00062 1.4E-08   44.7   1.2   24   41-64      3-26  (288)
 39 cd07869 STKc_PFTAIRE1 Catalyti  96.8 0.00062 1.3E-08   44.9   1.2   23   42-64      4-26  (303)
 40 cd06649 PKc_MEK2 Catalytic dom  96.7 0.00071 1.5E-08   45.5   1.4   25   40-64      2-26  (331)
 41 cd05108 PTKc_EGFR Catalytic do  96.7 0.00066 1.4E-08   45.1   1.1   24   40-63      4-27  (316)
 42 cd05629 STKc_NDR_like_fungal C  96.7 0.00065 1.4E-08   46.4   1.1   21   43-63      1-21  (377)
 43 cd05048 PTKc_Ror Catalytic Dom  96.7  0.0006 1.3E-08   44.1   0.8   24   40-63      2-25  (283)
 44 PHA03210 serine/threonine kina  96.7  0.0007 1.5E-08   48.8   1.1   22   42-63    147-168 (501)
 45 cd05096 PTKc_DDR1 Catalytic do  96.7 0.00079 1.7E-08   44.3   1.3   24   40-63      2-25  (304)
 46 PHA03212 serine/threonine kina  96.7 0.00088 1.9E-08   46.7   1.6   26   39-64     88-113 (391)
 47 cd05573 STKc_ROCK_NDR_like Cat  96.7 0.00069 1.5E-08   45.3   1.0   22   43-64      1-22  (350)
 48 KOG0585|consensus               96.6 0.00082 1.8E-08   50.1   1.2   26   39-64     93-118 (576)
 49 cd05067 PTKc_Lck_Blk Catalytic  96.6 0.00083 1.8E-08   43.0   1.1   24   40-63      3-26  (260)
 50 cd05051 PTKc_DDR Catalytic dom  96.6   0.001 2.2E-08   43.2   1.5   24   40-63      2-25  (296)
 51 cd05111 PTK_HER3 Pseudokinase   96.6 0.00081 1.8E-08   43.9   1.0   24   40-63      4-27  (279)
 52 KOG0600|consensus               96.6 0.00039 8.5E-09   51.8  -0.6   26   39-64    113-138 (560)
 53 cd05033 PTKc_EphR Catalytic do  96.6 0.00089 1.9E-08   43.0   1.0   23   41-63      2-24  (266)
 54 cd07874 STKc_JNK3 Catalytic do  96.6 0.00096 2.1E-08   45.1   1.1   24   41-64     15-38  (355)
 55 cd07872 STKc_PCTAIRE2 Catalyti  96.5  0.0013 2.7E-08   43.5   1.4   25   40-64      3-27  (309)
 56 cd05600 STKc_Sid2p_Dbf2p Catal  96.5   0.001 2.3E-08   44.5   1.0   22   43-64      1-22  (333)
 57 cd06620 PKc_MAPKK_Byr1_like Ca  96.5 0.00067 1.4E-08   44.2   0.1   24   40-63      2-25  (284)
 58 cd05109 PTKc_HER2 Catalytic do  96.5  0.0012 2.6E-08   42.8   1.2   24   40-63      4-27  (279)
 59 cd05090 PTKc_Ror1 Catalytic do  96.5  0.0012 2.5E-08   42.9   1.1   24   40-63      2-25  (283)
 60 cd07876 STKc_JNK2 Catalytic do  96.5  0.0011 2.4E-08   44.9   0.9   23   42-64     20-42  (359)
 61 cd07848 STKc_CDKL5 Catalytic d  96.5  0.0013 2.9E-08   42.7   1.2   22   43-64      1-22  (287)
 62 cd06650 PKc_MEK1 Catalytic dom  96.4  0.0014 3.1E-08   44.2   1.4   25   40-64      2-26  (333)
 63 cd07873 STKc_PCTAIRE1 Catalyti  96.4  0.0013 2.8E-08   43.2   1.1   25   40-64      3-27  (301)
 64 cd05054 PTKc_VEGFR Catalytic d  96.4  0.0011 2.5E-08   44.9   0.9   21   43-63      7-27  (337)
 65 cd05097 PTKc_DDR_like Catalyti  96.4  0.0014 3.1E-08   42.9   1.3   23   41-63      3-25  (295)
 66 cd05072 PTKc_Lyn Catalytic dom  96.4  0.0011 2.4E-08   42.4   0.7   24   40-63      3-26  (261)
 67 cd06622 PKc_MAPKK_PBS2_like Ca  96.4  0.0012 2.6E-08   42.8   0.9   22   43-64      1-22  (286)
 68 cd05601 STKc_CRIK Catalytic do  96.4  0.0013 2.8E-08   43.9   1.0   22   43-64      1-22  (330)
 69 PRK09188 serine/threonine prot  96.4  0.0014 3.1E-08   46.4   1.2   24   40-63     15-38  (365)
 70 cd07878 STKc_p38beta_MAPK11 Ca  96.4  0.0014 3.1E-08   44.0   1.1   23   42-64     14-36  (343)
 71 PLN00034 mitogen-activated pro  96.4  0.0011 2.3E-08   45.0   0.5   25   40-64     71-95  (353)
 72 cd05104 PTKc_Kit Catalytic dom  96.4  0.0012 2.7E-08   45.4   0.7   24   40-63     32-55  (375)
 73 KOG0695|consensus               96.4  0.0011 2.4E-08   48.4   0.5   25   39-63    246-270 (593)
 74 cd05091 PTKc_Ror2 Catalytic do  96.4 0.00076 1.7E-08   43.7  -0.3   24   40-63      2-25  (283)
 75 cd05049 PTKc_Trk Catalytic dom  96.3  0.0013 2.8E-08   42.3   0.7   24   40-63      2-25  (280)
 76 cd06619 PKc_MKK5 Catalytic dom  96.3  0.0019 4.2E-08   42.0   1.4   22   43-64      1-22  (279)
 77 cd05089 PTKc_Tie1 Catalytic do  96.3  0.0022 4.7E-08   42.2   1.5   21   43-63      2-22  (297)
 78 cd05110 PTKc_HER4 Catalytic do  96.3  0.0018 3.9E-08   42.8   1.0   24   40-63      4-27  (303)
 79 cd05032 PTKc_InsR_like Catalyt  96.3  0.0016 3.4E-08   41.9   0.7   24   40-63      3-26  (277)
 80 cd05061 PTKc_InsR Catalytic do  96.2  0.0017 3.6E-08   42.5   0.8   24   40-63      3-26  (288)
 81 cd07845 STKc_CDK10 Catalytic d  96.2  0.0019 4.2E-08   42.6   1.1   24   41-64      5-28  (309)
 82 cd06615 PKc_MEK Catalytic doma  96.2  0.0024 5.2E-08   42.3   1.5   21   43-63      1-21  (308)
 83 cd07875 STKc_JNK1 Catalytic do  96.2  0.0019 4.1E-08   43.9   1.0   23   42-64     23-45  (364)
 84 cd05050 PTKc_Musk Catalytic do  96.2   0.002 4.3E-08   41.9   1.1   24   40-63      2-25  (288)
 85 cd05112 PTKc_Itk Catalytic dom  96.2   0.002 4.4E-08   41.0   1.0   23   41-63      2-24  (256)
 86 cd05106 PTKc_CSF-1R Catalytic   96.2  0.0015 3.4E-08   45.0   0.5   24   40-63     35-58  (374)
 87 PTZ00036 glycogen synthase kin  96.2   0.002 4.2E-08   45.7   1.0   25   40-64     63-87  (440)
 88 KOG0201|consensus               96.2  0.0022 4.7E-08   47.1   1.2   22   43-64     13-34  (467)
 89 cd05066 PTKc_EphR_A Catalytic   96.2  0.0016 3.5E-08   41.9   0.5   23   41-63      2-24  (267)
 90 cd06646 STKc_MAP4K5 Catalytic   96.1  0.0022 4.8E-08   41.1   1.0   23   41-63      7-29  (267)
 91 cd05064 PTKc_EphR_A10 Catalyti  96.1  0.0022 4.9E-08   41.4   1.0   24   40-63      2-25  (266)
 92 KOG1152|consensus               96.1  0.0027 5.8E-08   48.6   1.5   25   40-64    558-582 (772)
 93 cd06638 STKc_myosinIIIA Cataly  96.1  0.0028   6E-08   41.0   1.3   25   40-64     15-39  (286)
 94 cd05070 PTKc_Fyn_Yrk Catalytic  96.1  0.0024 5.2E-08   40.9   1.0   24   40-63      3-26  (260)
 95 cd08228 STKc_Nek6 Catalytic do  96.0  0.0031 6.7E-08   40.3   1.3   22   42-63      1-22  (267)
 96 cd05095 PTKc_DDR2 Catalytic do  96.0  0.0029 6.2E-08   41.5   1.1   21   43-63      5-25  (296)
 97 cd06616 PKc_MKK4 Catalytic dom  96.0   0.002 4.2E-08   41.9   0.3   23   41-63      2-24  (288)
 98 cd05098 PTKc_FGFR1 Catalytic d  96.0  0.0019 4.2E-08   42.6   0.2   25   39-63     14-38  (307)
 99 cd08229 STKc_Nek7 Catalytic do  96.0  0.0029 6.3E-08   40.5   1.0   22   42-63      1-22  (267)
100 KOG1164|consensus               96.0  0.0032 6.9E-08   42.9   1.1   21   44-64     19-39  (322)
101 PHA03209 serine/threonine kina  95.9  0.0035 7.5E-08   42.8   1.2   24   41-64     64-87  (357)
102 cd07844 STKc_PCTAIRE_like Cata  95.9  0.0036 7.7E-08   40.7   1.1   24   41-64      3-26  (291)
103 cd05036 PTKc_ALK_LTK Catalytic  95.9  0.0031 6.6E-08   40.9   0.8   24   40-63      3-26  (277)
104 cd05059 PTKc_Tec_like Catalyti  95.9  0.0032   7E-08   40.3   0.9   23   41-63      2-24  (256)
105 cd05113 PTKc_Btk_Bmx Catalytic  95.9  0.0027 5.9E-08   40.8   0.5   23   41-63      2-24  (256)
106 cd05063 PTKc_EphR_A2 Catalytic  95.9  0.0029 6.4E-08   40.5   0.7   24   40-63      2-25  (268)
107 cd05093 PTKc_TrkB Catalytic do  95.9  0.0035 7.5E-08   41.0   1.0   24   40-63      2-25  (288)
108 cd05610 STKc_MASTL Catalytic d  95.9  0.0035 7.6E-08   46.9   1.1   24   41-64      2-25  (669)
109 cd06652 STKc_MEKK2 Catalytic d  95.9  0.0045 9.7E-08   39.7   1.4   23   42-64      1-23  (265)
110 cd07837 STKc_CdkB_plant Cataly  95.8  0.0043 9.3E-08   40.3   1.3   22   43-64      1-22  (295)
111 cd05039 PTKc_Csk_like Catalyti  95.8  0.0048   1E-07   39.3   1.5   24   40-63      3-26  (256)
112 cd05068 PTKc_Frk_like Catalyti  95.8  0.0039 8.6E-08   39.9   1.0   24   40-63      3-26  (261)
113 cd05092 PTKc_TrkA Catalytic do  95.8  0.0047   1E-07   40.2   1.4   24   40-63      2-25  (280)
114 cd07866 STKc_BUR1 Catalytic do  95.8  0.0039 8.3E-08   40.6   1.0   23   41-63      6-28  (311)
115 cd05073 PTKc_Hck Catalytic dom  95.8  0.0047   1E-07   39.6   1.3   24   40-63      3-26  (260)
116 cd05034 PTKc_Src_like Catalyti  95.8  0.0044 9.5E-08   39.5   1.2   24   40-63      3-26  (261)
117 KOG0610|consensus               95.8  0.0023 4.9E-08   46.9  -0.2   29   36-64     70-98  (459)
118 PTZ00283 serine/threonine prot  95.8  0.0043 9.3E-08   44.8   1.2   26   39-64     28-53  (496)
119 cd05148 PTKc_Srm_Brk Catalytic  95.8  0.0024 5.2E-08   40.7  -0.1   24   41-64      4-27  (261)
120 cd05065 PTKc_EphR_B Catalytic   95.8  0.0037   8E-08   40.2   0.7   23   41-63      2-24  (269)
121 cd05101 PTKc_FGFR2 Catalytic d  95.7  0.0031 6.7E-08   41.5   0.3   25   39-63     11-35  (304)
122 cd05053 PTKc_FGFR Catalytic do  95.7  0.0033 7.2E-08   40.9   0.5   25   39-63      8-32  (293)
123 cd05082 PTKc_Csk Catalytic dom  95.7  0.0042 9.1E-08   39.7   0.9   24   40-63      3-26  (256)
124 cd05062 PTKc_IGF-1R Catalytic   95.7  0.0038 8.2E-08   40.4   0.7   23   41-63      4-26  (277)
125 cd05105 PTKc_PDGFR_alpha Catal  95.7  0.0051 1.1E-07   43.2   1.4   25   39-63     33-57  (400)
126 cd05100 PTKc_FGFR3 Catalytic d  95.7  0.0036 7.9E-08   41.9   0.5   22   42-63     11-32  (334)
127 cd05057 PTKc_EGFR_like Catalyt  95.7  0.0042   9E-08   40.2   0.8   24   40-63      4-27  (279)
128 cd05038 PTKc_Jak_rpt2 Catalyti  95.7  0.0058 1.2E-07   39.2   1.4   23   41-63      2-24  (284)
129 cd07865 STKc_CDK9 Catalytic do  95.7  0.0043 9.4E-08   40.4   0.9   24   41-64     10-33  (310)
130 cd05107 PTKc_PDGFR_beta Cataly  95.6  0.0036 7.8E-08   44.1   0.4   24   40-63     34-57  (401)
131 PTZ00266 NIMA-related protein   95.6  0.0048   1E-07   49.0   1.0   26   39-64      9-34  (1021)
132 cd07846 STKc_CDKL2_3 Catalytic  95.6   0.006 1.3E-07   39.4   1.3   22   43-64      1-22  (286)
133 cd06618 PKc_MKK7 Catalytic dom  95.6   0.006 1.3E-07   40.0   1.3   25   39-63     11-35  (296)
134 cd07870 STKc_PFTAIRE2 Catalyti  95.6   0.005 1.1E-07   40.1   0.8   22   42-63      4-25  (291)
135 cd05071 PTKc_Src Catalytic dom  95.5  0.0051 1.1E-07   39.6   0.8   24   41-64      4-27  (262)
136 cd05581 STKc_PDK1 Catalytic do  95.5  0.0071 1.5E-07   38.6   1.4   22   43-64      1-22  (280)
137 cd06610 STKc_OSR1_SPAK Catalyt  95.5  0.0073 1.6E-07   38.3   1.4   21   43-63      1-21  (267)
138 cd05083 PTKc_Chk Catalytic dom  95.5  0.0045 9.7E-08   39.5   0.4   23   41-63      4-26  (254)
139 KOG0659|consensus               95.4  0.0058 1.3E-07   42.9   0.8   22   43-64      2-23  (318)
140 cd06644 STKc_STK10_LOK Catalyt  95.4   0.006 1.3E-07   39.8   0.8   21   43-63     12-32  (292)
141 cd05043 PTK_Ryk Pseudokinase d  95.4  0.0062 1.3E-07   39.3   0.8   24   40-63      3-26  (280)
142 KOG0592|consensus               95.4  0.0077 1.7E-07   45.4   1.4   26   39-64     69-94  (604)
143 PHA03207 serine/threonine kina  95.4  0.0071 1.5E-07   41.8   1.1   21   43-63     92-112 (392)
144 cd05079 PTKc_Jak1_rpt2 Catalyt  95.4   0.008 1.7E-07   39.1   1.3   20   44-63      5-24  (284)
145 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  95.4   0.009   2E-07   38.7   1.5   21   43-63      4-24  (284)
146 cd06653 STKc_MEKK3_like_1 Cata  95.3  0.0088 1.9E-07   38.4   1.4   22   43-64      2-23  (264)
147 cd05055 PTKc_PDGFR Catalytic d  95.3  0.0049 1.1E-07   40.9   0.2   25   39-63     31-55  (302)
148 cd07850 STKc_JNK Catalytic dom  95.3  0.0073 1.6E-07   40.8   1.0   23   42-64     15-37  (353)
149 cd07864 STKc_CDK12 Catalytic d  95.3  0.0066 1.4E-07   39.5   0.7   24   40-63      4-27  (302)
150 cd06651 STKc_MEKK3 Catalytic d  95.3    0.01 2.3E-07   38.1   1.6   22   43-64      2-23  (266)
151 cd07849 STKc_ERK1_2_like Catal  95.3   0.007 1.5E-07   40.6   0.7   22   43-64      5-26  (336)
152 cd06645 STKc_MAP4K3 Catalytic   95.2  0.0045 9.7E-08   39.7  -0.2   25   40-64      6-30  (267)
153 cd06605 PKc_MAPKK Catalytic do  95.2  0.0077 1.7E-07   38.3   0.9   21   43-63      1-21  (265)
154 cd05094 PTKc_TrkC Catalytic do  95.2  0.0073 1.6E-07   39.5   0.7   24   40-63      2-25  (291)
155 cd07843 STKc_CDC2L1 Catalytic   95.2   0.007 1.5E-07   39.4   0.6   24   41-64      3-26  (293)
156 cd07847 STKc_CDKL1_4 Catalytic  95.2  0.0095 2.1E-07   38.3   1.2   22   43-64      1-22  (286)
157 cd05574 STKc_phototropin_like   95.2  0.0095 2.1E-07   39.3   1.2   22   43-64      1-22  (316)
158 cd07877 STKc_p38alpha_MAPK14 C  95.2  0.0082 1.8E-07   40.6   0.9   24   41-64     15-38  (345)
159 PLN00009 cyclin-dependent kina  95.2   0.011 2.4E-07   38.5   1.5   23   42-64      1-23  (294)
160 cd07880 STKc_p38gamma_MAPK12 C  95.2  0.0086 1.9E-07   40.5   1.0   22   42-63     14-35  (343)
161 cd05609 STKc_MAST Catalytic do  95.2  0.0097 2.1E-07   39.2   1.2   21   43-63      1-21  (305)
162 KOG0663|consensus               95.1  0.0054 1.2E-07   44.3  -0.1   24   41-64     74-97  (419)
163 KOG0589|consensus               95.1  0.0056 1.2E-07   44.6  -0.0   22   42-63      3-24  (426)
164 cd08224 STKc_Nek6_Nek7 Catalyt  95.1   0.012 2.5E-07   37.4   1.4   21   43-63      2-22  (267)
165 PRK13184 pknD serine/threonine  95.1  0.0095 2.1E-07   46.9   1.1   23   42-64      1-23  (932)
166 cd07854 STKc_MAPK4_6 Catalytic  95.1  0.0099 2.1E-07   40.1   1.1   22   43-64      5-26  (342)
167 cd05099 PTKc_FGFR4 Catalytic d  95.1  0.0072 1.6E-07   40.1   0.4   24   40-63      9-32  (314)
168 KOG0667|consensus               95.0  0.0084 1.8E-07   45.3   0.7   21   44-64    187-207 (586)
169 cd05056 PTKc_FAK Catalytic dom  95.0  0.0097 2.1E-07   38.2   0.9   24   40-63      3-26  (270)
170 cd06623 PKc_MAPKK_plant_like C  95.0   0.011 2.5E-07   37.4   1.2   22   43-64      1-22  (264)
171 cd05580 STKc_PKA Catalytic dom  95.0   0.011 2.4E-07   38.6   1.1   22   43-64      1-22  (290)
172 cd06625 STKc_MEKK3_like Cataly  95.0   0.015 3.3E-07   37.0   1.6   21   43-63      2-22  (263)
173 cd06621 PKc_MAPKK_Pek1_like Ca  95.0   0.011 2.5E-07   38.5   1.1   22   43-64      1-22  (287)
174 KOG0595|consensus               94.9   0.013 2.9E-07   42.7   1.5   23   41-63      8-30  (429)
175 cd06641 STKc_MST3 Catalytic do  94.9   0.011 2.4E-07   38.3   0.8   20   44-63      5-24  (277)
176 cd07868 STKc_CDK8 Catalytic do  94.9   0.013 2.9E-07   38.6   1.2   16   48-63      6-21  (317)
177 cd07858 STKc_TEY_MAPK_plant Ca  94.8   0.014   3E-07   39.3   1.2   22   43-64      5-26  (337)
178 cd05052 PTKc_Abl Catalytic dom  94.8  0.0098 2.1E-07   38.2   0.5   24   40-63      3-26  (263)
179 KOG0986|consensus               94.8   0.013 2.8E-07   43.9   1.1   26   37-62    179-204 (591)
180 KOG0666|consensus               94.8   0.011 2.4E-07   42.7   0.7   22   42-63     23-44  (438)
181 cd06637 STKc_TNIK Catalytic do  94.8  0.0096 2.1E-07   38.1   0.3   21   43-63      6-26  (272)
182 cd07856 STKc_Sty1_Hog1 Catalyt  94.7   0.013 2.9E-07   39.4   1.0   23   42-64      9-31  (328)
183 cd06609 STKc_MST3_like Catalyt  94.7   0.013 2.9E-07   37.7   0.9   22   43-64      1-22  (274)
184 cd06608 STKc_myosinIII_like Ca  94.7   0.015 3.3E-07   36.9   1.2   23   42-64      5-27  (275)
185 cd06636 STKc_MAP4K4_6 Catalyti  94.7   0.014 2.9E-07   37.8   0.9   24   41-64     14-37  (282)
186 KOG0597|consensus               94.7   0.013 2.9E-07   45.0   0.9   23   42-64      1-23  (808)
187 cd06656 STKc_PAK3 Catalytic do  94.7   0.014 3.1E-07   38.4   1.0   21   43-63     19-39  (297)
188 cd05080 PTKc_Tyk2_rpt2 Catalyt  94.6   0.018 3.9E-07   37.3   1.4   18   45-62      6-23  (283)
189 cd06613 STKc_MAP4K3_like Catal  94.6   0.016 3.6E-07   36.7   1.1   21   43-63      3-23  (262)
190 KOG0661|consensus               94.5  0.0085 1.8E-07   44.7  -0.4   23   41-63      8-30  (538)
191 cd06639 STKc_myosinIIIB Cataly  94.5   0.019   4E-07   37.4   1.3   22   42-63     21-42  (291)
192 KOG0198|consensus               94.5   0.018 3.9E-07   40.3   1.2   22   42-63     16-37  (313)
193 cd06611 STKc_SLK_like Catalyti  94.5    0.01 2.2E-07   38.3   0.0   21   43-63      5-25  (280)
194 cd06647 STKc_PAK_I Catalytic d  94.5   0.018 3.9E-07   37.9   1.2   22   42-63     18-39  (293)
195 cd07833 STKc_CDKL Catalytic do  94.4    0.02 4.3E-07   36.9   1.2   22   43-64      1-22  (288)
196 cd07855 STKc_ERK5 Catalytic do  94.4   0.019 4.1E-07   38.5   1.1   22   43-64      5-26  (334)
197 cd06640 STKc_MST4 Catalytic do  94.2   0.017 3.7E-07   37.4   0.6   22   43-64      4-25  (277)
198 cd07879 STKc_p38delta_MAPK13 C  94.2   0.021 4.6E-07   38.5   1.0   22   43-64     15-36  (342)
199 KOG0583|consensus               94.2   0.026 5.7E-07   39.9   1.5   24   40-63     14-37  (370)
200 cd05069 PTKc_Yes Catalytic dom  94.1    0.02 4.3E-07   36.7   0.7   23   41-63      4-26  (260)
201 cd07852 STKc_MAPK15 Catalytic   94.1   0.016 3.4E-07   38.8   0.3   23   42-64      6-28  (337)
202 cd06917 STKc_NAK1_like Catalyt  94.1   0.023 4.9E-07   36.6   1.0   20   44-63      2-21  (277)
203 cd06654 STKc_PAK1 Catalytic do  94.1   0.026 5.6E-07   37.2   1.2   22   42-63     19-40  (296)
204 PHA03211 serine/threonine kina  94.1   0.024 5.3E-07   40.9   1.2   23   42-64    168-190 (461)
205 KOG0593|consensus               94.0   0.024 5.2E-07   40.7   1.0   23   42-64      1-23  (396)
206 cd06612 STKc_MST1_2 Catalytic   94.0   0.027 5.8E-07   35.6   1.2   21   43-63      3-23  (256)
207 cd06607 STKc_TAO Catalytic dom  94.0   0.044 9.6E-07   36.1   2.2   22   42-63     14-35  (307)
208 cd07867 STKc_CDC2L6 Catalytic   93.9   0.028 6.1E-07   36.9   1.2   15   49-63      7-21  (317)
209 KOG0658|consensus               93.9   0.022 4.7E-07   40.9   0.7   20   44-63     25-44  (364)
210 KOG1163|consensus               93.9   0.022 4.8E-07   40.0   0.7   23   41-63     13-35  (341)
211 cd07851 STKc_p38 Catalytic dom  93.8   0.028   6E-07   38.0   1.0   24   41-64     13-36  (343)
212 KOG0614|consensus               93.7   0.069 1.5E-06   40.8   3.0   28   36-63    413-440 (732)
213 KOG0615|consensus               93.7   0.028 6.1E-07   41.4   0.9   22   42-63    171-192 (475)
214 cd06643 STKc_SLK Catalytic dom  93.5   0.025 5.5E-07   36.6   0.4   20   45-64      7-26  (282)
215 KOG0594|consensus               93.5   0.017 3.6E-07   40.9  -0.5   23   42-64     10-32  (323)
216 cd06629 STKc_MAPKKK_Bck1_like   93.5   0.041 8.8E-07   35.3   1.3   19   45-63      3-21  (272)
217 KOG1151|consensus               93.5   0.024 5.2E-07   42.8   0.3   22   43-64    463-484 (775)
218 KOG0576|consensus               93.4   0.026 5.7E-07   43.8   0.3   23   42-64     14-36  (829)
219 PHA03390 pk1 serine/threonine-  93.1   0.043 9.3E-07   35.6   1.0   21   43-63     14-36  (267)
220 KOG0611|consensus               93.0   0.028 6.1E-07   42.0  -0.0   22   43-64     53-74  (668)
221 cd06624 STKc_ASK Catalytic dom  93.0   0.066 1.4E-06   34.3   1.7   24   41-64      6-29  (268)
222 cd06642 STKc_STK25-YSK1 Cataly  92.9   0.028 6.1E-07   36.3  -0.1   22   43-64      4-25  (277)
223 cd06635 STKc_TAO1 Catalytic do  92.9   0.043 9.3E-07   36.5   0.8   21   43-63     25-45  (317)
224 KOG0032|consensus               92.8   0.049 1.1E-06   38.8   1.1   21   43-63     35-55  (382)
225 PTZ00024 cyclin-dependent prot  92.8   0.056 1.2E-06   36.1   1.2   22   43-64      8-30  (335)
226 KOG0194|consensus               92.8   0.055 1.2E-06   40.0   1.3   22   42-63    156-177 (474)
227 smart00090 RIO RIO-like kinase  92.7   0.051 1.1E-06   36.0   0.9   20   44-63     29-48  (237)
228 cd06655 STKc_PAK2 Catalytic do  92.5   0.049 1.1E-06   36.0   0.7   21   43-63     19-39  (296)
229 PRK10359 lipopolysaccharide co  92.4   0.072 1.6E-06   35.9   1.4   22   42-63     30-51  (232)
230 KOG0193|consensus               92.3   0.053 1.2E-06   41.5   0.7   22   42-63    391-412 (678)
231 PTZ00267 NIMA-related protein   92.1   0.055 1.2E-06   38.7   0.5   21   44-64     68-88  (478)
232 KOG0577|consensus               92.0   0.052 1.1E-06   42.2   0.4   20   45-64     28-47  (948)
233 cd05144 RIO2_C RIO kinase fami  91.6    0.11 2.3E-06   32.8   1.4   19   45-63     17-35  (198)
234 KOG0660|consensus               91.5   0.095 2.1E-06   37.7   1.2   22   43-64     22-43  (359)
235 KOG1026|consensus               91.3    0.05 1.1E-06   42.4  -0.4   24   40-63    483-506 (774)
236 cd06634 STKc_TAO2 Catalytic do  91.3   0.068 1.5E-06   35.4   0.3   22   43-64     15-36  (308)
237 cd06633 STKc_TAO3 Catalytic do  90.8    0.12 2.6E-06   34.4   1.1   19   45-63     23-41  (313)
238 cd06614 STKc_PAK Catalytic dom  90.7    0.12 2.6E-06   33.5   1.0   24   41-64     17-40  (286)
239 KOG0669|consensus               90.7   0.025 5.5E-07   40.0  -2.3   22   42-63     16-37  (376)
240 KOG1166|consensus               90.6    0.11 2.3E-06   41.5   0.9   23   41-63    696-718 (974)
241 KOG1187|consensus               90.5    0.15 3.3E-06   35.9   1.5   21   43-63     75-95  (361)
242 KOG0581|consensus               90.4    0.12 2.6E-06   37.2   0.9   25   39-63     75-99  (364)
243 KOG0575|consensus               90.0    0.15 3.2E-06   38.8   1.0   22   43-64     18-39  (592)
244 cd06659 STKc_PAK6 Catalytic do  89.8    0.13 2.9E-06   33.9   0.7   22   43-64     21-42  (297)
245 KOG0606|consensus               89.8    0.23 4.9E-06   40.4   2.0   26   39-64     79-104 (1205)
246 KOG1095|consensus               89.6    0.18 3.9E-06   40.5   1.3   23   40-62    689-711 (1025)
247 PLN00113 leucine-rich repeat r  89.6    0.18 3.8E-06   38.6   1.3   20   44-63    691-710 (968)
248 KOG0671|consensus               89.5    0.17 3.6E-06   37.0   1.0   23   42-64     88-110 (415)
249 cd06658 STKc_PAK5 Catalytic do  88.6    0.16 3.4E-06   33.5   0.4   21   43-63     22-42  (292)
250 KOG0197|consensus               88.6   0.091   2E-06   38.9  -0.9   20   44-63    207-226 (468)
251 cd06648 STKc_PAK_II Catalytic   88.4    0.21 4.6E-06   32.6   0.9   21   43-63     19-39  (285)
252 KOG0579|consensus               88.2    0.11 2.4E-06   40.9  -0.7   25   39-63     27-52  (1187)
253 cd06657 STKc_PAK4 Catalytic do  87.9    0.21 4.6E-06   32.9   0.7   20   44-63     21-40  (292)
254 KOG0586|consensus               87.9    0.29 6.2E-06   37.3   1.4   26   39-64     52-77  (596)
255 KOG4279|consensus               87.9    0.26 5.6E-06   39.2   1.2   15   50-64    582-596 (1226)
256 KOG0192|consensus               87.9    0.22 4.8E-06   35.3   0.7   24   40-63     38-61  (362)
257 PRK09605 bifunctional UGMP fam  87.4    0.34 7.4E-06   35.3   1.5   19   45-63    335-353 (535)
258 KOG0662|consensus               87.0    0.28   6E-06   33.5   0.8   21   43-63      2-22  (292)
259 PRK10345 hypothetical protein;  86.5    0.43 9.4E-06   31.3   1.5   17   45-61      4-20  (210)
260 KOG1345|consensus               85.9    0.27 5.8E-06   35.2   0.3   25   39-63     19-44  (378)
261 KOG3653|consensus               84.4    0.44 9.5E-06   35.8   0.8   23   41-63    208-230 (534)
262 KOG1290|consensus               83.6    0.49 1.1E-05   35.9   0.8   22   43-64     78-99  (590)
263 KOG2345|consensus               82.4     0.6 1.3E-05   32.8   0.8   25   39-63     17-41  (302)
264 PRK12274 serine/threonine prot  82.1    0.92   2E-05   30.5   1.6   20   45-64      4-23  (218)
265 PF13035 DUF3896:  Protein of u  81.2     3.2   7E-05   22.6   3.2   28    2-29     19-46  (61)
266 KOG0584|consensus               81.2    0.76 1.6E-05   35.3   1.0   15   50-64     47-61  (632)
267 KOG0668|consensus               81.0    0.27 5.8E-06   34.6  -1.3   23   41-63     36-58  (338)
268 KOG2052|consensus               80.4    0.73 1.6E-05   34.5   0.7   21   43-63    211-231 (513)
269 KOG4250|consensus               78.6       1 2.3E-05   35.1   1.1   18   46-63     16-33  (732)
270 KOG1165|consensus               77.5     1.2 2.7E-05   32.6   1.1   19   44-62     29-47  (449)
271 KOG0574|consensus               77.3    0.28   6E-06   35.7  -2.2   21   43-63     33-53  (502)
272 KOG1025|consensus               75.0     1.4 2.9E-05   35.7   0.8   19   45-63    698-716 (1177)
273 KOG1006|consensus               74.6    0.76 1.6E-05   32.8  -0.5   23   39-61     60-82  (361)
274 PHA02988 hypothetical protein;  74.4     1.4 3.1E-05   28.9   0.8   24   40-63     15-40  (283)
275 KOG1167|consensus               73.8    0.69 1.5E-05   34.0  -0.9   23   42-64     35-57  (418)
276 KOG0582|consensus               72.2     2.3 4.9E-05   32.0   1.4   25   39-63     22-46  (516)
277 PF11181 YflT:  Heat induced st  72.2     6.4 0.00014   22.9   3.1   25    2-26     71-95  (103)
278 KOG0200|consensus               71.7       2 4.3E-05   32.2   1.0   20   44-63    297-316 (609)
279 KOG4257|consensus               71.4     2.8 6.1E-05   33.2   1.8   16   48-63    394-409 (974)
280 KOG1989|consensus               71.0     2.2 4.7E-05   33.4   1.1   21   44-64     38-58  (738)
281 KOG0587|consensus               70.8     2.2 4.8E-05   34.2   1.2   23   41-63     17-39  (953)
282 PRK04750 ubiB putative ubiquin  70.8     2.3   5E-05   31.8   1.2   21   42-63    119-139 (537)
283 KOG1033|consensus               68.8     2.1 4.6E-05   32.2   0.7   23   40-62     46-68  (516)
284 KOG0596|consensus               68.0     2.1 4.5E-05   33.1   0.5   22   42-63    360-381 (677)
285 KOG4258|consensus               67.4     2.8   6E-05   33.8   1.0   15   48-62    999-1013(1025)
286 KOG4717|consensus               67.0     1.6 3.5E-05   33.9  -0.3   21   43-63     18-38  (864)
287 KOG0664|consensus               65.3     4.4 9.5E-05   29.3   1.6   23   42-64     52-74  (449)
288 KOG0199|consensus               64.2     4.8  0.0001   32.3   1.8   57    6-62     46-129 (1039)
289 KOG0196|consensus               62.5       4 8.7E-05   32.8   1.1   25   39-63    625-649 (996)
290 PF08988 DUF1895:  Protein of u  57.8      18 0.00039   20.1   3.0   44    3-48      3-46  (68)
291 PF02216 B:  B domain;  InterPr  56.9      17 0.00038   19.5   2.7   24    4-27     13-36  (54)
292 KOG0984|consensus               56.2     3.5 7.6E-05   28.6  -0.1   19   42-60     45-63  (282)
293 TIGR01982 UbiB 2-polyprenylphe  53.3     6.4 0.00014   28.4   0.8   20   43-63    118-137 (437)
294 KOG1094|consensus               51.4       8 0.00017   30.4   1.1   19   45-63    540-558 (807)
295 cd07921 PCA_45_Doxase_A_like S  50.8      19 0.00041   21.9   2.5   18    5-22     37-54  (106)
296 cd07321 Extradiol_Dioxygenase_  50.7      17 0.00037   20.4   2.2   19    4-22     26-44  (77)
297 cd07923 Gallate_dioxygenase_C   49.1      18 0.00039   21.5   2.2   20    3-22     27-46  (94)
298 KOG4236|consensus               48.2     7.3 0.00016   30.5   0.5   19   45-63    564-584 (888)
299 PF10346 Con-6:  Conidiation pr  45.8      39 0.00084   16.7   3.3   23    4-26     10-32  (36)
300 PF14167 YfkD:  YfkD-like prote  44.4      11 0.00024   25.6   0.8   13   50-62    181-193 (232)
301 KOG1024|consensus               44.2      12 0.00027   28.2   1.1   28   36-63    277-304 (563)
302 KOG4645|consensus               44.1      12 0.00026   31.6   1.2   14   50-63   1242-1255(1509)
303 cd07922 CarBa CarBa is the A s  43.7      25 0.00055   20.2   2.2   19    4-22     27-45  (81)
304 KOG0033|consensus               43.6     3.4 7.3E-05   29.4  -1.8   20   43-62     11-30  (355)
305 PF14531 Kinase-like:  Kinase-l  40.7     8.9 0.00019   26.7  -0.1   19   46-64     15-33  (288)
306 PF07746 LigA:  Aromatic-ring-o  40.5      34 0.00074   19.8   2.4   20    3-22     20-39  (88)
307 cd07925 LigA_like_1 The A subu  40.0      37  0.0008   20.6   2.6   18    5-22     37-54  (106)
308 KOG0983|consensus               37.8      14 0.00031   26.7   0.6   27   37-63     86-112 (391)
309 PF04201 TPD52:  Tumour protein  37.3      55  0.0012   21.3   3.2   22   10-31     23-44  (162)
310 PF14385 DUF4416:  Domain of un  37.0   1E+02  0.0022   19.9   4.4   51   13-63     68-133 (164)
311 PF08006 DUF1700:  Protein of u  34.8      77  0.0017   19.9   3.6   24    2-27      8-31  (181)
312 PF13019 Telomere_Sde2:  Telome  34.6      14 0.00029   24.0   0.1   10   50-59     86-95  (162)
313 PRK13378 protocatechuate 4,5-d  34.6      49  0.0011   20.4   2.5   18    5-22     48-65  (117)
314 PF03109 ABC1:  ABC1 family;  I  34.4      14  0.0003   22.0   0.1   19   44-63     13-31  (119)
315 PRK13379 protocatechuate 4,5-d  33.9      51  0.0011   20.4   2.5   19    4-22     48-66  (119)
316 COG2112 Predicted Ser/Thr prot  33.4      22 0.00048   23.9   0.9   16   48-63     27-42  (201)
317 TIGR02792 PCA_ligA protocatech  32.9      54  0.0012   20.2   2.5   18    5-22     42-59  (117)
318 cd07924 PCA_45_Doxase_A The A   31.8      59  0.0013   20.2   2.6   18    5-22     45-62  (121)
319 PRK11199 tyrA bifunctional cho  30.7   2E+02  0.0043   20.4   5.7   15   44-58     97-112 (374)
320 PRK13377 protocatechuate 4,5-d  29.4      67  0.0014   20.2   2.5   18    5-22     48-65  (129)
321 PF08312 cwf21:  cwf21 domain;   29.4      89  0.0019   16.0   2.9   25    3-27     15-39  (46)
322 KOG0590|consensus               28.6      20 0.00044   27.2   0.2   22   42-63     19-40  (601)
323 PF08278 DnaG_DnaB_bind:  DNA p  28.5      82  0.0018   18.4   2.8   21    3-23    105-125 (127)
324 PF13348 Y_phosphatase3C:  Tyro  28.5      98  0.0021   16.2   2.9   22    4-25     45-67  (68)
325 PF15188 CCDC-167:  Coiled-coil  28.0 1.2E+02  0.0027   17.5   3.4   23    2-24     22-44  (85)
326 PF06154 YagB_YeeU_YfjZ:  YagB/  26.8      40 0.00087   20.4   1.2   11   53-63     89-99  (103)
327 PF09845 DUF2072:  Zn-ribbon co  25.9      30 0.00066   21.7   0.6   17   41-57     82-98  (131)
328 PF10777 YlaC:  Inner membrane   25.7 1.2E+02  0.0026   19.6   3.3   27    2-28    113-139 (155)
329 TIGR02433 lysidine_TilS_C tRNA  25.0      45 0.00098   16.2   1.0   19    2-20     21-39  (47)
330 KOG0588|consensus               24.5      32 0.00069   27.4   0.6   23   41-63     10-32  (786)
331 TIGR03142 cytochro_ccmI cytoch  24.4 1.6E+02  0.0035   17.3   4.0   27    2-28     46-72  (117)
332 PF06570 DUF1129:  Protein of u  24.2 1.6E+02  0.0035   19.0   3.8   25    3-27     12-36  (206)
333 PF07798 DUF1640:  Protein of u  23.5 1.6E+02  0.0034   18.7   3.6   25    3-27      6-30  (177)
334 KOG0578|consensus               22.8      40 0.00088   25.8   0.8   23   42-64    272-294 (550)
335 PRK07668 hypothetical protein;  22.8 1.7E+02  0.0036   20.2   3.8   25    3-27     12-36  (254)
336 PF13095 FTA2:  Kinetochore Sim  22.8      56  0.0012   21.8   1.4   21   43-63     37-58  (207)
337 PF06371 Drf_GBD:  Diaphanous G  22.0 1.5E+02  0.0032   18.1   3.2   22    2-23     10-31  (187)
338 PF02750 Synapsin_C:  Synapsin,  20.8      49  0.0011   22.3   0.8   25   37-61     43-69  (203)
339 PF08671 SinI:  Anti-repressor   20.6 1.2E+02  0.0025   14.3   2.4   20    1-20      5-24  (30)

No 1  
>KOG0605|consensus
Probab=99.59  E-value=2e-15  Score=110.39  Aligned_cols=62  Identities=50%  Similarity=0.754  Sum_probs=59.9

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCccccccCCccceEeeec
Q psy17601          2 AKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus         2 ~~Le~~l~~~~l~~~~~~~~~~~~~~~e~~~~r~~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..||+.|+..+++++++...++.+.++|++|+|++|.+++++||+++++||+||||+||||+
T Consensus       100 ~~le~~l~~~~~s~~~~~~~~~~~~~kEte~lR~~R~r~~~~DFe~Lk~IgkGAfGeVrLar  161 (550)
T KOG0605|consen  100 KELEEKLASEDVSEEEQNELLKSLLSKETEYLRLRRTRLSLDDFELLKVIGKGAFGEVRLAR  161 (550)
T ss_pred             HHHHHHHhhccccHHHHHHHHHHHhhHHHHHHHhccccCCcccchhheeeccccceeEEEEE
Confidence            57999999999999999999999999999999999999999999999999999999999996


No 2  
>KOG0608|consensus
Probab=99.38  E-value=5.6e-13  Score=100.65  Aligned_cols=62  Identities=32%  Similarity=0.527  Sum_probs=60.5

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCccccccCCccceEeeec
Q psy17601          2 AKLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus         2 ~~Le~~l~~~~l~~~~~~~~~~~~~~~e~~~~r~~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++||++|...||++..++++++.+.++|++|.|++|.++..+.|-.|+.||=|+||+|.||+
T Consensus       588 ~QLEkEM~kagLpd~~q~qMrkmL~QKESnYiRLkRaKMdKSmFvkik~iGvGAFGeV~Lv~  649 (1034)
T KOG0608|consen  588 KQLEKEMVKAGLPDIMQNQMRKMLQQKESNYIRLKRAKMDKSMFVKIKTIGVGAFGEVCLVR  649 (1034)
T ss_pred             HHHHHHHHHhcCCHHHHHHHHHHHHhhhhhHHHHHHhhccccceEEEeeecccccceeEEEe
Confidence            58999999999999999999999999999999999999999999999999999999999985


No 3  
>KOG0612|consensus
Probab=98.36  E-value=3.6e-07  Score=72.27  Aligned_cols=55  Identities=36%  Similarity=0.496  Sum_probs=42.1

Q ss_pred             hcCCCCHHHHHHHHHHHHHH-HHHHHhhhccCCCCCCCCccccccCCccceEeeec
Q psy17601          9 KDESLSETQRQEKRQQHAQK-ETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus         9 ~~~~l~~~~~~~~~~~~~~~-e~~~~r~~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++..|.-.|..+.+.+... +...-.....+++.+||+++++||+|+||+|.||+
T Consensus        40 ~ec~~~~Lrr~k~i~~fl~~~kp~v~~v~~lrl~~~DfeilKvIGrGaFGEV~lVr   95 (1317)
T KOG0612|consen   40 DECDNSALRRDKNIAEFLNRYKPIVKKVKELRLKAEDFEILKVIGRGAFGEVALVR   95 (1317)
T ss_pred             HHhccHHHHhhhhHHHHHHHhHHHHHHHHHHhCCHHhhHHHHHhcccccceeEEEE
Confidence            45666666776666665554 44444566778999999999999999999999986


No 4  
>KOG0598|consensus
Probab=98.12  E-value=9.4e-07  Score=62.74  Aligned_cols=25  Identities=48%  Similarity=0.804  Sum_probs=23.5

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+++||+++++||+|+||+|++|+
T Consensus        21 ~~~~~dF~~lkviGkG~fGkV~~Vr   45 (357)
T KOG0598|consen   21 MVGPDDFEILKVIGKGSFGKVFQVR   45 (357)
T ss_pred             cCChhheeeeeeeeccCCceEEEEE
Confidence            5789999999999999999999986


No 5  
>KOG0616|consensus
Probab=98.00  E-value=6.7e-06  Score=58.06  Aligned_cols=44  Identities=23%  Similarity=0.437  Sum_probs=30.9

Q ss_pred             HHHHHHHHHHHHHHhh----hccCCCCCCCCccccccCCccceEeeec
Q psy17601         20 EKRQQHAQKETEFLRL----KRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        20 ~~~~~~~~~e~~~~r~----~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .....+.+...+|...    ..+..+++||+++++||.|+||+|+||+
T Consensus        17 ~~~~~l~~~~~~~~~~~~~~~~~~~~l~dfe~~~tlGtGSFGrV~LVr   64 (355)
T KOG0616|consen   17 SVKEFLDKAREDFPKKWANTPQNPYSLQDFERLKTLGTGSFGRVHLVR   64 (355)
T ss_pred             HHHHHHHHHHHhhhhhhcCCCCCCcchhhhhheeeeccCccceEEEEE
Confidence            3344444444444432    2223789999999999999999999997


No 6  
>KOG0694|consensus
Probab=97.93  E-value=4e-06  Score=63.51  Aligned_cols=26  Identities=38%  Similarity=0.677  Sum_probs=24.2

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+++++||..+++||+|+||+|+||.
T Consensus       363 ~~~~l~~F~~l~vLGkGsFGkV~lae  388 (694)
T KOG0694|consen  363 GPLTLDDFRLLAVLGRGSFGKVLLAE  388 (694)
T ss_pred             CcccccceEEEEEeccCcCceEEEEE
Confidence            47899999999999999999999985


No 7  
>KOG0580|consensus
Probab=97.79  E-value=1e-05  Score=55.71  Aligned_cols=27  Identities=26%  Similarity=0.450  Sum_probs=24.7

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .....++||++-++||+|.||+||||+
T Consensus        16 ~~~~~l~dfeigr~LgkgkFG~vYlar   42 (281)
T KOG0580|consen   16 TKTWTLDDFEIGRPLGKGKFGNVYLAR   42 (281)
T ss_pred             ccccchhhccccccccCCccccEeEee
Confidence            346889999999999999999999997


No 8  
>KOG0696|consensus
Probab=97.77  E-value=9.7e-06  Score=59.95  Aligned_cols=26  Identities=35%  Similarity=0.616  Sum_probs=23.5

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+.++||+.+.+||+|+||+|+||.+
T Consensus       345 ~i~~tDFnFl~VlGKGSFGKVlLaer  370 (683)
T KOG0696|consen  345 RIKATDFNFLMVLGKGSFGKVLLAER  370 (683)
T ss_pred             ceeecccceEEEeccCccceeeeecc
Confidence            56778999999999999999999964


No 9  
>KOG0690|consensus
Probab=97.49  E-value=3.7e-05  Score=55.60  Aligned_cols=27  Identities=37%  Similarity=0.711  Sum_probs=24.3

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.++.++||+.+++||+|.||+|-|++
T Consensus       162 ~~kvTm~dFdfLKvLGkGTFGKVIL~r  188 (516)
T KOG0690|consen  162 KNKVTMEDFDFLKVLGKGTFGKVILCR  188 (516)
T ss_pred             cceeccchhhHHHHhcCCccceEEEEe
Confidence            446788999999999999999999986


No 10 
>KOG0591|consensus
Probab=97.27  E-value=4.1e-05  Score=54.16  Aligned_cols=27  Identities=41%  Similarity=0.598  Sum_probs=24.0

Q ss_pred             cCCCCCCCCccccccCCccceEeeecC
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+..+.||++++.||+|+||+||.|.+
T Consensus        14 ~~~~l~~y~Il~~IG~GsFg~vykv~~   40 (375)
T KOG0591|consen   14 PQKTLADYQILKKIGRGSFGEVYKVQC   40 (375)
T ss_pred             CcccHHHHHHHHHHcCCcchheEEeee
Confidence            467789999999999999999999863


No 11 
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=97.15  E-value=0.00017  Score=49.17  Aligned_cols=22  Identities=68%  Similarity=0.989  Sum_probs=20.1

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +||++++.||+|+||+||+|.+
T Consensus         1 ~~y~~~~~LG~G~~g~V~~~~~   22 (363)
T cd05628           1 EDFESLKVIGRGAFGEVRLVQK   22 (363)
T ss_pred             CCceEeEEEEeCCCEEEEEEEE
Confidence            5899999999999999999863


No 12 
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=97.14  E-value=0.00017  Score=48.82  Aligned_cols=22  Identities=59%  Similarity=0.957  Sum_probs=20.0

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~lG~G~~g~V~~~~~   22 (364)
T cd05599           1 DDFESIKVIGRGAFGEVRLVQK   22 (364)
T ss_pred             CCceEEEEEEecCCEEEEEEEE
Confidence            5899999999999999999863


No 13 
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=97.12  E-value=0.00044  Score=47.73  Aligned_cols=35  Identities=37%  Similarity=0.656  Sum_probs=27.5

Q ss_pred             HHHHHhhhccCCCCCCCCccccccCCccceEeeec
Q psy17601         29 ETEFLRLKRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        29 e~~~~r~~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.............++|++++.||+|+||.||+|.
T Consensus        29 ~~~~~~~~~~~~~~~~y~~~~~lG~G~fg~Vy~~~   63 (370)
T cd05621          29 EKIVRKIRKLQMKAEDYDVVKVIGRGAFGEVQLVR   63 (370)
T ss_pred             HHHHHHHHhcCCCHHHCeEEEEEEecCCeEEEEEE
Confidence            33333445556778999999999999999999986


No 14 
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=97.10  E-value=0.00019  Score=49.24  Aligned_cols=22  Identities=36%  Similarity=0.526  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||+||+|.+
T Consensus         1 ~~f~~~~~LG~G~~g~Vy~~~~   22 (381)
T cd05626           1 SMFVKIKTLGIGAFGEVCLACK   22 (381)
T ss_pred             CCceEEEEEeecCCEEEEEEEE
Confidence            4799999999999999999863


No 15 
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=97.07  E-value=0.00022  Score=48.59  Aligned_cols=22  Identities=41%  Similarity=0.505  Sum_probs=20.1

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~lG~G~~g~V~~a~~   22 (376)
T cd05598           1 SMFVKIKTIGIGAFGEVCLVRK   22 (376)
T ss_pred             CCceEEEEEEeCCCeEEEEEEE
Confidence            5899999999999999999863


No 16 
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=97.06  E-value=0.00022  Score=48.81  Aligned_cols=22  Identities=36%  Similarity=0.507  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|++
T Consensus         1 ~~f~~~~~LG~G~~g~Vy~a~~   22 (382)
T cd05625           1 SMFVKIKTLGIGAFGEVCLARK   22 (382)
T ss_pred             CCcEEEEEEEeCCCEEEEEEEE
Confidence            4699999999999999999863


No 17 
>KOG1035|consensus
Probab=97.01  E-value=0.00018  Score=57.74  Aligned_cols=22  Identities=41%  Similarity=0.830  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++||+.+.+||+||||.|++|+
T Consensus       478 ~~DFEEL~lLGkGGFG~VvkVR  499 (1351)
T KOG1035|consen  478 LNDFEELELLGKGGFGSVVKVR  499 (1351)
T ss_pred             hhhhHHHHHhcCCCCceEEEEe
Confidence            4799999999999999999986


No 18 
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=97.01  E-value=0.00027  Score=46.78  Aligned_cols=26  Identities=35%  Similarity=0.463  Sum_probs=23.4

Q ss_pred             cCCCCCCCCccccccCCccceEeeec
Q psy17601         38 SRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        38 ~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.+..++|++.+.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~~~lg~G~~g~V~~a~   27 (303)
T cd05088           2 PVLEWNDIKFQDVIGEGNFGQVLKAR   27 (303)
T ss_pred             CccchhhceeeeeecCCCCceEEEEE
Confidence            35778899999999999999999986


No 19 
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=97.01  E-value=0.00036  Score=48.00  Aligned_cols=29  Identities=48%  Similarity=0.785  Sum_probs=25.0

Q ss_pred             hccCCCCCCCCccccccCCccceEeeecC
Q psy17601         36 KRSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        36 ~~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ....++.++|++++.||+|+||.||+|.+
T Consensus        36 ~~~~~~~~~y~~~~~lg~G~~g~Vy~~~~   64 (370)
T cd05596          36 TKLRMKAEDFDVIKVIGRGAFGEVQLVRH   64 (370)
T ss_pred             ccCCCCHHHcEEEEEEeeCCCEEEEEEEE
Confidence            44567889999999999999999999863


No 20 
>PHA02882 putative serine/threonine kinase; Provisional
Probab=97.00  E-value=0.00028  Score=46.65  Aligned_cols=23  Identities=26%  Similarity=0.365  Sum_probs=20.3

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .-..|.+.+.||+|+||.||+|.
T Consensus        10 ~~~~y~i~~~LG~G~fG~Vy~~~   32 (294)
T PHA02882         10 TGKEWKIDKLIGCGGFGCVYETQ   32 (294)
T ss_pred             CCCceEEeeEEecCCCceEEEEE
Confidence            34679999999999999999985


No 21 
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=96.98  E-value=0.00029  Score=47.45  Aligned_cols=22  Identities=59%  Similarity=0.880  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 d~y~i~~~lG~G~fg~V~~~~~   22 (331)
T cd05624           1 DDFEIIKVIGRGAFGEVAVVKM   22 (331)
T ss_pred             CCceEEEEEeeCCCeEEEEEEE
Confidence            5899999999999999999863


No 22 
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=96.97  E-value=0.0003  Score=47.77  Aligned_cols=21  Identities=67%  Similarity=1.013  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++++.||+|+||.||+|.
T Consensus         1 ~~f~~~~~lG~G~~g~V~~~~   21 (360)
T cd05627           1 DDFESLKVIGRGAFGEVRLVQ   21 (360)
T ss_pred             CCceEEEEEeeCCCEEEEEEE
Confidence            589999999999999999986


No 23 
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=96.97  E-value=0.00038  Score=51.33  Aligned_cols=28  Identities=36%  Similarity=0.427  Sum_probs=24.5

Q ss_pred             ccCCCCCCCCccccccCCccceEeeecC
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.....++|.+.+.||+|+||.||+|.+
T Consensus       126 ~~~~~~~~y~l~~~LG~G~FG~VYka~~  153 (566)
T PLN03225        126 RPSFKKDDFVLGKKLGEGAFGVVYKASL  153 (566)
T ss_pred             CCCCccCCeEEeEEEeeCCCeEEEEEEE
Confidence            4566789999999999999999999863


No 24 
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=96.96  E-value=0.00033  Score=47.41  Aligned_cols=23  Identities=30%  Similarity=0.429  Sum_probs=20.6

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|.+.+.||+|+||.||+|.
T Consensus         5 ~~~~~~~~~~lG~G~fg~V~~~~   27 (343)
T cd05103           5 PRDRLKLGKPLGRGAFGQVIEAD   27 (343)
T ss_pred             chhHhcccccccCCccceEEEEe
Confidence            44689999999999999999985


No 25 
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=96.92  E-value=0.0005  Score=50.53  Aligned_cols=27  Identities=30%  Similarity=0.501  Sum_probs=23.6

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.+++.++|.+.+.||+|+||.||.+.
T Consensus       139 ~~r~~~d~F~i~~~LG~GgFG~VYkG~  165 (507)
T PLN03224        139 NSRWSSDDFQLRDKLGGGNFGITFEGL  165 (507)
T ss_pred             CCCccccCceEeeEeecCCCeEEEEEE
Confidence            346788999999999999999999864


No 26 
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=96.88  E-value=0.00039  Score=46.82  Aligned_cols=29  Identities=28%  Similarity=0.438  Sum_probs=25.0

Q ss_pred             hccCCCCCCCCccccccCCccceEeeecC
Q psy17601         36 KRSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        36 ~~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ......+++|.+.+.||+|+||.||+|.+
T Consensus        11 ~~~~~~~~~y~~~~~lg~G~~g~V~~~~~   39 (329)
T PTZ00263         11 DTSSWKLSDFEMGETLGTGSFGRVRIAKH   39 (329)
T ss_pred             ccCCCCchheEEEEEEEecCCeEEEEEEE
Confidence            34567789999999999999999999863


No 27 
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=96.86  E-value=0.0004  Score=46.46  Aligned_cols=24  Identities=29%  Similarity=0.475  Sum_probs=20.9

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||.|+||.||+|.
T Consensus         4 ~~~~~~~~~~~lG~G~fg~Vy~~~   27 (338)
T cd05102           4 FPRDRLRLGKVLGHGAFGKVVEAS   27 (338)
T ss_pred             cchhHceeeeEeccCCcceEEEEE
Confidence            345789999999999999999984


No 28 
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=96.86  E-value=0.00037  Score=44.58  Aligned_cols=24  Identities=21%  Similarity=0.382  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +++++|.+++.||+|+||.||+|.
T Consensus         1 ~~~~~~~~~~~lg~G~~~~vy~~~   24 (256)
T cd05114           1 INPSELTFMKELGSGQFGVVHLGK   24 (256)
T ss_pred             CCHHHcEEeeEecCCcCceEEEEE
Confidence            356889999999999999999875


No 29 
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=96.85  E-value=0.00044  Score=46.59  Aligned_cols=21  Identities=67%  Similarity=0.988  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++++.||+|+||.||+|.
T Consensus         1 ~~y~~~~~lG~G~~g~V~~~~   21 (331)
T cd05597           1 DDFEILKVIGRGAFGEVAVVK   21 (331)
T ss_pred             CCceEEEEEEecCCeEEEEEE
Confidence            589999999999999999986


No 30 
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=96.84  E-value=0.00059  Score=44.37  Aligned_cols=22  Identities=36%  Similarity=0.635  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+|.+++.||+|+||.||+|.+
T Consensus         1 ~~Y~~~~~lg~G~~g~Vy~~~~   22 (290)
T cd07862           1 QQYECVAEIGEGAYGKVFKARD   22 (290)
T ss_pred             CCcceeeEeccCCCeEEEEEEE
Confidence            4699999999999999999863


No 31 
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=96.83  E-value=0.0011  Score=45.77  Aligned_cols=29  Identities=48%  Similarity=0.757  Sum_probs=25.0

Q ss_pred             hccCCCCCCCCccccccCCccceEeeecC
Q psy17601         36 KRSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        36 ~~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ....+..++|.+++.||+|+||.||+|.+
T Consensus        36 ~~~~~~~~~y~i~~~lG~G~fg~Vy~~~~   64 (371)
T cd05622          36 RDLRMKAEDYEVVKVIGRGAFGEVQLVRH   64 (371)
T ss_pred             hhcCcchhhcEEEEEEeecCCeEEEEEEE
Confidence            34567789999999999999999999863


No 32 
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=96.83  E-value=0.00047  Score=44.40  Aligned_cols=24  Identities=25%  Similarity=0.506  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|.+++.||.|+||.||+|+
T Consensus         2 ~~~~~~~~~~~lg~g~~g~v~~~~   25 (275)
T cd05046           2 FPRSNLQEITTLGRGEFGEVFLAK   25 (275)
T ss_pred             CChHhceeeeeecccceeEEEEEE
Confidence            345899999999999999999986


No 33 
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=96.82  E-value=0.00044  Score=47.13  Aligned_cols=27  Identities=26%  Similarity=0.618  Sum_probs=23.9

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+..++|.+++.||+|+||.||+|.
T Consensus        24 ~~~~~~~~y~~~~~ig~G~~g~Vy~a~   50 (340)
T PTZ00426         24 KNKMKYEDFNFIRTLGTGSFGRVILAT   50 (340)
T ss_pred             CCCCChhhcEEEEEEeecCCeEEEEEE
Confidence            346778999999999999999999985


No 34 
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=96.81  E-value=0.00058  Score=44.97  Aligned_cols=22  Identities=36%  Similarity=0.700  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~G~~g~Vy~~~~   22 (291)
T cd05612           1 DDLERIKTVGTGTFGRVHLVRD   22 (291)
T ss_pred             CCceeeeeeecCCCeEEEEEEE
Confidence            5799999999999999999863


No 35 
>PTZ00284 protein kinase; Provisional
Probab=96.79  E-value=0.00051  Score=48.56  Aligned_cols=23  Identities=30%  Similarity=0.676  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+|.+++.||+|+||.||+|.+
T Consensus       128 ~~~y~i~~~lG~G~fg~V~~a~~  150 (467)
T PTZ00284        128 TQRFKILSLLGEGTFGKVVEAWD  150 (467)
T ss_pred             CCcEEEEEEEEeccCEEEEEEEE
Confidence            46799999999999999999864


No 36 
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=96.78  E-value=0.00059  Score=44.01  Aligned_cols=22  Identities=36%  Similarity=0.687  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +||.+++.||.|+||.||+|.+
T Consensus         1 ~~~~~~~~ig~g~~g~v~~~~~   22 (283)
T cd06617           1 DDLEVIEELGRGAYGVVDKMRH   22 (283)
T ss_pred             CCceEEEEecccCCeEEEEEEE
Confidence            5899999999999999999863


No 37 
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=96.78  E-value=0.00056  Score=46.00  Aligned_cols=21  Identities=71%  Similarity=1.002  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+++.||+|+||.||++.
T Consensus         1 ~~y~~~~~lG~G~fg~V~~~~   21 (332)
T cd05623           1 EDFEILKVIGRGAFGEVAVVK   21 (332)
T ss_pred             CCceEEEEEEeCCCeEEEEEE
Confidence            589999999999999999985


No 38 
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=96.76  E-value=0.00062  Score=44.68  Aligned_cols=24  Identities=21%  Similarity=0.398  Sum_probs=21.5

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+++|.+++.||.|+||.||+|.+
T Consensus         3 ~~~~y~~~~~lg~G~~g~Vy~~~~   26 (288)
T cd07871           3 KLETYVKLDKLGEGTYATVFKGRS   26 (288)
T ss_pred             ccccceEeeEEecCCCEEEEEEEE
Confidence            568899999999999999999863


No 39 
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=96.75  E-value=0.00062  Score=44.91  Aligned_cols=23  Identities=22%  Similarity=0.512  Sum_probs=20.9

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|++++.||.|+||.||+|.+
T Consensus         4 ~~~y~~~~~lg~G~~g~V~~~~~   26 (303)
T cd07869           4 ADSYEKLEKLGEGSYATVYKGKS   26 (303)
T ss_pred             cccceEeeeEEecCCEEEEEEEE
Confidence            47899999999999999999864


No 40 
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=96.75  E-value=0.00071  Score=45.49  Aligned_cols=25  Identities=32%  Similarity=0.438  Sum_probs=22.0

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +..++|++++.||+|+||.||+|.+
T Consensus         2 l~~~~y~~~~~lg~G~~g~V~~~~~   26 (331)
T cd06649           2 LKDDDFERISELGAGNGGVVTKVQH   26 (331)
T ss_pred             CCcccceEEEeecCCCCEEEEEEEE
Confidence            4568999999999999999999863


No 41 
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=96.72  E-value=0.00066  Score=45.09  Aligned_cols=24  Identities=42%  Similarity=0.751  Sum_probs=21.5

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|..++.||+|+||.||+|.
T Consensus         4 ~~~~~f~~~~~lg~G~~g~Vy~~~   27 (316)
T cd05108           4 LKETEFKKIKVLGSGAFGTVYKGL   27 (316)
T ss_pred             cchhhceeeeeeecCCCceEEEEE
Confidence            456799999999999999999985


No 42 
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=96.72  E-value=0.00065  Score=46.42  Aligned_cols=21  Identities=57%  Similarity=0.906  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+++.||.|+||.||+|.
T Consensus         1 ~~y~~~~~lG~G~~g~Vy~~~   21 (377)
T cd05629           1 EDFHTVKVIGKGAFGEVRLVQ   21 (377)
T ss_pred             CCceEeEEEeecCCEEEEEEE
Confidence            479999999999999999985


No 43 
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=96.70  E-value=0.0006  Score=44.10  Aligned_cols=24  Identities=29%  Similarity=0.457  Sum_probs=21.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.++||++++.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~G~~g~Vy~~~   25 (283)
T cd05048           2 IPLSAVRFLEELGEGAFGKVYKGE   25 (283)
T ss_pred             CChHHcchhhcccCccCCcEEEEE
Confidence            567899999999999999999875


No 44 
>PHA03210 serine/threonine kinase US3; Provisional
Probab=96.69  E-value=0.0007  Score=48.77  Aligned_cols=22  Identities=23%  Similarity=0.335  Sum_probs=19.7

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++|.+++.||+|+||+||+|.
T Consensus       147 ~~~Y~ii~~LG~G~fG~Vyl~~  168 (501)
T PHA03210        147 LAHFRVIDDLPAGAFGKIFICA  168 (501)
T ss_pred             hhccEEEeEecCCCCcceEEEE
Confidence            4689999999999999999864


No 45 
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=96.69  E-value=0.00079  Score=44.32  Aligned_cols=24  Identities=21%  Similarity=0.217  Sum_probs=20.8

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~G~fg~V~~~~   25 (304)
T cd05096           2 FPRGHLLFKEKLGEGQFGEVHLCE   25 (304)
T ss_pred             CchhhCeeeeEecccCCeEEEEEE
Confidence            345789999999999999999985


No 46 
>PHA03212 serine/threonine kinase US3; Provisional
Probab=96.68  E-value=0.00088  Score=46.75  Aligned_cols=26  Identities=27%  Similarity=0.235  Sum_probs=22.8

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+...+|.+++.||+|+||.||+|+|
T Consensus        88 ~~~~~~y~~~~~lg~G~~g~V~~~~d  113 (391)
T PHA03212         88 GIEKAGFSILETFTPGAEGFAFACID  113 (391)
T ss_pred             ccccCCcEEEEEEcCCCCeEEEEEEE
Confidence            45667899999999999999999874


No 47 
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=96.68  E-value=0.00069  Score=45.32  Aligned_cols=22  Identities=64%  Similarity=0.918  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~G~~g~Vy~~~~   22 (350)
T cd05573           1 DDFEVIKVIGRGAFGEVWLVRD   22 (350)
T ss_pred             CCceEEEEEEeCCcEEEEEEEE
Confidence            4799999999999999999864


No 48 
>KOG0585|consensus
Probab=96.64  E-value=0.00082  Score=50.11  Aligned_cols=26  Identities=31%  Similarity=0.572  Sum_probs=23.7

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +..+++|++++-||+|.||+|.||++
T Consensus        93 ~k~lNqy~l~~eiG~G~yGkVkLar~  118 (576)
T KOG0585|consen   93 RKQLNQYELIKEIGSGQYGKVKLARD  118 (576)
T ss_pred             ceehhheehhhhhcCCccceEEEEee
Confidence            45788999999999999999999985


No 49 
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=96.64  E-value=0.00083  Score=43.03  Aligned_cols=24  Identities=29%  Similarity=0.420  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++++.||.|+||.||+|.
T Consensus         3 ~~~~~~~~~~~ig~G~~g~v~~~~   26 (260)
T cd05067           3 VPRETLKLVKKLGAGQFGEVWMGY   26 (260)
T ss_pred             cchHHceeeeeeccCccceEEeee
Confidence            455789999999999999999986


No 50 
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=96.63  E-value=0.001  Score=43.24  Aligned_cols=24  Identities=21%  Similarity=0.342  Sum_probs=21.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...++|.+++.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~G~~g~v~~~~   25 (296)
T cd05051           2 FPRQPLNFVEKLGEGQFGEVHLCE   25 (296)
T ss_pred             CchhhCcccccccCCCCccEEEEE
Confidence            345789999999999999999875


No 51 
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=96.62  E-value=0.00081  Score=43.87  Aligned_cols=24  Identities=38%  Similarity=0.678  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+++.||+|+||.||+|.
T Consensus         4 ~~~~~~~~~~~lg~G~~~~vy~~~   27 (279)
T cd05111           4 LKETELRKLKLLGSGVFGTVHKGI   27 (279)
T ss_pred             CCHhhceeccccCccCCcceEEEE
Confidence            456899999999999999999875


No 52 
>KOG0600|consensus
Probab=96.61  E-value=0.00039  Score=51.80  Aligned_cols=26  Identities=31%  Similarity=0.579  Sum_probs=23.3

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ....+.|+.|..||+|+||+||.|+|
T Consensus       113 ~r~~~~feki~kIGeGTyg~VYkAr~  138 (560)
T KOG0600|consen  113 PRRADSFEKIEKIGEGTYGQVYKARD  138 (560)
T ss_pred             ccchHHHHHHHHhcCcchhheeEeee
Confidence            44678999999999999999999986


No 53 
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=96.58  E-value=0.00089  Score=43.02  Aligned_cols=23  Identities=35%  Similarity=0.384  Sum_probs=20.7

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|.+...||+|+||.||.|.
T Consensus         2 ~~~~~~~~~~lg~g~~g~vy~~~   24 (266)
T cd05033           2 DPSYVTIEKVIGGGEFGEVCRGR   24 (266)
T ss_pred             ChHHceeeeEecCCccceEEEEE
Confidence            46789999999999999999875


No 54 
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=96.56  E-value=0.00096  Score=45.07  Aligned_cols=24  Identities=33%  Similarity=0.439  Sum_probs=21.2

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -.++|.+++.||+|+||.||+|.+
T Consensus        15 ~~~~y~~~~~lg~G~~g~V~~~~~   38 (355)
T cd07874          15 VLKRYQNLKPIGSGAQGIVCAAYD   38 (355)
T ss_pred             hhhceeEEEEeeecCCEEEEEEEe
Confidence            357899999999999999999864


No 55 
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=96.52  E-value=0.0013  Score=43.55  Aligned_cols=25  Identities=20%  Similarity=0.320  Sum_probs=21.8

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+++|.+++.||+|+||.||+|.+
T Consensus         3 ~~~~~y~~~~~lg~G~~g~Vy~~~~   27 (309)
T cd07872           3 GKMETYIKLEKLGEGTYATVFKGRS   27 (309)
T ss_pred             CCCCceEEEEEecccCCEEEEEEEe
Confidence            3568899999999999999999863


No 56 
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=96.52  E-value=0.001  Score=44.53  Aligned_cols=22  Identities=27%  Similarity=0.582  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~ig~G~~g~Vy~~~~   22 (333)
T cd05600           1 KDFQILTQVGQGGYGQVFLAKK   22 (333)
T ss_pred             CCcEEEEEEeecCCeEEEEEEE
Confidence            4799999999999999999863


No 57 
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=96.51  E-value=0.00067  Score=44.18  Aligned_cols=24  Identities=33%  Similarity=0.436  Sum_probs=21.5

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|++++.||+|+||.||+|.
T Consensus         2 l~~~~~~~~~~ig~g~~g~v~~~~   25 (284)
T cd06620           2 LRNEDLETISDLGAGNGGSVSKVK   25 (284)
T ss_pred             ccHHHHHHHHHcCCCCCeEEEEEE
Confidence            456799999999999999999986


No 58 
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=96.49  E-value=0.0012  Score=42.75  Aligned_cols=24  Identities=42%  Similarity=0.685  Sum_probs=21.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|++++.||.|+||.||.|.
T Consensus         4 l~~~~~~~~~~lg~G~~g~vy~~~   27 (279)
T cd05109           4 LKETELKKVKVLGSGAFGTVYKGI   27 (279)
T ss_pred             cchhheeeeeecCCCCCceEEEEE
Confidence            467899999999999999999885


No 59 
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=96.49  E-value=0.0012  Score=42.93  Aligned_cols=24  Identities=25%  Similarity=0.329  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.+++|++.+.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~g~~g~vy~~~   25 (283)
T cd05090           2 LPLSAVRFMEELGECAFGKIYKGH   25 (283)
T ss_pred             CChhhceeeeeccccCCcceEEEE
Confidence            456899999999999999999974


No 60 
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=96.46  E-value=0.0011  Score=44.93  Aligned_cols=23  Identities=35%  Similarity=0.540  Sum_probs=20.8

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||+|.+
T Consensus        20 ~~~y~~~~~lg~G~~g~V~~~~~   42 (359)
T cd07876          20 LKRYQQLKPIGSGAQGIVCAAFD   42 (359)
T ss_pred             hhceEEEEEeecCCCEEEEEEEE
Confidence            57899999999999999999864


No 61 
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=96.46  E-value=0.0013  Score=42.66  Aligned_cols=22  Identities=41%  Similarity=0.629  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~g~~~~v~~~~~   22 (287)
T cd07848           1 NKFEVLGVVGEGAYGVVLKCRH   22 (287)
T ss_pred             CCceEEEEecccCCEEEEEEEE
Confidence            4799999999999999999863


No 62 
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=96.45  E-value=0.0014  Score=44.19  Aligned_cols=25  Identities=32%  Similarity=0.392  Sum_probs=21.8

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +..++|++++.||.|+||.||+|.+
T Consensus         2 l~~~~y~~~~~lg~g~~g~V~~~~~   26 (333)
T cd06650           2 LKDDDFEKISELGAGNGGVVFKVSH   26 (333)
T ss_pred             cchhhhheeccccCCCCEEEEEEEE
Confidence            3458999999999999999999863


No 63 
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=96.45  E-value=0.0013  Score=43.24  Aligned_cols=25  Identities=20%  Similarity=0.323  Sum_probs=22.0

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+++|.+++.||.|+||.||+|.+
T Consensus         3 ~~~~~y~~~~~lg~g~~g~vy~~~~   27 (301)
T cd07873           3 GKLETYIKLDKLGEGTYATVYKGRS   27 (301)
T ss_pred             ccccceEEeeEeccCcCEEEEEEEE
Confidence            3578999999999999999999853


No 64 
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=96.44  E-value=0.0011  Score=44.93  Aligned_cols=21  Identities=33%  Similarity=0.555  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|++.+.||.|+||.||+|.
T Consensus         7 ~~~~i~~~lG~G~fg~Vy~a~   27 (337)
T cd05054           7 DRLKLGKPLGRGAFGKVIQAS   27 (337)
T ss_pred             HHhhhhcccccCcCceEEecc
Confidence            589999999999999999985


No 65 
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=96.44  E-value=0.0014  Score=42.94  Aligned_cols=23  Identities=22%  Similarity=0.309  Sum_probs=20.3

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|++.+.||+|+||.||+|.
T Consensus         3 ~~~~~~~~~~lg~G~~g~v~~~~   25 (295)
T cd05097           3 PRQQLRLKEKLGEGQFGEVHLCE   25 (295)
T ss_pred             chHhCeehhccCCCCCceEEecc
Confidence            34689999999999999999875


No 66 
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=96.44  E-value=0.0011  Score=42.38  Aligned_cols=24  Identities=29%  Similarity=0.427  Sum_probs=21.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+++.||.|+||.||+|.
T Consensus         3 ~~~~~~~~~~~lg~g~~g~v~~~~   26 (261)
T cd05072           3 IPRESIKLVKKLGAGQFGEVWMGY   26 (261)
T ss_pred             CchHHeEEeeecCCcCCceEEEEE
Confidence            467899999999999999999985


No 67 
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=96.43  E-value=0.0012  Score=42.84  Aligned_cols=22  Identities=27%  Similarity=0.647  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||.|+||.||+|.+
T Consensus         1 ~~~~~~~~ig~g~~g~v~~~~~   22 (286)
T cd06622           1 DEIEVLDELGKGNYGSVYKVLH   22 (286)
T ss_pred             ChhhhhhhhcccCCeEEEEEEE
Confidence            5799999999999999999863


No 68 
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=96.41  E-value=0.0013  Score=43.92  Aligned_cols=22  Identities=36%  Similarity=0.723  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+++.||+|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~G~~g~Vy~~~~   22 (330)
T cd05601           1 KDFDVKSLVGRGHFGEVQVVRE   22 (330)
T ss_pred             CCceEEEEEEeccCEEEEEEEE
Confidence            4799999999999999999863


No 69 
>PRK09188 serine/threonine protein kinase; Provisional
Probab=96.39  E-value=0.0014  Score=46.42  Aligned_cols=24  Identities=17%  Similarity=0.192  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .-.++|.+...||+|+||+||+|+
T Consensus        15 ~~~~~Y~~~~~IG~G~fg~Vy~a~   38 (365)
T PRK09188         15 ALSARFVETAVLKRDVFSTVERGY   38 (365)
T ss_pred             cccCCceEccEEeecCcEEEEEEE
Confidence            345789999999999999999995


No 70 
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=96.38  E-value=0.0014  Score=43.96  Aligned_cols=23  Identities=30%  Similarity=0.590  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+.|.+++.||+|+||.||+|.+
T Consensus        14 ~~~y~~~~~lg~G~~g~V~~~~~   36 (343)
T cd07878          14 PERYQNLTPVGSGAYGSVCSAYD   36 (343)
T ss_pred             hhhhhhheecccCCCeEEEEEEE
Confidence            46899999999999999999863


No 71 
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=96.38  E-value=0.0011  Score=44.97  Aligned_cols=25  Identities=32%  Similarity=0.425  Sum_probs=21.9

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+++|+.++.||.|+||.||+|.+
T Consensus        71 ~~~~~~~~~~~lg~G~~g~V~~~~~   95 (353)
T PLN00034         71 KSLSELERVNRIGSGAGGTVYKVIH   95 (353)
T ss_pred             CCHHHHhhhhhccCCCCeEEEEEEE
Confidence            4568999999999999999999863


No 72 
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=96.36  E-value=0.0012  Score=45.43  Aligned_cols=24  Identities=25%  Similarity=0.379  Sum_probs=20.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus        32 ~~~~~~~~~~~LG~G~fG~V~~~~   55 (375)
T cd05104          32 FPRNRLSFGKTLGAGAFGKVVEAT   55 (375)
T ss_pred             cchHHeehhheecCCccceEEEEE
Confidence            445689999999999999999874


No 73 
>KOG0695|consensus
Probab=96.36  E-value=0.0011  Score=48.39  Aligned_cols=25  Identities=40%  Similarity=0.755  Sum_probs=22.9

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      -+.+.||..+++||+|+|.+|.||+
T Consensus       246 ~l~l~df~ll~vigrgsyakvl~~~  270 (593)
T KOG0695|consen  246 GLGLQDFDLLRVIGRGSYAKVLLVR  270 (593)
T ss_pred             ccccccceeeeeecCcchhhhhhee
Confidence            4678999999999999999999886


No 74 
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=96.36  E-value=0.00076  Score=43.69  Aligned_cols=24  Identities=17%  Similarity=0.347  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +++++|.+++.||.|+||.||++.
T Consensus         2 i~~~~~~~~~~lg~G~~g~V~~~~   25 (283)
T cd05091           2 INLSTVRFMEELGEDRFGKVYKGH   25 (283)
T ss_pred             CCHHHHHHHHHhCCCCCCeEEEEE
Confidence            467789999999999999999975


No 75 
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=96.33  E-value=0.0013  Score=42.34  Aligned_cols=24  Identities=21%  Similarity=0.292  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+++.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~g~~~~v~~~~   25 (280)
T cd05049           2 VQRDTIVLKRELGEGAFGKVFLGE   25 (280)
T ss_pred             CChHHhhHHhhccccCCceEeeee
Confidence            356789999999999999999985


No 76 
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=96.32  E-value=0.0019  Score=41.98  Aligned_cols=22  Identities=23%  Similarity=0.391  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|+++++||+|+||.||+|.+
T Consensus         1 ~~~~~~~~lg~g~~~~v~~~~~   22 (279)
T cd06619           1 QDIQYQEILGHGNGGTVYKAYH   22 (279)
T ss_pred             CcchheeeeccCCCeEEEEEEE
Confidence            4799999999999999999864


No 77 
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=96.29  E-value=0.0022  Score=42.20  Aligned_cols=21  Identities=38%  Similarity=0.676  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+.++||.|+||.||+|.
T Consensus         2 ~~~~~~~~lg~g~~g~v~~~~   22 (297)
T cd05089           2 EDIKFEDVIGEGNFGQVIRAM   22 (297)
T ss_pred             ccceeeeeecCCCcceEEEEE
Confidence            689999999999999999885


No 78 
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=96.26  E-value=0.0018  Score=42.79  Aligned_cols=24  Identities=42%  Similarity=0.681  Sum_probs=21.5

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|..++.||.|+||.||+|.
T Consensus         4 ~~~~~~~~~~~lg~G~~g~vy~~~   27 (303)
T cd05110           4 LKETELKRVKVLGSGAFGTVYKGI   27 (303)
T ss_pred             cchhhceeccccccCCCccEEEEE
Confidence            456899999999999999999985


No 79 
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological 
Probab=96.25  E-value=0.0016  Score=41.90  Aligned_cols=24  Identities=25%  Similarity=0.511  Sum_probs=21.1

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||.|+||.||++.
T Consensus         3 ~~~~~~~~~~~lg~g~~g~v~~~~   26 (277)
T cd05032           3 LPREKITLIRELGQGSFGMVYEGL   26 (277)
T ss_pred             cchHHeeEEeEecCCCCceEEEEE
Confidence            456789999999999999999875


No 80 
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=96.25  E-value=0.0017  Score=42.46  Aligned_cols=24  Identities=25%  Similarity=0.447  Sum_probs=21.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus         3 ~~~~~~~i~~~lg~G~~g~Vy~~~   26 (288)
T cd05061           3 VSREKITLLRELGQGSFGMVYEGN   26 (288)
T ss_pred             ccHHHceeeeeecCCCCcEEEEEE
Confidence            456789999999999999999874


No 81 
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=96.24  E-value=0.0019  Score=42.57  Aligned_cols=24  Identities=38%  Similarity=0.666  Sum_probs=21.8

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++++|++++.||.|+||.||+|.+
T Consensus         5 ~~~~y~~~~~ig~g~~~~v~~~~~   28 (309)
T cd07845           5 SVTEFEKLNRIGEGTYGIVYRARD   28 (309)
T ss_pred             cccceeEeeeeeecCCEEEEEEEE
Confidence            578999999999999999999864


No 82 
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=96.23  E-value=0.0024  Score=42.34  Aligned_cols=21  Identities=38%  Similarity=0.594  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++++.||.|+||.||+|.
T Consensus         1 ~~~~~~~~lg~G~~g~v~~~~   21 (308)
T cd06615           1 DDFEKLGELGAGNGGVVTKVL   21 (308)
T ss_pred             CCceEEeeccCCCCeEEEEEE
Confidence            579999999999999999985


No 83 
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=96.23  E-value=0.0019  Score=43.87  Aligned_cols=23  Identities=35%  Similarity=0.505  Sum_probs=20.8

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||+|+||.||.|.+
T Consensus        23 ~~~y~~~~~lg~G~~g~V~~~~~   45 (364)
T cd07875          23 LKRYQNLKPIGSGAQGIVCAAYD   45 (364)
T ss_pred             hcceeEEEEeecCCCeEEEEEEE
Confidence            57999999999999999999864


No 84 
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=96.23  E-value=0.002  Score=41.93  Aligned_cols=24  Identities=29%  Similarity=0.454  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..+||++++.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~g~~g~v~~~~   25 (288)
T cd05050           2 YPRNNIEYVRDIGQGAFGRVFQAR   25 (288)
T ss_pred             CChHhceecccccccccccEEEEE
Confidence            356789999999999999999985


No 85 
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=96.22  E-value=0.002  Score=40.96  Aligned_cols=23  Identities=22%  Similarity=0.283  Sum_probs=20.7

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+++|.+.+.||.|+||.||+|.
T Consensus         2 ~~~~~~~~~~ig~g~~g~v~~~~   24 (256)
T cd05112           2 HPSELTLVQEIGSGQFGLVWLGY   24 (256)
T ss_pred             ChhHeEEEeeecCcccceEEEEE
Confidence            46789999999999999999985


No 86 
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=96.21  E-value=0.0015  Score=45.00  Aligned_cols=24  Identities=25%  Similarity=0.459  Sum_probs=20.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++.+.||+|+||.||+|+
T Consensus        35 ~~~~~~~~~~~LG~G~fg~V~~~~   58 (374)
T cd05106          35 FPRDNLQFGKTLGAGAFGKVVEAT   58 (374)
T ss_pred             ccHHHceehheecCCCcccEEEEE
Confidence            345689999999999999999875


No 87 
>PTZ00036 glycogen synthase kinase; Provisional
Probab=96.21  E-value=0.002  Score=45.66  Aligned_cols=25  Identities=24%  Similarity=0.376  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ....+|.+++.||+|+||.||+|.+
T Consensus        63 ~~~~~y~~~~~LG~G~fg~Vy~~~~   87 (440)
T PTZ00036         63 SPNKSYKLGNIIGNGSFGVVYEAIC   87 (440)
T ss_pred             CcCCeEEEeEEEEeCCCEEEEEEEE
Confidence            3446899999999999999999863


No 88 
>KOG0201|consensus
Probab=96.19  E-value=0.0022  Score=47.12  Aligned_cols=22  Identities=50%  Similarity=0.806  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|..+..||+|+||+||.|+|
T Consensus        13 ~~~~~~~~IgrGsfG~Vyk~~d   34 (467)
T KOG0201|consen   13 LLYTKLELIGRGSFGEVYKAID   34 (467)
T ss_pred             cccccchhccccccceeeeeee
Confidence            5688889999999999999976


No 89 
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=96.18  E-value=0.0016  Score=41.90  Aligned_cols=23  Identities=35%  Similarity=0.406  Sum_probs=20.4

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+|.+.+.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~lg~g~~g~v~~~~   24 (267)
T cd05066           2 DASCIKIEKVIGAGEFGEVCSGR   24 (267)
T ss_pred             CHHHeEeeeeecccCCCceEEEE
Confidence            45689999999999999999875


No 90 
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=96.14  E-value=0.0022  Score=41.08  Aligned_cols=23  Identities=26%  Similarity=0.567  Sum_probs=20.7

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|++++.||+|+||.||+|.
T Consensus         7 ~~~~y~~~~~lg~g~~g~vy~~~   29 (267)
T cd06646           7 PQHDYELIQRVGSGTYGDVYKAR   29 (267)
T ss_pred             chhhcchhheeecCCCeEEEEEE
Confidence            45789999999999999999986


No 91 
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=96.13  E-value=0.0022  Score=41.41  Aligned_cols=24  Identities=25%  Similarity=0.480  Sum_probs=20.3

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +...+|.+.+.||+|+||.||+|.
T Consensus         2 i~~~~~~~~~~ig~G~fg~V~~~~   25 (266)
T cd05064           2 LDNKSIKIERILGTGRFGELCRGC   25 (266)
T ss_pred             CchHHeEEeeeecccCCCeEEEEE
Confidence            345679999999999999999873


No 92 
>KOG1152|consensus
Probab=96.13  E-value=0.0027  Score=48.57  Aligned_cols=25  Identities=28%  Similarity=0.578  Sum_probs=22.4

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -+.+||..++.+|.|+||+|.||++
T Consensus       558 ~k~s~yttlq~lG~GAyGkV~lai~  582 (772)
T KOG1152|consen  558 KKFSDYTTLQPLGEGAYGKVNLAIH  582 (772)
T ss_pred             cccccceeeeeccccccceEEEeee
Confidence            3678999999999999999999974


No 93 
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=96.11  E-value=0.0028  Score=41.04  Aligned_cols=25  Identities=24%  Similarity=0.545  Sum_probs=21.7

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...++|++++.||+|+||.||+|.+
T Consensus        15 ~~~~~~~~~~~lg~g~~~~vy~~~~   39 (286)
T cd06638          15 DPSDTWEIIETIGKGTYGKVFKVLN   39 (286)
T ss_pred             CcccceeeeeeeccCCCcEEEEEEE
Confidence            3557999999999999999999853


No 94 
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=96.09  E-value=0.0024  Score=40.86  Aligned_cols=24  Identities=29%  Similarity=0.476  Sum_probs=21.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++++.||+|+||.||+|.
T Consensus         3 ~~~~~~~~~~~ig~g~~~~v~~~~   26 (260)
T cd05070           3 IPRESLQLIKKLGNGQFGEVWMGT   26 (260)
T ss_pred             CchHHhhhhheeccccCceEEEEE
Confidence            345789999999999999999885


No 95 
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis.  Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=96.04  E-value=0.0031  Score=40.33  Aligned_cols=22  Identities=36%  Similarity=0.608  Sum_probs=20.1

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +++|.+.+.||.|+||.||+|.
T Consensus         1 ~~~~~i~~~l~~g~~~~v~~~~   22 (267)
T cd08228           1 LANFQIEKKIGRGQFSEVYRAT   22 (267)
T ss_pred             CcceeeeeeeccCCCeeEEEEE
Confidence            4789999999999999999985


No 96 
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=96.02  E-value=0.0029  Score=41.50  Aligned_cols=21  Identities=24%  Similarity=0.336  Sum_probs=19.0

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+.+.||.|+||.||+|.
T Consensus         5 ~~~~~~~~lg~G~~g~v~~~~   25 (296)
T cd05095           5 KRLTFKEKLGEGQFGEVHLCE   25 (296)
T ss_pred             hhceeeeeccCCCCCeEEecc
Confidence            579999999999999999874


No 97 
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=96.02  E-value=0.002  Score=41.88  Aligned_cols=23  Identities=48%  Similarity=0.758  Sum_probs=20.4

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+||+.+..||+|+||.||++.
T Consensus         2 ~~~~~~~~~~lg~G~~g~vy~~~   24 (288)
T cd06616           2 TAEDLKDLGEIGRGAFGTVNKML   24 (288)
T ss_pred             cHHHhHHHHHhCCCCceEEEEEE
Confidence            45789999999999999999875


No 98 
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=96.01  E-value=0.0019  Score=42.63  Aligned_cols=25  Identities=20%  Similarity=0.291  Sum_probs=21.6

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||+|+||.||+|.
T Consensus        14 ~~~~~~~~i~~~lg~G~~g~V~~~~   38 (307)
T cd05098          14 EVPRDRLVLGKPLGEGCFGQVVMAE   38 (307)
T ss_pred             eeehHHeEEeeeeccCCCeeEEEeE
Confidence            4455889999999999999999885


No 99 
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=96.01  E-value=0.0029  Score=40.45  Aligned_cols=22  Identities=36%  Similarity=0.588  Sum_probs=20.1

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +++|.+.+.||+|+||.||+|.
T Consensus         1 ~~~y~~~~~ig~g~~g~v~~~~   22 (267)
T cd08229           1 LANFRIEKKIGRGQFSEVYRAT   22 (267)
T ss_pred             CchhhhhhhhcccCCeEEEEEe
Confidence            4689999999999999999986


No 100
>KOG1164|consensus
Probab=95.95  E-value=0.0032  Score=42.86  Aligned_cols=21  Identities=33%  Similarity=0.453  Sum_probs=19.6

Q ss_pred             CCCccccccCCccceEeeecC
Q psy17601         44 DFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .|.+.+.||.|+||.||+|.+
T Consensus        19 ~~~i~~~iG~G~fG~V~~v~~   39 (322)
T KOG1164|consen   19 RYKLGKKIGEGGFGAVYLVSD   39 (322)
T ss_pred             ceEEeeeccccCCceEEEEEe
Confidence            899999999999999999864


No 101
>PHA03209 serine/threonine kinase US3; Provisional
Probab=95.94  E-value=0.0035  Score=42.78  Aligned_cols=24  Identities=13%  Similarity=0.163  Sum_probs=20.8

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+|.+++.||.|+||.||+|.+
T Consensus        64 ~~~~y~~~~~lg~G~~g~Vy~~~~   87 (357)
T PHA03209         64 ASLGYTVIKTLTPGSEGRVFVATK   87 (357)
T ss_pred             hhcCcEEEEEecCCCCeEEEEEEE
Confidence            345799999999999999999863


No 102
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=95.90  E-value=0.0036  Score=40.70  Aligned_cols=24  Identities=21%  Similarity=0.458  Sum_probs=21.4

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+++|.+++.||.|+||.||+|.+
T Consensus         3 ~~~~y~~~~~lg~g~~~~vy~~~~   26 (291)
T cd07844           3 KLETYKKLDKLGEGSYATVYKGRS   26 (291)
T ss_pred             CccceeEEEEEeecCCeEEEEEEE
Confidence            468999999999999999999863


No 103
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=95.90  E-value=0.0031  Score=40.92  Aligned_cols=24  Identities=29%  Similarity=0.595  Sum_probs=21.1

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus         3 ~~~~~~~~~~~lg~g~~g~vy~~~   26 (277)
T cd05036           3 VPRDSITLLRALGHGAFGEVYEGL   26 (277)
T ss_pred             CCHHHcEeeeECCCCCCCcEEEEE
Confidence            455789999999999999999885


No 104
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=95.89  E-value=0.0032  Score=40.29  Aligned_cols=23  Identities=26%  Similarity=0.371  Sum_probs=20.5

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...+|.+.+.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~lg~G~~~~v~~~~   24 (256)
T cd05059           2 DPSELTFLKELGSGQFGVVHLGK   24 (256)
T ss_pred             ChHHcchhhhhccCCCceEEEeE
Confidence            45689999999999999999975


No 105
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=95.89  E-value=0.0027  Score=40.80  Aligned_cols=23  Identities=30%  Similarity=0.421  Sum_probs=20.7

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.+||.+++.||.|+||.||+|.
T Consensus         2 ~~~~~~~~~~lg~G~~~~vy~~~   24 (256)
T cd05113           2 DPKDLTFLKELGTGQFGVVKYGK   24 (256)
T ss_pred             ChHHeEEeeEecCcccceEEEEE
Confidence            56789999999999999999985


No 106
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored 
Probab=95.89  E-value=0.0029  Score=40.54  Aligned_cols=24  Identities=38%  Similarity=0.571  Sum_probs=21.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|...+.||+|+||.||+|.
T Consensus         2 i~~~~~~~~~~lg~g~~g~vy~~~   25 (268)
T cd05063           2 IHPSHITKQKVIGAGEFGEVFRGI   25 (268)
T ss_pred             CChHHceEeeEecCCCCccEEEEE
Confidence            456789999999999999999885


No 107
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly 
Probab=95.87  E-value=0.0035  Score=40.97  Aligned_cols=24  Identities=21%  Similarity=0.313  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++..+|.+.+.||+|+||+||+|.
T Consensus         2 ~~~~~~~~~~~lg~G~~~~v~~~~   25 (288)
T cd05093           2 IKRHNIVLKRELGEGAFGKVFLAE   25 (288)
T ss_pred             CchHHeeeccccCCcCCeeEEeeE
Confidence            456789999999999999999875


No 108
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=95.87  E-value=0.0035  Score=46.86  Aligned_cols=24  Identities=38%  Similarity=0.559  Sum_probs=21.5

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+++|.+++.||.|+||.||+|.+
T Consensus         2 ~~~~y~i~~~LG~G~fg~Vy~a~~   25 (669)
T cd05610           2 SIEEFVIVKPISRGAFGKVYLGRK   25 (669)
T ss_pred             ccCCEEEEEEEecCCCeEEEEEEE
Confidence            468899999999999999999864


No 109
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=95.85  E-value=0.0045  Score=39.72  Aligned_cols=23  Identities=30%  Similarity=0.472  Sum_probs=20.2

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+.+.||+|+||.||++.+
T Consensus         1 ~~~~~~~~~l~~g~~g~v~~~~~   23 (265)
T cd06652           1 PTNWRLGKLLGQGAFGRVYLCYD   23 (265)
T ss_pred             CCcceEeeEEecCCceEEEEEEE
Confidence            36899999999999999999863


No 110
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=95.84  E-value=0.0043  Score=40.31  Aligned_cols=22  Identities=36%  Similarity=0.714  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++.+.||.|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~g~~g~vy~~~~   22 (295)
T cd07837           1 DAYEKLEKIGEGTYGKVYKARD   22 (295)
T ss_pred             CCceEeeEecccCCeEEEEEEE
Confidence            4699999999999999999863


No 111
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=95.82  E-value=0.0048  Score=39.30  Aligned_cols=24  Identities=21%  Similarity=0.404  Sum_probs=21.5

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|++.+.||.|+||.||+|.
T Consensus         3 ~~~~~~~~~~~ig~g~~g~v~~~~   26 (256)
T cd05039           3 INSKELKLGATIGKGEFGDVMLGD   26 (256)
T ss_pred             cChhhccceeeeecCCCceEEEEE
Confidence            456799999999999999999885


No 112
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=95.82  E-value=0.0039  Score=39.89  Aligned_cols=24  Identities=25%  Similarity=0.515  Sum_probs=21.1

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus         3 ~~~~~~~~~~~lg~g~~~~v~~~~   26 (261)
T cd05068           3 IDRTSIQLLRKLGAGQFGEVWEGL   26 (261)
T ss_pred             cchhheeeEEEecccCCccEEEEE
Confidence            355789999999999999999875


No 113
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=95.81  E-value=0.0047  Score=40.20  Aligned_cols=24  Identities=25%  Similarity=0.261  Sum_probs=21.1

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|.....||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~g~~g~v~~~~   25 (280)
T cd05092           2 IKRRDIVLKWELGEGAFGKVFLAE   25 (280)
T ss_pred             CChHhceeccccCCccCCeEEEeE
Confidence            566789999999999999999874


No 114
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=95.81  E-value=0.0039  Score=40.63  Aligned_cols=23  Identities=39%  Similarity=0.647  Sum_probs=21.1

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+++|.+++.||.|+||.||+|.
T Consensus         6 ~~~~y~~~~~lg~g~~~~v~~~~   28 (311)
T cd07866           6 KLRDYEILGKLGEGTFGEVYKAR   28 (311)
T ss_pred             ccccEEEEEEeccCCCEEEEEEE
Confidence            36899999999999999999986


No 115
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=95.80  E-value=0.0047  Score=39.62  Aligned_cols=24  Identities=29%  Similarity=0.389  Sum_probs=21.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus         3 ~~~~~~~~~~~lg~g~~~~vy~~~   26 (260)
T cd05073           3 IPRESLKLEKKLGAGQFGEVWMAT   26 (260)
T ss_pred             ccccceeEEeEecCccceEEEEEE
Confidence            346789999999999999999985


No 116
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=95.79  E-value=0.0044  Score=39.50  Aligned_cols=24  Identities=25%  Similarity=0.372  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||.|+||.||+|.
T Consensus         3 ~~~~~~~i~~~ig~g~~~~v~~~~   26 (261)
T cd05034           3 IPRESLKLERKLGAGQFGEVWMGT   26 (261)
T ss_pred             cchhheeeeeeeccCcceEEEEEE
Confidence            456889999999999999999875


No 117
>KOG0610|consensus
Probab=95.79  E-value=0.0023  Score=46.90  Aligned_cols=29  Identities=31%  Similarity=0.392  Sum_probs=25.3

Q ss_pred             hccCCCCCCCCccccccCCccceEeeecC
Q psy17601         36 KRSRLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        36 ~~~~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +...+++++|+.++.||+|.-|.||||.+
T Consensus        70 ~~~~l~l~~f~llk~LG~GdiG~VyL~~l   98 (459)
T KOG0610|consen   70 KDGSLGLRHFRLLKRLGCGDIGTVYLVEL   98 (459)
T ss_pred             CCCccCHHHHHHHHHcCCCCceeEEEEEe
Confidence            34567889999999999999999999963


No 118
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=95.78  E-value=0.0043  Score=44.80  Aligned_cols=26  Identities=19%  Similarity=0.226  Sum_probs=22.1

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +...++|.+.+.||+|+||.||+|.+
T Consensus        28 ~~~~~rY~i~~~LG~G~fG~Vy~a~~   53 (496)
T PTZ00283         28 KEQAKKYWISRVLGSGATGTVLCAKR   53 (496)
T ss_pred             cccCCCEEEEEEEecCCCEEEEEEEE
Confidence            34457999999999999999999863


No 119
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=95.75  E-value=0.0024  Score=40.69  Aligned_cols=24  Identities=29%  Similarity=0.404  Sum_probs=20.8

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+|.+++.||.|+||.||+|.+
T Consensus         4 ~~~~y~~~~~ig~g~~~~vy~~~~   27 (261)
T cd05148           4 PREEFTLERKLGSGYFGEVWEGLW   27 (261)
T ss_pred             cHHHHHHhhhhccCCCccEEEeEe
Confidence            346899999999999999999863


No 120
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=95.75  E-value=0.0037  Score=40.21  Aligned_cols=23  Identities=35%  Similarity=0.449  Sum_probs=20.4

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.+|.+.+.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~lg~g~~g~vy~~~   24 (269)
T cd05065           2 DVSCVKIEEVIGAGEFGEVCRGR   24 (269)
T ss_pred             ChHHeEEEeEecCCCCCeEEEEE
Confidence            46788999999999999999875


No 121
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=95.75  E-value=0.0031  Score=41.50  Aligned_cols=25  Identities=20%  Similarity=0.355  Sum_probs=22.1

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||.|+||.||+|.
T Consensus        11 ~~~~~~~~~~~~lg~G~~g~Vy~~~   35 (304)
T cd05101          11 EFSRDKLTLGKPLGEGCFGQVVMAE   35 (304)
T ss_pred             cccHHHeeecceeeccCCceEEEEE
Confidence            4667899999999999999999884


No 122
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=95.74  E-value=0.0033  Score=40.88  Aligned_cols=25  Identities=32%  Similarity=0.430  Sum_probs=21.6

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+++.||+|+||.||++.
T Consensus         8 ~~~~~~~~~~~~ig~g~~g~v~~~~   32 (293)
T cd05053           8 ELPRDRLTLGKPLGEGAFGQVVKAE   32 (293)
T ss_pred             ccCHhHeEEeeEecccccccEEEEE
Confidence            3456789999999999999999875


No 123
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=95.73  E-value=0.0042  Score=39.66  Aligned_cols=24  Identities=29%  Similarity=0.599  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|.+.+.||+|+||.||++.
T Consensus         3 ~~~~~~~~~~~lg~g~~~~v~~~~   26 (256)
T cd05082           3 LNMKELKLLQTIGKGEFGDVMLGD   26 (256)
T ss_pred             ccHHhCeeeeeecccCCCeEEEEE
Confidence            456799999999999999999874


No 124
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=95.72  E-value=0.0038  Score=40.39  Aligned_cols=23  Identities=26%  Similarity=0.450  Sum_probs=20.3

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|++.+.||+|+||.||+|.
T Consensus         4 ~~~~~~~~~~ig~G~~g~v~~~~   26 (277)
T cd05062           4 AREKITMSRELGQGSFGMVYEGI   26 (277)
T ss_pred             cHHHceeeeeeccccCCeEEEEE
Confidence            45789999999999999999874


No 125
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=95.72  E-value=0.0051  Score=43.24  Aligned_cols=25  Identities=20%  Similarity=0.421  Sum_probs=21.5

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..+.|.+.+.||.|+||.||.|.
T Consensus        33 ~~~~~~~~~~~~LG~G~fG~Vy~~~   57 (400)
T cd05105          33 EFPRDGLVLGRILGSGAFGKVVEGT   57 (400)
T ss_pred             eccccceehhheecCCCCceEEEEE
Confidence            4556889999999999999999874


No 126
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=95.70  E-value=0.0036  Score=41.93  Aligned_cols=22  Identities=23%  Similarity=0.306  Sum_probs=19.5

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+|.+.+.||+|+||.||+|.
T Consensus        11 ~~~~~i~~~ig~G~~g~v~~~~   32 (334)
T cd05100          11 RTRLTLGKPLGEGCFGQVVMAE   32 (334)
T ss_pred             HhHeeecceeccccCCcEEEEE
Confidence            3578999999999999999985


No 127
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=95.69  E-value=0.0042  Score=40.24  Aligned_cols=24  Identities=42%  Similarity=0.720  Sum_probs=20.9

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+++.||.|+||.||+|.
T Consensus         4 ~~~~~~~~~~~ig~g~~g~v~~~~   27 (279)
T cd05057           4 LKETELEKIKVLGSGAFGTVYKGV   27 (279)
T ss_pred             cCHHHcEEcceecCCCCccEEEEE
Confidence            345789999999999999999875


No 128
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=95.69  E-value=0.0058  Score=39.22  Aligned_cols=23  Identities=22%  Similarity=0.361  Sum_probs=20.2

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|.+++.||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~ig~g~~~~v~~~~   24 (284)
T cd05038           2 EKRHLKFIKQLGEGHFGKVELCR   24 (284)
T ss_pred             chhhchhheeeccCCCeeEEEee
Confidence            34689999999999999999985


No 129
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=95.69  E-value=0.0043  Score=40.36  Aligned_cols=24  Identities=42%  Similarity=0.650  Sum_probs=21.0

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+++|.+++.||.|+||.||+|.+
T Consensus        10 ~~~~y~~~~~lg~g~~~~v~~~~~   33 (310)
T cd07865          10 EVSKYEKLAKIGQGTFGEVFKARH   33 (310)
T ss_pred             hhhheEEEEEeecCCCEEEEEEEE
Confidence            357899999999999999999863


No 130
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=95.64  E-value=0.0036  Score=44.09  Aligned_cols=24  Identities=21%  Similarity=0.429  Sum_probs=20.5

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus        34 ~~~~~~~~~~~lG~G~fG~Vy~~~   57 (401)
T cd05107          34 MPRDNLVLGRTLGSGAFGRVVEAT   57 (401)
T ss_pred             ecHHHeehhhhccCCCceeEEEEE
Confidence            445678889999999999999985


No 131
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=95.61  E-value=0.0048  Score=48.98  Aligned_cols=26  Identities=31%  Similarity=0.497  Sum_probs=22.8

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+++|.+++.||.|+||.||+|.+
T Consensus         9 e~~l~~YeIl~kLG~GgFGtVYLAkd   34 (1021)
T PTZ00266          9 ESRLNEYEVIKKIGNGRFGEVFLVKH   34 (1021)
T ss_pred             ccccCCEEEEEEEecCCCeEEEEEEE
Confidence            45568999999999999999999864


No 132
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=95.60  E-value=0.006  Score=39.38  Aligned_cols=22  Identities=32%  Similarity=0.613  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||.|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~g~~~~vy~~~~   22 (286)
T cd07846           1 EKYENLGLVGEGSYGMVMKCKH   22 (286)
T ss_pred             CceeEeeeeccCCCeEEEEEEE
Confidence            4689999999999999999863


No 133
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=95.60  E-value=0.006  Score=39.99  Aligned_cols=25  Identities=32%  Similarity=0.434  Sum_probs=22.9

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++|.+.+.||.|+||.||+|.
T Consensus        11 ~~~~~~~~~~~~lg~g~~~~v~~~~   35 (296)
T cd06618          11 PADLNDLENLGEIGSGTCGQVYKMR   35 (296)
T ss_pred             cCCcchheeeeEeeccCCeEEEEEE
Confidence            5678999999999999999999986


No 134
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=95.55  E-value=0.005  Score=40.12  Aligned_cols=22  Identities=23%  Similarity=0.477  Sum_probs=20.1

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++|.+++.||.|+||.||+|.
T Consensus         4 ~~~y~~~~~ig~g~~~~v~~~~   25 (291)
T cd07870           4 ATSYLNLEKLGEGSYATVYKGI   25 (291)
T ss_pred             cceeEEEEEEEecCCEEEEEEE
Confidence            4789999999999999999985


No 135
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=95.53  E-value=0.0051  Score=39.64  Aligned_cols=24  Identities=25%  Similarity=0.228  Sum_probs=20.7

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+|.+.+.||.|+||.||+|.+
T Consensus         4 ~~~~~~~~~~lg~g~~~~v~~~~~   27 (262)
T cd05071           4 PRESLRLEVKLGQGCFGEVWMGTW   27 (262)
T ss_pred             ChHHeeEeeecCCCCCCcEEEEEe
Confidence            446799999999999999999853


No 136
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1. Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto
Probab=95.52  E-value=0.0071  Score=38.64  Aligned_cols=22  Identities=32%  Similarity=0.546  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+.+.||.|+||.||.|.+
T Consensus         1 ~~y~~~~~lg~g~~~~vy~~~~   22 (280)
T cd05581           1 DDFKFGKIIGEGSFSTVVLAKE   22 (280)
T ss_pred             CCceEeeeecCCCceEEEEEEE
Confidence            4799999999999999999863


No 137
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1 
Probab=95.52  E-value=0.0073  Score=38.33  Aligned_cols=21  Identities=38%  Similarity=0.561  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++.+.||.|+||.||.|.
T Consensus         1 ~~y~~~~~lg~g~~~~v~~~~   21 (267)
T cd06610           1 DDYELIEVIGVGATAVVYAAI   21 (267)
T ss_pred             CcceeeeeecCCCCeEEEEEE
Confidence            589999999999999999885


No 138
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=95.50  E-value=0.0045  Score=39.50  Aligned_cols=23  Identities=22%  Similarity=0.443  Sum_probs=20.4

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++++|.+.+.||+|+||.||++.
T Consensus         4 ~~~~~~~~~~lg~g~~g~v~~~~   26 (254)
T cd05083           4 NLQKLTLGEIIGEGEFGAVLQGE   26 (254)
T ss_pred             cHHHceeeeeeccCCCCceEecc
Confidence            56789999999999999999864


No 139
>KOG0659|consensus
Probab=95.42  E-value=0.0058  Score=42.95  Aligned_cols=22  Identities=32%  Similarity=0.649  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|..++.||.|+||.||+|+|
T Consensus         2 ~rY~~~~~lGEG~~gvVyka~d   23 (318)
T KOG0659|consen    2 DRYEKLEKLGEGTYGVVYKARD   23 (318)
T ss_pred             chhhhhhhhcCcceEEEEEEEe
Confidence            4688899999999999999986


No 140
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=95.42  E-value=0.006  Score=39.82  Aligned_cols=21  Identities=38%  Similarity=0.566  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|++++.||.|+||.||+|.
T Consensus        12 ~~y~i~~~lg~g~~g~vy~~~   32 (292)
T cd06644          12 EVWEIIGELGDGAFGKVYKAK   32 (292)
T ss_pred             hhhhhhheecCCCCeEEEEEE
Confidence            669999999999999999985


No 141
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It 
Probab=95.41  E-value=0.0062  Score=39.35  Aligned_cols=24  Identities=17%  Similarity=0.290  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+..+||+|+||.||.|.
T Consensus         3 ~~~~~~~~~~~i~~g~~g~V~~~~   26 (280)
T cd05043           3 ISRDRVTLSDLLQEGTFGRIFYGI   26 (280)
T ss_pred             cchhheEEeeeecccCCceEEEEE
Confidence            456789999999999999999885


No 142
>KOG0592|consensus
Probab=95.40  E-value=0.0077  Score=45.43  Aligned_cols=26  Identities=19%  Similarity=0.367  Sum_probs=24.0

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +..+.||.+.++||.|+|.+|++|.+
T Consensus        69 kk~~~DF~Fg~~lGeGSYStV~~A~~   94 (604)
T KOG0592|consen   69 KKTPNDFKFGKILGEGSYSTVVLARE   94 (604)
T ss_pred             cCChhhcchhheeccccceeEEEeee
Confidence            67789999999999999999999974


No 143
>PHA03207 serine/threonine kinase US3; Provisional
Probab=95.40  E-value=0.0071  Score=41.84  Aligned_cols=21  Identities=19%  Similarity=0.181  Sum_probs=19.0

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+|.+++.||.|+||.||+|.
T Consensus        92 ~~y~i~~~Lg~G~~g~Vy~~~  112 (392)
T PHA03207         92 MQYNILSSLTPGSEGEVFVCT  112 (392)
T ss_pred             CceEEEEeecCCCCeEEEEEE
Confidence            469999999999999999974


No 144
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=95.38  E-value=0.008  Score=39.10  Aligned_cols=20  Identities=20%  Similarity=0.385  Sum_probs=17.9

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .|.+++.||+|+||.||+|.
T Consensus         5 ~~~~~~~lg~g~~g~v~~~~   24 (284)
T cd05079           5 FLKRIRDLGEGHFGKVELCR   24 (284)
T ss_pred             hhhhceecCCCCceeEEEEE
Confidence            47889999999999999885


No 145
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=95.36  E-value=0.009  Score=38.67  Aligned_cols=21  Identities=19%  Similarity=0.436  Sum_probs=18.8

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+|.+++.||.|+||.||.|.
T Consensus         4 ~~~~~~~~lg~g~~g~v~~~~   24 (284)
T cd05081           4 RHLKFIQQLGKGNFGSVELCR   24 (284)
T ss_pred             ccceeeeeccCCCCceEEEEE
Confidence            478999999999999999874


No 146
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho
Probab=95.35  E-value=0.0088  Score=38.41  Aligned_cols=22  Identities=41%  Similarity=0.590  Sum_probs=19.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+|.+.+.||+|+||.||+|.+
T Consensus         2 ~~~~~~~~lg~g~~g~v~~~~~   23 (264)
T cd06653           2 VNWRLGKLLGRGAFGEVYLCYD   23 (264)
T ss_pred             CceeeeeeEccCCCeEEEEEEE
Confidence            5799999999999999999863


No 147
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=95.34  E-value=0.0049  Score=40.86  Aligned_cols=25  Identities=24%  Similarity=0.403  Sum_probs=21.7

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +...++|.+.+.||+|+||.||+|.
T Consensus        31 ~~~~~~~~~~~~ig~G~~g~V~~~~   55 (302)
T cd05055          31 EFPRNNLSFGKTLGAGAFGKVVEAT   55 (302)
T ss_pred             cccHHHeEEcceeeccCCeeEEEEE
Confidence            4566799999999999999999874


No 148
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=95.33  E-value=0.0073  Score=40.85  Aligned_cols=23  Identities=35%  Similarity=0.505  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+|.+++.||+|+||.||+|.+
T Consensus        15 ~~~y~~~~~lg~g~~g~V~~~~~   37 (353)
T cd07850          15 LKRYQNLKPIGSGAQGIVCAAYD   37 (353)
T ss_pred             hcceEEEEEeccCCCEEEEEEEE
Confidence            46799999999999999999863


No 149
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=95.27  E-value=0.0066  Score=39.54  Aligned_cols=24  Identities=29%  Similarity=0.537  Sum_probs=21.5

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+++|++.+.||.|+||.||+|.
T Consensus         4 ~~~~~~~~~~~lg~g~~g~v~~~~   27 (302)
T cd07864           4 RCVDKFDIIGQIGEGTYGQVYKAR   27 (302)
T ss_pred             hhhhhhheeeeecccCCEEEEEEE
Confidence            356899999999999999999986


No 150
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=95.27  E-value=0.01  Score=38.12  Aligned_cols=22  Identities=32%  Similarity=0.502  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -+|...+.||.|+||.||+|.+
T Consensus         2 ~~~~~~~~lg~g~~g~vy~~~~   23 (266)
T cd06651           2 INWRRGKLLGQGAFGRVYLCYD   23 (266)
T ss_pred             CCccccceecCCCCEEEEEEEE
Confidence            4799999999999999999863


No 151
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=95.26  E-value=0.007  Score=40.60  Aligned_cols=22  Identities=27%  Similarity=0.519  Sum_probs=20.0

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.+.+.||.|+||.||+|.+
T Consensus         5 ~~y~i~~~lg~G~~g~vy~~~~   26 (336)
T cd07849           5 PRYQNLSYIGEGAYGMVCSATH   26 (336)
T ss_pred             cceEEEEEEEecCCeEEEEEEE
Confidence            6899999999999999999863


No 152
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=95.24  E-value=0.0045  Score=39.68  Aligned_cols=25  Identities=36%  Similarity=0.591  Sum_probs=21.3

Q ss_pred             CCCCCCCccccccCCccceEeeecC
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...++|.+.+.||+|+||.||+|.+
T Consensus         6 ~~~~~~~~~~~lg~g~~~~v~~~~~   30 (267)
T cd06645           6 NPQEDFELIQRIGSGTYGDVYKARN   30 (267)
T ss_pred             CcHHHHHHHHHhCCCCCeEEEEEEE
Confidence            3446899999999999999999863


No 153
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=95.23  E-value=0.0077  Score=38.35  Aligned_cols=21  Identities=33%  Similarity=0.518  Sum_probs=19.2

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|+..+.||.|+||.||+|.
T Consensus         1 ~~~~~~~~ig~g~~~~v~~~~   21 (265)
T cd06605           1 DDLEYLGELGAGNSGVVSKVL   21 (265)
T ss_pred             CcchHHHHhcCCCCeEEEEEE
Confidence            479999999999999999985


No 154
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=95.21  E-value=0.0073  Score=39.48  Aligned_cols=24  Identities=25%  Similarity=0.347  Sum_probs=21.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +...+|.+...||+|+||.||+|.
T Consensus         2 ~~~~~~~~~~~lg~g~~g~vy~~~   25 (291)
T cd05094           2 IKRRDIVLKRELGEGAFGKVFLAE   25 (291)
T ss_pred             CchHHeEEeeeecccCCCeEEEeE
Confidence            456789999999999999999985


No 155
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=95.20  E-value=0.007  Score=39.43  Aligned_cols=24  Identities=29%  Similarity=0.587  Sum_probs=21.0

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++++|++++.||.|+||.||+|.+
T Consensus         3 ~~~~y~~~~~lg~g~~~~v~~~~~   26 (293)
T cd07843           3 SVDEYEKLNRIEEGTYGVVYRARD   26 (293)
T ss_pred             chhhhhhhhhhcCCCCeEEEEEEE
Confidence            357899999999999999999863


No 156
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=95.19  E-value=0.0095  Score=38.33  Aligned_cols=22  Identities=36%  Similarity=0.599  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|++++.||.|+||.||+|.+
T Consensus         1 ~~y~~~~~l~~g~~~~v~~~~~   22 (286)
T cd07847           1 EKYEKLSKIGEGSYGVVFKCRN   22 (286)
T ss_pred             CceeeeeeecccCCeEEEEEEE
Confidence            4689999999999999999863


No 157
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=95.19  E-value=0.0095  Score=39.29  Aligned_cols=22  Identities=23%  Similarity=0.433  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|+.++.||.|+||.||+|.+
T Consensus         1 ~~y~~~~~ig~g~~g~vy~~~~   22 (316)
T cd05574           1 KHFKKIKLLGKGDVGRVFLVRL   22 (316)
T ss_pred             CceEEeeeecCCccEEEEEEEE
Confidence            4799999999999999999863


No 158
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=95.18  E-value=0.0082  Score=40.63  Aligned_cols=24  Identities=29%  Similarity=0.537  Sum_probs=20.9

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++|.+++.||+|+||.||+|.+
T Consensus        15 ~~~~y~~~~~lg~G~~g~v~~~~~   38 (345)
T cd07877          15 VPERYQNLSPVGSGAYGSVCAAFD   38 (345)
T ss_pred             ccCceEEEEEeeecCCeEEEEEEE
Confidence            347899999999999999999863


No 159
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=95.18  E-value=0.011  Score=38.54  Aligned_cols=23  Identities=30%  Similarity=0.647  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|+++..||+|+||.||+|.+
T Consensus         1 ~~~y~~~~~l~~g~~~~v~~~~~   23 (294)
T PLN00009          1 MDQYEKVEKIGEGTYGVVYKARD   23 (294)
T ss_pred             CCceEEEEEecCCCCEEEEEEEe
Confidence            46899999999999999999863


No 160
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=95.17  E-value=0.0086  Score=40.50  Aligned_cols=22  Identities=27%  Similarity=0.616  Sum_probs=19.8

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.|.+++.||.|+||.||+|.
T Consensus        14 ~~~y~~~~~lg~G~~g~V~~~~   35 (343)
T cd07880          14 PDRYRDLKQVGSGAYGTVCSAL   35 (343)
T ss_pred             ccceEEEEEeeecCCeEEEEEE
Confidence            3679999999999999999986


No 161
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=95.17  E-value=0.0097  Score=39.24  Aligned_cols=21  Identities=43%  Similarity=0.681  Sum_probs=19.2

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++++.||.|+||.||+|.
T Consensus         1 ~~y~~~~~l~~g~~~~v~~~~   21 (305)
T cd05609           1 EDFETIKLISNGAYGAVYLVR   21 (305)
T ss_pred             CCceEeeEeecCCCeeEEEEE
Confidence            479999999999999999885


No 162
>KOG0663|consensus
Probab=95.14  E-value=0.0054  Score=44.34  Aligned_cols=24  Identities=38%  Similarity=0.630  Sum_probs=22.2

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++.|+.+..|+.|+||.||-|+|
T Consensus        74 sv~efe~lnrI~EGtyGiVYRakd   97 (419)
T KOG0663|consen   74 SVEEFEKLNRIEEGTYGVVYRAKD   97 (419)
T ss_pred             cHHHHHHHhhcccCcceeEEEecc
Confidence            568999999999999999999986


No 163
>KOG0589|consensus
Probab=95.13  E-value=0.0056  Score=44.61  Aligned_cols=22  Identities=36%  Similarity=0.724  Sum_probs=20.2

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +++|+.++.||+|+||.++|++
T Consensus         3 m~~Ye~~~~iG~GafG~a~lvr   24 (426)
T KOG0589|consen    3 MDNYEVLRQVGRGAFGSALLVR   24 (426)
T ss_pred             cchhhhhhhcCccccchhhhhh
Confidence            5789999999999999999875


No 164
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a
Probab=95.09  E-value=0.012  Score=37.45  Aligned_cols=21  Identities=38%  Similarity=0.550  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+.+.||.|+||.||+|.
T Consensus         2 ~~y~~~~~lg~g~~~~v~~~~   22 (267)
T cd08224           2 GNFKIEKKIGKGQFSVVYKAI   22 (267)
T ss_pred             CceeeeeeeccCCceEEEEEE
Confidence            579999999999999999985


No 165
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=95.09  E-value=0.0095  Score=46.94  Aligned_cols=23  Identities=26%  Similarity=0.668  Sum_probs=20.4

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.+|++++.||+|+||.||+|.+
T Consensus         1 igrYeIi~~LGkGgfG~VYlA~d   23 (932)
T PRK13184          1 MQRYDIIRLIGKGGMGEVYLAYD   23 (932)
T ss_pred             CCCeEEEEEEecCCCEEEEEEEE
Confidence            36899999999999999999863


No 166
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=95.09  E-value=0.0099  Score=40.12  Aligned_cols=22  Identities=23%  Similarity=0.403  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|.+++.||.|+||.||+|.+
T Consensus         5 ~~y~~~~~Lg~g~~g~vy~~~~   26 (342)
T cd07854           5 SRYMDLRPLGCGSNGLVFSAVD   26 (342)
T ss_pred             cceEEEEEecCCCCEEEEEEEE
Confidence            5799999999999999999863


No 167
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=95.07  E-value=0.0072  Score=40.09  Aligned_cols=24  Identities=21%  Similarity=0.357  Sum_probs=20.9

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..++|.+.+.||+|+||.||+|.
T Consensus         9 ~~~~~~~~~~~lg~G~~g~vy~~~   32 (314)
T cd05099           9 FPRDRLVLGKPLGEGCFGQVVRAE   32 (314)
T ss_pred             ccHHHeeeeeeecCCCcccEEEee
Confidence            445789999999999999999974


No 168
>KOG0667|consensus
Probab=95.05  E-value=0.0084  Score=45.27  Aligned_cols=21  Identities=43%  Similarity=0.877  Sum_probs=18.0

Q ss_pred             CCCccccccCCccceEeeecC
Q psy17601         44 DFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .|+++.+||+|+||+|..|.|
T Consensus       187 rY~V~e~LGkGtFGQVvk~~d  207 (586)
T KOG0667|consen  187 RYEVLEVLGKGSFGQVVKAYD  207 (586)
T ss_pred             EEEEEEEecccccceeEEEEe
Confidence            457788999999999998865


No 169
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=95.03  E-value=0.0097  Score=38.24  Aligned_cols=24  Identities=29%  Similarity=0.544  Sum_probs=20.7

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.++|.+.+.||.|+||.||+|.
T Consensus         3 ~~~~~~~~~~~lg~g~~g~v~~~~   26 (270)
T cd05056           3 IQREDITLGRCIGEGQFGDVYQGV   26 (270)
T ss_pred             echhhceeeeeeCCccceeEEEEE
Confidence            345678999999999999999985


No 170
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=95.01  E-value=0.011  Score=37.36  Aligned_cols=22  Identities=36%  Similarity=0.530  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++.+.||.|+||.||+|.+
T Consensus         1 ~~~~~~~~i~~g~~~~v~~~~~   22 (264)
T cd06623           1 SDLERVKVLGQGSSGVVYKVRH   22 (264)
T ss_pred             CcceeeeeeeecCCeEEEEEEE
Confidence            4799999999999999999863


No 171
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=94.98  E-value=0.011  Score=38.57  Aligned_cols=22  Identities=36%  Similarity=0.650  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|.++..||.|+||.||+|.+
T Consensus         1 ~~y~~~~~ig~g~~~~vy~~~~   22 (290)
T cd05580           1 DDFEFIKTLGTGSFGRVMLVRH   22 (290)
T ss_pred             CceEEEEEeecCCCeEEEEEEE
Confidence            4789999999999999999863


No 172
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=94.97  E-value=0.015  Score=36.96  Aligned_cols=21  Identities=29%  Similarity=0.493  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|.+.++||.|+||.||+|.
T Consensus         2 ~~~~~~~~lg~g~~~~vy~~~   22 (263)
T cd06625           2 TNWRRGKLLGQGAFGRVYLCY   22 (263)
T ss_pred             CcccccceecCCCceEEEEEE
Confidence            579999999999999999985


No 173
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=94.97  E-value=0.011  Score=38.50  Aligned_cols=22  Identities=32%  Similarity=0.294  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|+.++.||.|+||.||+|.+
T Consensus         1 ~~~~~~~~lg~g~~~~v~~~~~   22 (287)
T cd06621           1 EKIVELSRLGEGAGGSVTKCRL   22 (287)
T ss_pred             CceEEEEEeccCCceEEEEEEE
Confidence            4789999999999999999864


No 174
>KOG0595|consensus
Probab=94.95  E-value=0.013  Score=42.72  Aligned_cols=23  Identities=35%  Similarity=0.427  Sum_probs=21.0

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.+|...+-||.|+||.||.|+
T Consensus         8 ~~~~y~~~~~iG~GsfavVykg~   30 (429)
T KOG0595|consen    8 VVGDYELSREIGSGSFAVVYKGR   30 (429)
T ss_pred             ccccceehhhccCcceEEEEEeE
Confidence            46899999999999999999986


No 175
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=94.88  E-value=0.011  Score=38.31  Aligned_cols=20  Identities=50%  Similarity=0.772  Sum_probs=17.8

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      -|..++.||.|+||.||++.
T Consensus         5 ~~~~~~~ig~G~~~~vy~~~   24 (277)
T cd06641           5 LFTKLEKIGKGSFGEVFKGI   24 (277)
T ss_pred             hhhhheeEeecCCeEEEEEE
Confidence            47788999999999999985


No 176
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=94.87  E-value=0.013  Score=38.60  Aligned_cols=16  Identities=31%  Similarity=0.468  Sum_probs=14.2

Q ss_pred             cccccCCccceEeeec
Q psy17601         48 LKVIGRGAFGECPKKI   63 (64)
Q Consensus        48 ~~~iG~G~fG~V~La~   63 (64)
                      .+.||+|+||.||+|.
T Consensus         6 ~~~lG~G~~g~Vy~~~   21 (317)
T cd07868           6 GCKVGRGTYGHVYKAK   21 (317)
T ss_pred             ccccccCCCeEEEEEE
Confidence            4679999999999986


No 177
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=94.84  E-value=0.014  Score=39.27  Aligned_cols=22  Identities=36%  Similarity=0.688  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|.+++.||+|+||.||+|.+
T Consensus         5 ~~y~~~~~lg~G~~~~vy~~~~   26 (337)
T cd07858           5 TKYVPIKPIGRGAYGIVCSAKN   26 (337)
T ss_pred             cceeEEEEeccCCCeEEEEEEe
Confidence            4689999999999999999863


No 178
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=94.83  E-value=0.0098  Score=38.17  Aligned_cols=24  Identities=21%  Similarity=0.419  Sum_probs=20.9

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +...+|.+.+.||.|+||.||+|.
T Consensus         3 ~~~~~~~~~~~ig~g~~~~v~~~~   26 (263)
T cd05052           3 MERTDITMKHKLGGGQYGEVYEGV   26 (263)
T ss_pred             CchHHeEEeeecCCcccceEEEEE
Confidence            345789999999999999999986


No 179
>KOG0986|consensus
Probab=94.82  E-value=0.013  Score=43.90  Aligned_cols=26  Identities=27%  Similarity=0.498  Sum_probs=22.7

Q ss_pred             ccCCCCCCCCccccccCCccceEeee
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKK   62 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La   62 (64)
                      ...+..++|..-++||+|+||+|+-+
T Consensus       179 ~qpvt~n~F~~~RvlGkGGFGEV~ac  204 (591)
T KOG0986|consen  179 LQPVTKNTFRVYRVLGKGGFGEVCAC  204 (591)
T ss_pred             hhhccccceeeeEEEecccccceeEE
Confidence            35678899999999999999999854


No 180
>KOG0666|consensus
Probab=94.79  E-value=0.011  Score=42.72  Aligned_cols=22  Identities=32%  Similarity=0.696  Sum_probs=19.9

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..|+.+.-||+|+||.||+|.
T Consensus        23 l~~ye~ig~Ig~GTYG~VykA~   44 (438)
T KOG0666|consen   23 LFEYEGIGKIGRGTYGKVYKAV   44 (438)
T ss_pred             HHHhhccceecccccceeeEee
Confidence            4679999999999999999984


No 181
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=94.77  E-value=0.0096  Score=38.13  Aligned_cols=21  Identities=29%  Similarity=0.567  Sum_probs=18.7

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..|.+.+.||+|+||.||+|.
T Consensus         6 ~~y~~~~~lg~g~~g~vy~~~   26 (272)
T cd06637           6 GIFELVELVGNGTYGQVYKGR   26 (272)
T ss_pred             hhhhHHHheeecCCeEEEEEE
Confidence            458889999999999999885


No 182
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=94.74  E-value=0.013  Score=39.40  Aligned_cols=23  Identities=30%  Similarity=0.486  Sum_probs=20.3

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+++.||.|+||.||+|.+
T Consensus         9 ~~~y~~~~~ig~g~~g~v~~~~~   31 (328)
T cd07856           9 TNRYVDLQPVGMGAFGLVCSARD   31 (328)
T ss_pred             ccceEEEEeecccCCeEEEEEEE
Confidence            46799999999999999999863


No 183
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=94.73  E-value=0.013  Score=37.67  Aligned_cols=22  Identities=55%  Similarity=0.848  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++++.||.|+||.||+|.+
T Consensus         1 ~~y~~~~~lg~g~~~~v~~~~~   22 (274)
T cd06609           1 ELFTLLECIGKGSFGEVYKAID   22 (274)
T ss_pred             ChhhhhhhhcCCCCeEEEEEEE
Confidence            4789999999999999999863


No 184
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=94.72  E-value=0.015  Score=36.91  Aligned_cols=23  Identities=35%  Similarity=0.564  Sum_probs=20.7

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|++++.||.|+||.||+|.+
T Consensus         5 ~~~y~~~~~l~~g~~~~v~~~~~   27 (275)
T cd06608           5 TGIFELVEVIGEGTYGKVYKARH   27 (275)
T ss_pred             hhheeheeeecCCCCeEEEEEEE
Confidence            47899999999999999999863


No 185
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=94.67  E-value=0.014  Score=37.80  Aligned_cols=24  Identities=29%  Similarity=0.504  Sum_probs=20.8

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ....|++.+.||.|+||.||+|.+
T Consensus        14 ~~~~~~~~~~lg~g~~~~v~~~~~   37 (282)
T cd06636          14 PAGIFELVEVVGNGTYGQVYKGRH   37 (282)
T ss_pred             hhhhhhhheeeccCCCeEEEEEEE
Confidence            447899999999999999999863


No 186
>KOG0597|consensus
Probab=94.67  E-value=0.013  Score=44.96  Aligned_cols=23  Identities=30%  Similarity=0.603  Sum_probs=20.4

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +++|.+...||+|+||.||.+++
T Consensus         1 me~yhv~e~iG~Gsfg~VYKgrr   23 (808)
T KOG0597|consen    1 MEQYHVYEMIGEGSFGRVYKGRR   23 (808)
T ss_pred             CcchhHHHHhcCCccceeeeccc
Confidence            36899999999999999999874


No 187
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=94.67  E-value=0.014  Score=38.43  Aligned_cols=21  Identities=29%  Similarity=0.520  Sum_probs=19.7

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+|.+++.||.|+||.||+|.
T Consensus        19 ~~y~~~~~lg~g~~g~v~~~~   39 (297)
T cd06656          19 KKYTRFEKIGQGASGTVYTAI   39 (297)
T ss_pred             hhceeeeeeccCCCeEEEEEE
Confidence            789999999999999999985


No 188
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=94.64  E-value=0.018  Score=37.31  Aligned_cols=18  Identities=28%  Similarity=0.706  Sum_probs=16.1

Q ss_pred             CCccccccCCccceEeee
Q psy17601         45 FEPLKVIGRGAFGECPKK   62 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La   62 (64)
                      |.+++.||+|+||.||++
T Consensus         6 ~~~~~~lg~g~~g~v~~~   23 (283)
T cd05080           6 LKKIRVLGEGHFGKVSLY   23 (283)
T ss_pred             ceeceecccCCCcEEEEe
Confidence            488999999999999875


No 189
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=94.62  E-value=0.016  Score=36.68  Aligned_cols=21  Identities=38%  Similarity=0.735  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++.+.||.|+||.||+|.
T Consensus         3 ~~~~~~~~l~~g~~~~v~~~~   23 (262)
T cd06613           3 EDYELIQRIGSGTYGDVYKAR   23 (262)
T ss_pred             cceEEEEEecCCCceEEEEeE
Confidence            689999999999999999986


No 190
>KOG0661|consensus
Probab=94.55  E-value=0.0085  Score=44.68  Aligned_cols=23  Identities=17%  Similarity=0.410  Sum_probs=20.3

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+.|.+++-||.|+||.||||.
T Consensus         8 ~m~RY~~i~klGDGTfGsV~la~   30 (538)
T KOG0661|consen    8 FMDRYTVIRKLGDGTFGSVYLAK   30 (538)
T ss_pred             HHHHHHHHHHhcCCcceeEEEee
Confidence            34678999999999999999985


No 191
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=94.54  E-value=0.019  Score=37.40  Aligned_cols=22  Identities=27%  Similarity=0.644  Sum_probs=20.2

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++|.++..||.|+||.||+|.
T Consensus        21 ~~~y~~~~~l~~g~~~~vy~~~   42 (291)
T cd06639          21 TDTWEIIETIGKGTYGKVYKVT   42 (291)
T ss_pred             CCCeEEEEEeecCCCeEEEEEE
Confidence            5789999999999999999985


No 192
>KOG0198|consensus
Probab=94.54  E-value=0.018  Score=40.35  Aligned_cols=22  Identities=27%  Similarity=0.587  Sum_probs=19.4

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++...+.||+|+||.|+++.
T Consensus        16 ~~~~~~~~~lG~Gs~G~V~l~~   37 (313)
T KOG0198|consen   16 ISNWSKGKLLGRGSFGSVYLAT   37 (313)
T ss_pred             cchhhhhccccCccceEEEEEE
Confidence            4568889999999999999985


No 193
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=94.52  E-value=0.01  Score=38.31  Aligned_cols=21  Identities=33%  Similarity=0.540  Sum_probs=19.5

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++++.||.|+||.||+|.
T Consensus         5 ~~~~i~~~l~~g~~~~v~~~~   25 (280)
T cd06611           5 DIWEIIGELGDGAFGKVYKAQ   25 (280)
T ss_pred             hHHHHHHHhcCCCCceEEEEE
Confidence            679999999999999999985


No 194
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=94.50  E-value=0.018  Score=37.89  Aligned_cols=22  Identities=27%  Similarity=0.471  Sum_probs=20.0

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.|.+++.||.|+||.||++.
T Consensus        18 ~~~~~~~~~lg~g~~g~v~~~~   39 (293)
T cd06647          18 KKKYTRFEKIGQGASGTVYTAI   39 (293)
T ss_pred             hhhceeeeEecCCCCeEEEEEE
Confidence            4689999999999999999985


No 195
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=94.45  E-value=0.02  Score=36.89  Aligned_cols=22  Identities=36%  Similarity=0.628  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++.+.||.|+||.||+|.+
T Consensus         1 ~~y~~~~~i~~g~~~~v~~~~~   22 (288)
T cd07833           1 NKYEVLGVVGEGAYGVVLKCRN   22 (288)
T ss_pred             CceeEEEEecccCCeeEEEEEe
Confidence            3689999999999999999863


No 196
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=94.41  E-value=0.019  Score=38.46  Aligned_cols=22  Identities=36%  Similarity=0.759  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++|++.+.||.|+||.||+|.+
T Consensus         5 ~~y~~~~~lg~g~~g~v~~~~~   26 (334)
T cd07855           5 SRYKPIENIGSGAYGVVCSAID   26 (334)
T ss_pred             hceeeeeeeecCCCeEEEEEEE
Confidence            6899999999999999998853


No 197
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=94.24  E-value=0.017  Score=37.42  Aligned_cols=22  Identities=55%  Similarity=0.822  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|..++.||.|+||.||+|.+
T Consensus         4 ~~y~~~~~lg~g~~~~vy~~~~   25 (277)
T cd06640           4 ELFTKLERIGKGSFGEVFKGID   25 (277)
T ss_pred             HhhhhhhhcccCCCeEEEEEEE
Confidence            4688999999999999999863


No 198
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=94.22  E-value=0.021  Score=38.51  Aligned_cols=22  Identities=41%  Similarity=0.759  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|.+...||.|+||.||+|.+
T Consensus        15 ~~y~~~~~ig~g~~g~v~~~~~   36 (342)
T cd07879          15 ERYTSLKQVGSGAYGSVCSAID   36 (342)
T ss_pred             cceEEEEEeeecCCeEEEEEEe
Confidence            5799999999999999999863


No 199
>KOG0583|consensus
Probab=94.20  E-value=0.026  Score=39.86  Aligned_cols=24  Identities=25%  Similarity=0.534  Sum_probs=21.4

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .....|.+.+.||.|+||+|++|.
T Consensus        14 ~~~g~y~~~~~lG~GsfgkV~~a~   37 (370)
T KOG0583|consen   14 LSIGKYELGRTLGSGSFGKVKLAK   37 (370)
T ss_pred             cccCceeeeeeecCCCCeeEEEee
Confidence            456789999999999999999985


No 200
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=94.14  E-value=0.02  Score=36.70  Aligned_cols=23  Identities=26%  Similarity=0.296  Sum_probs=20.0

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..++|.+...||.|+||.||+|.
T Consensus         4 ~~~~~~~~~~ig~g~~~~v~~~~   26 (260)
T cd05069           4 PRESLRLDVKLGQGCFGEVWMGT   26 (260)
T ss_pred             ChHHeeeeeeecCcCCCeEEEEE
Confidence            44678899999999999999985


No 201
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=94.13  E-value=0.016  Score=38.81  Aligned_cols=23  Identities=39%  Similarity=0.713  Sum_probs=20.5

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|.+.+.||.|+||.||+|.+
T Consensus         6 ~~~y~~~~~lg~g~~~~v~~~~~   28 (337)
T cd07852           6 LRKYEILQKLGKGAYGIVWKAID   28 (337)
T ss_pred             hhHHHHhHhhcCCCCeeEEEEEE
Confidence            46899999999999999999864


No 202
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=94.09  E-value=0.023  Score=36.57  Aligned_cols=20  Identities=35%  Similarity=0.688  Sum_probs=18.2

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .|+.++.||.|+||.||+|.
T Consensus         2 ~y~~~~~l~~g~~g~v~~~~   21 (277)
T cd06917           2 LYQRLELIGRGAYGAVYRGK   21 (277)
T ss_pred             hhhhhhheeccCCceEEEEE
Confidence            58889999999999999986


No 203
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=94.07  E-value=0.026  Score=37.20  Aligned_cols=22  Identities=23%  Similarity=0.448  Sum_probs=19.9

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+|.+++.||.|+||.||++.
T Consensus        19 ~~~y~~~~~lg~g~~~~v~~~~   40 (296)
T cd06654          19 KKKYTRFEKIGQGASGTVYTAM   40 (296)
T ss_pred             ccceeeEEEecCCCCeEEEEEE
Confidence            3689999999999999999986


No 204
>PHA03211 serine/threonine kinase US3; Provisional
Probab=94.06  E-value=0.024  Score=40.90  Aligned_cols=23  Identities=13%  Similarity=0.055  Sum_probs=20.1

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...|.+.+.||+|+||.||+|.+
T Consensus       168 ~~gy~i~~~Lg~G~~G~Vy~a~~  190 (461)
T PHA03211        168 GLGFAIHRALTPGSEGCVFESSH  190 (461)
T ss_pred             cCCeEEEEEEccCCCeEEEEEEE
Confidence            34799999999999999999864


No 205
>KOG0593|consensus
Probab=94.03  E-value=0.024  Score=40.75  Aligned_cols=23  Identities=30%  Similarity=0.586  Sum_probs=20.1

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ++.|+.+..+|.||||.||.++.
T Consensus         1 MekYE~LgkvGEGSYGvV~KCrn   23 (396)
T KOG0593|consen    1 MEKYEKLGKVGEGSYGVVMKCRN   23 (396)
T ss_pred             CcHHhhhhccccCcceEEEEecc
Confidence            35799999999999999999863


No 206
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=94.02  E-value=0.027  Score=35.57  Aligned_cols=21  Identities=38%  Similarity=0.705  Sum_probs=19.4

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|++.+.||.|+||.||+|.
T Consensus         3 ~~y~~~~~i~~g~~~~v~~~~   23 (256)
T cd06612           3 EVFDILEKLGEGSYGSVYKAI   23 (256)
T ss_pred             ccchhhhhhcCCCCeEEEEEE
Confidence            689999999999999999885


No 207
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=93.97  E-value=0.044  Score=36.11  Aligned_cols=22  Identities=32%  Similarity=0.449  Sum_probs=19.4

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...|..++.||+|+||.||+|.
T Consensus        14 ~~~y~~~~~lg~g~~g~vy~~~   35 (307)
T cd06607          14 EKLFTDLREIGHGSFGAVYFAR   35 (307)
T ss_pred             chhhhhheeecCCCCeEEEEEE
Confidence            3569999999999999999985


No 208
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=93.92  E-value=0.028  Score=36.91  Aligned_cols=15  Identities=33%  Similarity=0.596  Sum_probs=13.5

Q ss_pred             ccccCCccceEeeec
Q psy17601         49 KVIGRGAFGECPKKI   63 (64)
Q Consensus        49 ~~iG~G~fG~V~La~   63 (64)
                      +.||+|+||.||+|.
T Consensus         7 ~~lG~G~~g~Vy~~~   21 (317)
T cd07867           7 CKVGRGTYGHVYKAK   21 (317)
T ss_pred             eEeccCCCeeEEEEE
Confidence            569999999999986


No 209
>KOG0658|consensus
Probab=93.92  E-value=0.022  Score=40.94  Aligned_cols=20  Identities=30%  Similarity=0.692  Sum_probs=17.8

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .|...++||.|+||.||.|.
T Consensus        25 ~~~~~~liG~GsFg~Vyq~~   44 (364)
T KOG0658|consen   25 SYEAVRLIGSGSFGVVYQAK   44 (364)
T ss_pred             EEEeeEEEeecccceEEEEE
Confidence            47788999999999999985


No 210
>KOG1163|consensus
Probab=93.91  E-value=0.022  Score=40.05  Aligned_cols=23  Identities=26%  Similarity=0.449  Sum_probs=20.3

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      -...|.+++-||.|+||.+|+++
T Consensus        13 v~gky~lvrkiGsGSFGdIy~~~   35 (341)
T KOG1163|consen   13 VGGKYKLVRKIGSGSFGDIYLGI   35 (341)
T ss_pred             eccceEEEEeecCCchhheeeee
Confidence            44679999999999999999985


No 211
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=93.82  E-value=0.028  Score=37.96  Aligned_cols=24  Identities=25%  Similarity=0.552  Sum_probs=20.9

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..++|.+++.||.|+||.||+|++
T Consensus        13 ~~~~y~~~~~ig~g~~g~vy~~~~   36 (343)
T cd07851          13 VPDRYQNLSPVGSGAYGQVCSAFD   36 (343)
T ss_pred             ccCceEEEEEeccCCceEEEEEEE
Confidence            357899999999999999999863


No 212
>KOG0614|consensus
Probab=93.74  E-value=0.069  Score=40.78  Aligned_cols=28  Identities=18%  Similarity=0.415  Sum_probs=25.0

Q ss_pred             hccCCCCCCCCccccccCCccceEeeec
Q psy17601         36 KRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        36 ~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..+++.++|++++..||-|+||+|=|+.
T Consensus       413 e~a~v~l~dl~~iaTLGvGgFGRVELV~  440 (732)
T KOG0614|consen  413 EFAQVKLSDLKRIATLGVGGFGRVELVK  440 (732)
T ss_pred             hhcccchhhhhhhhhcccCccceEEEEE
Confidence            4568899999999999999999998874


No 213
>KOG0615|consensus
Probab=93.70  E-value=0.028  Score=41.42  Aligned_cols=22  Identities=27%  Similarity=0.362  Sum_probs=18.4

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.|.+.+.+|.|+||.|.||+
T Consensus       171 ~d~yii~~~LGsGafg~Vkla~  192 (475)
T KOG0615|consen  171 NDYYIISKTLGSGAFGLVKLAY  192 (475)
T ss_pred             cceeEeeeeecCCceeEEEEEE
Confidence            3556667799999999999996


No 214
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=93.50  E-value=0.025  Score=36.60  Aligned_cols=20  Identities=35%  Similarity=0.622  Sum_probs=17.4

Q ss_pred             CCccccccCCccceEeeecC
Q psy17601         45 FEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~~   64 (64)
                      |++++.||.|+||.||++.+
T Consensus         7 ~~i~~~lg~g~~g~v~~~~~   26 (282)
T cd06643           7 WEIIGELGDGAFGKVYKAQN   26 (282)
T ss_pred             HHHHhhcccCCCeEEEEEEE
Confidence            47889999999999998853


No 215
>KOG0594|consensus
Probab=93.50  E-value=0.017  Score=40.93  Aligned_cols=23  Identities=26%  Similarity=0.528  Sum_probs=20.3

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .++|+.+..||.|+||.||.|++
T Consensus        10 ~~~~~~~eklGeGtyg~Vykar~   32 (323)
T KOG0594|consen   10 MFDYEKVEKLGEGTYGVVYKARS   32 (323)
T ss_pred             HHHHHHHHHhCCCCceEEEEEEE
Confidence            56788899999999999999874


No 216
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=93.49  E-value=0.041  Score=35.29  Aligned_cols=19  Identities=21%  Similarity=0.518  Sum_probs=16.7

Q ss_pred             CCccccccCCccceEeeec
Q psy17601         45 FEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~   63 (64)
                      |.+.+.||.|+||+||+|.
T Consensus         3 ~~~~~~lg~g~~~~vy~~~   21 (272)
T cd06629           3 WVKGELIGKGTYGRVYLAL   21 (272)
T ss_pred             eeecceecccCceEEEEEe
Confidence            5667899999999999985


No 217
>KOG1151|consensus
Probab=93.48  E-value=0.024  Score=42.84  Aligned_cols=22  Identities=36%  Similarity=0.703  Sum_probs=18.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|-.+.+||+|+|.+||.|+|
T Consensus       463 ~RYLlLhLLGrGGFSEVyKAFD  484 (775)
T KOG1151|consen  463 DRYLLLHLLGRGGFSEVYKAFD  484 (775)
T ss_pred             HHHHHHHHhccccHHHHHHhcc
Confidence            4566788999999999999986


No 218
>KOG0576|consensus
Probab=93.35  E-value=0.026  Score=43.77  Aligned_cols=23  Identities=35%  Similarity=0.709  Sum_probs=21.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+||+.+..+|.|+||.||.|+|
T Consensus        14 ~ddyellqrvgsgTygdvyKaRd   36 (829)
T KOG0576|consen   14 QDDYELLQRVGSGTYGDVYKARD   36 (829)
T ss_pred             ccchhheeeecCCcccchhhhcc
Confidence            48999999999999999999986


No 219
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=93.12  E-value=0.043  Score=35.65  Aligned_cols=21  Identities=24%  Similarity=0.325  Sum_probs=16.7

Q ss_pred             CCCCccccc--cCCccceEeeec
Q psy17601         43 EDFEPLKVI--GRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~i--G~G~fG~V~La~   63 (64)
                      ++|++++.+  |.|+||.||++.
T Consensus        14 ~~~~~~~~~~lg~g~~g~v~~~~   36 (267)
T PHA03390         14 KNCEIVKKLKLIDGKFGKVSVLK   36 (267)
T ss_pred             HhhccccceeecCCCceEEEEEE
Confidence            456666655  999999999985


No 220
>KOG0611|consensus
Probab=92.97  E-value=0.028  Score=42.04  Aligned_cols=22  Identities=18%  Similarity=0.564  Sum_probs=19.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      -.|++...||+|+||+|.+|++
T Consensus        53 HRyE~~etLGkGTYGKVk~A~e   74 (668)
T KOG0611|consen   53 HRYEITETLGKGTYGKVKLAYE   74 (668)
T ss_pred             hHHHHHHHhcCCcccceeehhh
Confidence            4799999999999999999974


No 221
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=92.96  E-value=0.066  Score=34.31  Aligned_cols=24  Identities=21%  Similarity=0.353  Sum_probs=19.2

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+.+.....||+|+||.||.|.+
T Consensus         6 ~~~~~~~~~~lg~g~~g~v~~~~~   29 (268)
T cd06624           6 EYDENGERVVLGKGTYGIVYAARD   29 (268)
T ss_pred             ccccCCceEEEecCCceEEEEeEe
Confidence            445666677999999999999863


No 222
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=92.94  E-value=0.028  Score=36.31  Aligned_cols=22  Identities=55%  Similarity=0.833  Sum_probs=18.7

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +.|..++.||.|+||.||+|.+
T Consensus         4 ~~y~~~~~l~~g~~~~vy~~~~   25 (277)
T cd06642           4 ELFTKLERIGKGSFGEVYKGID   25 (277)
T ss_pred             HHHHHHHHhcCCCCeeEEEEEE
Confidence            4577889999999999999853


No 223
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=92.88  E-value=0.043  Score=36.49  Aligned_cols=21  Identities=33%  Similarity=0.501  Sum_probs=18.8

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..|..++.||+|+||.||+|.
T Consensus        25 ~~f~~~~~lg~G~~~~v~~~~   45 (317)
T cd06635          25 KLFTDLREIGHGSFGAVYFAR   45 (317)
T ss_pred             hhhhhhheeccCCCeEEEEEE
Confidence            458899999999999999986


No 224
>KOG0032|consensus
Probab=92.84  E-value=0.049  Score=38.82  Aligned_cols=21  Identities=33%  Similarity=0.457  Sum_probs=18.7

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|++.+.||+|+||.||.|.
T Consensus        35 ~~Y~l~~~lG~G~Fg~v~~~~   55 (382)
T KOG0032|consen   35 EKYELGRELGRGQFGVVYLCR   55 (382)
T ss_pred             ccEEehhhhCCCCceEEEEEE
Confidence            468888899999999999986


No 225
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=92.79  E-value=0.056  Score=36.06  Aligned_cols=22  Identities=27%  Similarity=0.530  Sum_probs=17.2

Q ss_pred             CCCCc-cccccCCccceEeeecC
Q psy17601         43 EDFEP-LKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~-~~~iG~G~fG~V~La~~   64 (64)
                      +.|.. .++||.|+||.||+|.+
T Consensus         8 ~ry~~~~~~ig~G~~g~vy~~~~   30 (335)
T PTZ00024          8 ERYIQKGAHLGEGTYGKVEKAYD   30 (335)
T ss_pred             cchhhhhhcccCCCceeEEEEEE
Confidence            34554 46899999999999864


No 226
>KOG0194|consensus
Probab=92.79  E-value=0.055  Score=39.95  Aligned_cols=22  Identities=45%  Similarity=0.523  Sum_probs=17.7

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+|-...+.||.|+||+|+.+.
T Consensus       156 H~~v~l~kkLGeGaFGeV~~G~  177 (474)
T KOG0194|consen  156 HSDIELGKKLGEGAFGEVFKGK  177 (474)
T ss_pred             ccCccccceeecccccEEEEEE
Confidence            3555667899999999999874


No 227
>smart00090 RIO RIO-like kinase.
Probab=92.70  E-value=0.051  Score=35.98  Aligned_cols=20  Identities=10%  Similarity=-0.115  Sum_probs=18.1

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .|.+.+.||.|+||.||+|.
T Consensus        29 ~~~i~~~Lg~G~~g~Vy~a~   48 (237)
T smart00090       29 LSAIGGCISTGKEANVYHAL   48 (237)
T ss_pred             hHHhCCeeccCcceeEEEEE
Confidence            47788999999999999996


No 228
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=92.54  E-value=0.049  Score=35.96  Aligned_cols=21  Identities=29%  Similarity=0.477  Sum_probs=19.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..|.+++.||.|+||.||+|.
T Consensus        19 ~~y~~~~~lg~g~~g~vy~~~   39 (296)
T cd06655          19 KKYTRYEKIGQGASGTVFTAI   39 (296)
T ss_pred             ceEEEEEEEecCCCeEEEEEE
Confidence            569999999999999999886


No 229
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=92.42  E-value=0.072  Score=35.88  Aligned_cols=22  Identities=9%  Similarity=-0.093  Sum_probs=19.4

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      -..|..++++|.|+||.|+|+.
T Consensus        30 ~~~y~~~~~l~~~~f~~v~l~~   51 (232)
T PRK10359         30 SYNIKTIKVFRNIDDTKVSLID   51 (232)
T ss_pred             hCceEEEEEecCCCceEEEEEe
Confidence            3579999999999999999974


No 230
>KOG0193|consensus
Probab=92.34  E-value=0.053  Score=41.53  Aligned_cols=22  Identities=27%  Similarity=0.335  Sum_probs=17.7

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+++.+...||+|+||+||-++
T Consensus       391 ~~ev~l~~rIGsGsFGtV~Rg~  412 (678)
T KOG0193|consen  391 PEEVLLGERIGSGSFGTVYRGR  412 (678)
T ss_pred             HHHhhccceeccccccceeecc
Confidence            4556667799999999999765


No 231
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=92.06  E-value=0.055  Score=38.65  Aligned_cols=21  Identities=10%  Similarity=0.066  Sum_probs=18.6

Q ss_pred             CCCccccccCCccceEeeecC
Q psy17601         44 DFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .|.+.+.||+|+||.||+|.+
T Consensus        68 ~y~~~~~lg~G~~g~vy~a~~   88 (478)
T PTZ00267         68 MYVLTTLVGRNPTTAAFVATR   88 (478)
T ss_pred             eEEEEEEEEeCCCcEEEEEEE
Confidence            388899999999999999863


No 232
>KOG0577|consensus
Probab=92.05  E-value=0.052  Score=42.21  Aligned_cols=20  Identities=40%  Similarity=0.655  Sum_probs=17.7

Q ss_pred             CCccccccCCccceEeeecC
Q psy17601         45 FEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~~   64 (64)
                      |.=++-||.|+||-||.|+|
T Consensus        28 f~dLrEIGHGSFGAVYfArd   47 (948)
T KOG0577|consen   28 FSDLREIGHGSFGAVYFARD   47 (948)
T ss_pred             HHHHHHhcCCccceeEEeec
Confidence            66688899999999999986


No 233
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=91.62  E-value=0.11  Score=32.77  Aligned_cols=19  Identities=16%  Similarity=0.004  Sum_probs=16.6

Q ss_pred             CCccccccCCccceEeeec
Q psy17601         45 FEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~   63 (64)
                      |.+.+.||.|+||.||.+.
T Consensus        17 ~~~~~~i~~G~~g~Vy~~~   35 (198)
T cd05144          17 ESLGNQIGVGKESDVYLAL   35 (198)
T ss_pred             hhcCCccccCcceEEEEEE
Confidence            6667899999999999875


No 234
>KOG0660|consensus
Probab=91.46  E-value=0.095  Score=37.67  Aligned_cols=22  Identities=32%  Similarity=0.516  Sum_probs=18.3

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|..++.||+|+||.|+.|.|
T Consensus        22 ~~y~~~~~iG~GAyGvVcsA~~   43 (359)
T KOG0660|consen   22 RYYVLIEPIGRGAYGVVCSAKD   43 (359)
T ss_pred             ceecccccccCcceeeEEEEEE
Confidence            4566689999999999998864


No 235
>KOG1026|consensus
Probab=91.30  E-value=0.05  Score=42.36  Aligned_cols=24  Identities=25%  Similarity=0.296  Sum_probs=20.0

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..+|-..+.-||.|+||+||+|+
T Consensus       483 i~r~~i~~~~eLGegaFGkVf~a~  506 (774)
T KOG1026|consen  483 IPRSDIVFKEELGEGAFGKVFLAE  506 (774)
T ss_pred             echhheeehhhhcCchhhhhhhhh
Confidence            455677778889999999999985


No 236
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=91.28  E-value=0.068  Score=35.40  Aligned_cols=22  Identities=36%  Similarity=0.554  Sum_probs=18.9

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|..++.||.|+||.||+|++
T Consensus        15 ~~~~~~~~lg~g~~g~v~~~~~   36 (308)
T cd06634          15 KLFSDLREIGHGSFGAVYFARD   36 (308)
T ss_pred             HHHHHHHheeeCCCEEEEEEEE
Confidence            3488889999999999999863


No 237
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=90.84  E-value=0.12  Score=34.37  Aligned_cols=19  Identities=37%  Similarity=0.550  Sum_probs=16.5

Q ss_pred             CCccccccCCccceEeeec
Q psy17601         45 FEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~   63 (64)
                      |..+..||.|+||.||+|.
T Consensus        23 ~~~~~~lg~g~~g~v~~~~   41 (313)
T cd06633          23 FVGLHEIGHGSFGAVYFAT   41 (313)
T ss_pred             hhcceeeccCCCeEEEEEE
Confidence            6667789999999999985


No 238
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=90.72  E-value=0.12  Score=33.49  Aligned_cols=24  Identities=42%  Similarity=0.502  Sum_probs=20.4

Q ss_pred             CCCCCCccccccCCccceEeeecC
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..+.|+..+.||.|+||.||.|.+
T Consensus        17 ~~~~~~~~~~l~~g~~~~v~~~~~   40 (286)
T cd06614          17 PRELYKNLEKIGEGASGEVYKATD   40 (286)
T ss_pred             ccccchHhHhccCCCCeEEEEEEE
Confidence            446799999999999999999863


No 239
>KOG0669|consensus
Probab=90.70  E-value=0.025  Score=40.03  Aligned_cols=22  Identities=45%  Similarity=0.715  Sum_probs=19.4

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.|+.+..||+|.||+|++|+
T Consensus        16 ~~~yek~~kigqGtfgeVFkAr   37 (376)
T KOG0669|consen   16 VSKYEKLAKIGQGTFGEVFKAR   37 (376)
T ss_pred             chHHHHHHhcCCchHHHHHHHh
Confidence            4678888999999999999986


No 240
>KOG1166|consensus
Probab=90.64  E-value=0.11  Score=41.46  Aligned_cols=23  Identities=35%  Similarity=0.476  Sum_probs=19.6

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .-++|.|-+.||+|+||+||.|.
T Consensus       696 ~~~~~~I~~e~G~g~y~~vy~a~  718 (974)
T KOG1166|consen  696 GGEKFCISKEIGEGSYGSVYVAT  718 (974)
T ss_pred             cceeEEEEeeeccccceEEEEee
Confidence            34578888899999999999985


No 241
>KOG1187|consensus
Probab=90.53  E-value=0.15  Score=35.88  Aligned_cols=21  Identities=33%  Similarity=0.699  Sum_probs=18.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++|..-.+||+|+||.||.+.
T Consensus        75 ~~Fs~~~~ig~Ggfg~VYkG~   95 (361)
T KOG1187|consen   75 NNFSESNLIGEGGFGTVYKGV   95 (361)
T ss_pred             hCCchhcceecCCCeEEEEEE
Confidence            678888899999999999763


No 242
>KOG0581|consensus
Probab=90.42  E-value=0.12  Score=37.22  Aligned_cols=25  Identities=32%  Similarity=0.437  Sum_probs=22.3

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++++|++.+..||.|+-|.|++|+
T Consensus        75 ~i~~~dle~~~~lG~G~gG~V~kv~   99 (364)
T KOG0581|consen   75 GISLSDLERLGVLGSGNGGTVYKVR   99 (364)
T ss_pred             ccCHHHhhhhhhcccCCCcEEEEEE
Confidence            4566799999999999999999986


No 243
>KOG0575|consensus
Probab=89.97  E-value=0.15  Score=38.81  Aligned_cols=22  Identities=23%  Similarity=0.656  Sum_probs=19.6

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|..-++||+|+|..||.|+|
T Consensus        18 ~~Y~~g~~LGkGgFA~cYe~~~   39 (592)
T KOG0575|consen   18 KRYKRGRFLGKGGFARCYEARD   39 (592)
T ss_pred             ceeeeeeeeccCcceEEEEEEE
Confidence            4599999999999999999875


No 244
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=89.85  E-value=0.13  Score=33.90  Aligned_cols=22  Identities=23%  Similarity=0.187  Sum_probs=17.8

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      +-|+....||.|+||.||+|.+
T Consensus        21 ~~~~~~~~ig~g~~g~v~~~~~   42 (297)
T cd06659          21 SLLENYIKIGEGSTGIVCIARE   42 (297)
T ss_pred             hhHHhhhhcCCCCceeEEEEEE
Confidence            4566677899999999999853


No 245
>KOG0606|consensus
Probab=89.78  E-value=0.23  Score=40.36  Aligned_cols=26  Identities=27%  Similarity=0.422  Sum_probs=22.7

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...-+||+.||+|-.|+||-||++++
T Consensus        79 ~p~e~df~~IklisngAygavylvrh  104 (1205)
T KOG0606|consen   79 APSESDFNTIKLISNGAYGAVYLVRH  104 (1205)
T ss_pred             CCCccccceeEeeccCCCCceeeeec
Confidence            34558999999999999999999964


No 246
>KOG1095|consensus
Probab=89.64  E-value=0.18  Score=40.47  Aligned_cols=23  Identities=35%  Similarity=0.648  Sum_probs=18.1

Q ss_pred             CCCCCCCccccccCCccceEeee
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKK   62 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La   62 (64)
                      ++.+.-.....||+|+||+||-+
T Consensus       689 v~~~~v~l~~~lG~G~FG~VY~g  711 (1025)
T KOG1095|consen  689 VPRKNVTLLRVLGKGAFGEVYEG  711 (1025)
T ss_pred             CChhheEeeeeeccccccceEEE
Confidence            34456666789999999999965


No 247
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional
Probab=89.61  E-value=0.18  Score=38.62  Aligned_cols=20  Identities=30%  Similarity=0.338  Sum_probs=16.9

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      +|....+||+|+||.||.|.
T Consensus       691 ~~~~~~~ig~G~~g~Vy~~~  710 (968)
T PLN00113        691 SLKEENVISRGKKGASYKGK  710 (968)
T ss_pred             hCCcccEEccCCCeeEEEEE
Confidence            45666789999999999986


No 248
>KOG0671|consensus
Probab=89.46  E-value=0.17  Score=36.99  Aligned_cols=23  Identities=26%  Similarity=0.611  Sum_probs=19.6

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...|.+++.+|.|+||+|..+.|
T Consensus        88 ~~Ry~i~~~lGeGtFGkV~ec~D  110 (415)
T KOG0671|consen   88 TNRYEIVDLLGEGTFGKVVECWD  110 (415)
T ss_pred             ccceehhhhhcCCcccceEEEee
Confidence            35689999999999999987764


No 249
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=88.64  E-value=0.16  Score=33.48  Aligned_cols=21  Identities=24%  Similarity=0.292  Sum_probs=17.5

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|..+..||.|+||.||+|.
T Consensus        22 ~~~~~~~~lg~g~~g~v~~~~   42 (292)
T cd06658          22 EYLDSFIKIGEGSTGIVCIAT   42 (292)
T ss_pred             HHHhhhhcccCCCCeEEEEEE
Confidence            456667889999999999885


No 250
>KOG0197|consensus
Probab=88.57  E-value=0.091  Score=38.89  Aligned_cols=20  Identities=25%  Similarity=0.496  Sum_probs=16.1

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+..++-||+|.||+|++..
T Consensus       207 ~l~l~~~LG~G~FG~V~~g~  226 (468)
T KOG0197|consen  207 ELKLIRELGSGQFGEVWLGK  226 (468)
T ss_pred             HHHHHHHhcCCccceEEEEE
Confidence            34457789999999999874


No 251
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=88.43  E-value=0.21  Score=32.59  Aligned_cols=21  Identities=19%  Similarity=0.224  Sum_probs=17.8

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.|...+.||.|+||.||+|.
T Consensus        19 ~~~~~~~~lg~g~~g~v~~~~   39 (285)
T cd06648          19 SYLDNFVKIGEGSTGIVCIAT   39 (285)
T ss_pred             HhhhcceEeccCCCeEEEEEE
Confidence            356667899999999999985


No 252
>KOG0579|consensus
Probab=88.21  E-value=0.11  Score=40.94  Aligned_cols=25  Identities=32%  Similarity=0.607  Sum_probs=19.7

Q ss_pred             CCCC-CCCCccccccCCccceEeeec
Q psy17601         39 RLGV-EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~-~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++. +.+++|--||.|+||+||.|.
T Consensus        27 dlnP~d~WeIiGELGDGAFGKVyKA~   52 (1187)
T KOG0579|consen   27 DLNPRDHWEIIGELGDGAFGKVYKAV   52 (1187)
T ss_pred             cCCHHHHHHHHhhhcCccchhhhhhh
Confidence            4555 456778899999999999874


No 253
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=87.94  E-value=0.21  Score=32.90  Aligned_cols=20  Identities=20%  Similarity=0.225  Sum_probs=15.9

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      .|+..+.||+|+||.||++.
T Consensus        21 ~~~~~~~lg~g~~g~v~~~~   40 (292)
T cd06657          21 YLDNFIKIGEGSTGIVCIAT   40 (292)
T ss_pred             HhhhHHHcCCCCCeEEEEEE
Confidence            34446789999999999874


No 254
>KOG0586|consensus
Probab=87.92  E-value=0.29  Score=37.31  Aligned_cols=26  Identities=23%  Similarity=0.330  Sum_probs=22.2

Q ss_pred             CCCCCCCCccccccCCccceEeeecC
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+-.|.+++.||+|.|++|.||+.
T Consensus        52 ~~~vg~y~i~~tig~g~f~~V~La~~   77 (596)
T KOG0586|consen   52 SNSVGLYVIIKTIGKGNFAKVKLARH   77 (596)
T ss_pred             cccccceeeeeeeccceeEEEEeeEe
Confidence            44567899999999999999999863


No 255
>KOG4279|consensus
Probab=87.91  E-value=0.26  Score=39.24  Aligned_cols=15  Identities=33%  Similarity=0.727  Sum_probs=14.1

Q ss_pred             cccCCccceEeeecC
Q psy17601         50 VIGRGAFGECPKKID   64 (64)
Q Consensus        50 ~iG~G~fG~V~La~~   64 (64)
                      +||+|+||.||-|+|
T Consensus       582 VLGKGTYG~VYA~RD  596 (1226)
T KOG4279|consen  582 VLGKGTYGTVYAARD  596 (1226)
T ss_pred             EeecCceeEEEeecc
Confidence            799999999999986


No 256
>KOG0192|consensus
Probab=87.89  E-value=0.22  Score=35.34  Aligned_cols=24  Identities=25%  Similarity=0.480  Sum_probs=19.2

Q ss_pred             CCCCCCCccccccCCccceEeeec
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +..+++.+...||+|+||+||-+.
T Consensus        38 i~~~~l~~~~~iG~G~~g~V~~~~   61 (362)
T KOG0192|consen   38 IDPDELPIEEVLGSGSFGTVYKGK   61 (362)
T ss_pred             cChHHhhhhhhcccCCceeEEEEE
Confidence            445677777789999999999664


No 257
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=87.39  E-value=0.34  Score=35.33  Aligned_cols=19  Identities=32%  Similarity=0.340  Sum_probs=15.3

Q ss_pred             CCccccccCCccceEeeec
Q psy17601         45 FEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~   63 (64)
                      |...+.||+|+||.||++.
T Consensus       335 ~~~~~~iG~G~~g~Vy~~~  353 (535)
T PRK09605        335 KIPDHLIGKGAEADIKKGE  353 (535)
T ss_pred             cCccceeccCCcEEEEEEe
Confidence            3456789999999999853


No 258
>KOG0662|consensus
Probab=86.96  E-value=0.28  Score=33.51  Aligned_cols=21  Identities=24%  Similarity=0.605  Sum_probs=17.8

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..|+.+.-||.|+||.|+.|+
T Consensus         2 ~~ydkmekigegtygtvfkar   22 (292)
T KOG0662|consen    2 QKYDKMEKIGEGTYGTVFKAR   22 (292)
T ss_pred             cchHHHHhhcCCcceeeEecc
Confidence            356778889999999999886


No 259
>PRK10345 hypothetical protein; Provisional
Probab=86.46  E-value=0.43  Score=31.27  Aligned_cols=17  Identities=18%  Similarity=0.427  Sum_probs=14.0

Q ss_pred             CCccccccCCccceEee
Q psy17601         45 FEPLKVIGRGAFGECPK   61 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~L   61 (64)
                      ......||+|+||.||.
T Consensus         4 L~~~~~LG~G~~~~Vy~   20 (210)
T PRK10345          4 LSEQSPLGTGRHRKCYA   20 (210)
T ss_pred             cCCcceecCCCceEEEE
Confidence            44567899999999985


No 260
>KOG1345|consensus
Probab=85.94  E-value=0.27  Score=35.18  Aligned_cols=25  Identities=20%  Similarity=0.392  Sum_probs=21.5

Q ss_pred             CCCC-CCCCccccccCCccceEeeec
Q psy17601         39 RLGV-EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~-~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.+ +.|.+.+++|.|-||++.||+
T Consensus        19 kv~l~d~y~I~k~lgeG~FgkIlL~e   44 (378)
T KOG1345|consen   19 KVDLEDVYTINKQLGEGRFGKILLAE   44 (378)
T ss_pred             ccchhhhhhHHHHhcccceeeEEeee
Confidence            3444 789999999999999999986


No 261
>KOG3653|consensus
Probab=84.37  E-value=0.44  Score=35.82  Aligned_cols=23  Identities=35%  Similarity=0.569  Sum_probs=18.4

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++...+.+.+||+|.||.||.|-
T Consensus       208 ~l~pl~l~eli~~Grfg~V~Kaq  230 (534)
T KOG3653|consen  208 ELDPLQLLELIGRGRFGCVWKAQ  230 (534)
T ss_pred             cCCchhhHHHhhcCccceeehhh
Confidence            45566667799999999999873


No 262
>KOG1290|consensus
Probab=83.58  E-value=0.49  Score=35.86  Aligned_cols=22  Identities=18%  Similarity=0.279  Sum_probs=19.2

Q ss_pred             CCCCccccccCCccceEeeecC
Q psy17601         43 EDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ..|-+++-||=|+|.+||||.|
T Consensus        78 gRY~v~rKLGWGHFSTVWLawD   99 (590)
T KOG1290|consen   78 GRYHVQRKLGWGHFSTVWLAWD   99 (590)
T ss_pred             ceEEEEEeccccccceeEEEee
Confidence            4566888999999999999976


No 263
>KOG2345|consensus
Probab=82.39  E-value=0.6  Score=32.83  Aligned_cols=25  Identities=12%  Similarity=0.256  Sum_probs=21.8

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++-+.|.+.+.+|.|+|.-|+|+.
T Consensus        17 ~In~~Ryri~~~LgeGGfsfv~LV~   41 (302)
T KOG2345|consen   17 IINNKRYRIQRLLGEGGFSFVDLVK   41 (302)
T ss_pred             EEcCceEEEeeeecCCCceeeeeec
Confidence            4566789999999999999999985


No 264
>PRK12274 serine/threonine protein kinase; Provisional
Probab=82.05  E-value=0.92  Score=30.52  Aligned_cols=20  Identities=10%  Similarity=-0.039  Sum_probs=16.6

Q ss_pred             CCccccccCCccceEeeecC
Q psy17601         45 FEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~~   64 (64)
                      +.+..+|++|+||+|+++.+
T Consensus         4 ~~~~~~l~~~~f~~v~~~~~   23 (218)
T PRK12274          4 PAVNEPLKSDTFGRILLVRG   23 (218)
T ss_pred             cccceeecCCCcceEEEeec
Confidence            45677899999999999853


No 265
>PF13035 DUF3896:  Protein of unknown function (DUF3896)
Probab=81.17  E-value=3.2  Score=22.56  Aligned_cols=28  Identities=25%  Similarity=0.312  Sum_probs=22.0

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHHHHH
Q psy17601          2 AKLEESLKDESLSETQRQEKRQQHAQKE   29 (64)
Q Consensus         2 ~~Le~~l~~~~l~~~~~~~~~~~~~~~e   29 (64)
                      ++|-++|.++.|++++++++.-.....|
T Consensus        19 q~lc~kls~~~ls~~er~qi~~eidnye   46 (61)
T PF13035_consen   19 QQLCKKLSSMHLSEKEREQIKLEIDNYE   46 (61)
T ss_pred             HHHHHHHhhcccCHHHHHHHHhhhhhHH
Confidence            4677899999999999998876655443


No 266
>KOG0584|consensus
Probab=81.16  E-value=0.76  Score=35.30  Aligned_cols=15  Identities=53%  Similarity=0.837  Sum_probs=14.2

Q ss_pred             cccCCccceEeeecC
Q psy17601         50 VIGRGAFGECPKKID   64 (64)
Q Consensus        50 ~iG~G~fG~V~La~~   64 (64)
                      +||+|+|-+||.|+|
T Consensus        47 vLGrGafKtVYka~D   61 (632)
T KOG0584|consen   47 VLGRGAFKTVYKAFD   61 (632)
T ss_pred             hcccccceeeeeccc
Confidence            899999999999987


No 267
>KOG0668|consensus
Probab=80.98  E-value=0.27  Score=34.56  Aligned_cols=23  Identities=30%  Similarity=0.655  Sum_probs=20.6

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.+||++++-+|+|.|.+|+-++
T Consensus        36 ~~ddYeivrk~GRGKYSEVFeg~   58 (338)
T KOG0668|consen   36 NQDDYEIVRKVGRGKYSEVFEGI   58 (338)
T ss_pred             ccchHHHHHHHcCccHhhHhccc
Confidence            67999999999999999998654


No 268
>KOG2052|consensus
Probab=80.35  E-value=0.73  Score=34.50  Aligned_cols=21  Identities=29%  Similarity=0.501  Sum_probs=17.7

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+-.++.+||+|-||+||-+.
T Consensus       211 rqI~L~e~IGkGRyGEVwrG~  231 (513)
T KOG2052|consen  211 RQIVLQEIIGKGRFGEVWRGR  231 (513)
T ss_pred             heeEEEEEecCccccceeecc
Confidence            567778899999999998754


No 269
>KOG4250|consensus
Probab=78.56  E-value=1  Score=35.07  Aligned_cols=18  Identities=33%  Similarity=0.521  Sum_probs=14.6

Q ss_pred             CccccccCCccceEeeec
Q psy17601         46 EPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        46 ~~~~~iG~G~fG~V~La~   63 (64)
                      ..-..||+||||.||..+
T Consensus        16 ~~~e~LG~Ga~g~V~rgr   33 (732)
T KOG4250|consen   16 EMDERLGKGAFGNVYRGR   33 (732)
T ss_pred             eehhhhcCCccceeeeec
Confidence            334589999999999875


No 270
>KOG1165|consensus
Probab=77.48  E-value=1.2  Score=32.61  Aligned_cols=19  Identities=32%  Similarity=0.406  Sum_probs=17.1

Q ss_pred             CCCccccccCCccceEeee
Q psy17601         44 DFEPLKVIGRGAFGECPKK   62 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La   62 (64)
                      .|.+-+-||.|+||..++.
T Consensus        29 hyrVGkKIGeGsFG~lf~G   47 (449)
T KOG1165|consen   29 HYRVGKKIGEGSFGVLFLG   47 (449)
T ss_pred             cceeccccccCcceeeecc
Confidence            6999999999999998864


No 271
>KOG0574|consensus
Probab=77.32  E-value=0.28  Score=35.74  Aligned_cols=21  Identities=33%  Similarity=0.665  Sum_probs=18.3

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +-|+++--||.|+||.|+.|+
T Consensus        33 EVFDi~~KLGEGSYGSV~KAI   53 (502)
T KOG0574|consen   33 EVFDIVGKLGEGSYGSVHKAI   53 (502)
T ss_pred             HHHHHHHHhcCCcchHHHHHH
Confidence            458888899999999999875


No 272
>KOG1025|consensus
Probab=74.97  E-value=1.4  Score=35.71  Aligned_cols=19  Identities=47%  Similarity=0.700  Sum_probs=14.9

Q ss_pred             CCccccccCCccceEeeec
Q psy17601         45 FEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~   63 (64)
                      +...++||.|+||.||..+
T Consensus       698 lkk~kvLGsgAfGtV~kGi  716 (1177)
T KOG1025|consen  698 LKKDKVLGSGAFGTVYKGI  716 (1177)
T ss_pred             hhhhceeccccceeEEeee
Confidence            3445689999999999754


No 273
>KOG1006|consensus
Probab=74.60  E-value=0.76  Score=32.83  Aligned_cols=23  Identities=35%  Similarity=0.642  Sum_probs=17.8

Q ss_pred             CCCCCCCCccccccCCccceEee
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPK   61 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~L   61 (64)
                      .++.++.+-+-.||+|+||.|+.
T Consensus        60 ~F~~~~Lqdlg~iG~G~fG~V~K   82 (361)
T KOG1006|consen   60 TFTSDNLQDLGEIGNGAFGTVNK   82 (361)
T ss_pred             ccccchHHHHHHhcCCcchhhhh
Confidence            34556667788999999999964


No 274
>PHA02988 hypothetical protein; Provisional
Probab=74.40  E-value=1.4  Score=28.88  Aligned_cols=24  Identities=17%  Similarity=0.209  Sum_probs=19.1

Q ss_pred             CCCCCCCcc--ccccCCccceEeeec
Q psy17601         40 LGVEDFEPL--KVIGRGAFGECPKKI   63 (64)
Q Consensus        40 ~~~~dF~~~--~~iG~G~fG~V~La~   63 (64)
                      +..+|++..  ..||.|++|.||.+.
T Consensus        15 i~~~~i~~~~~~~i~~g~~~~v~~~~   40 (283)
T PHA02988         15 IESDDIDKYTSVLIKENDQNSIYKGI   40 (283)
T ss_pred             cCHHHcCCCCCeEEeeCCceEEEEEE
Confidence            455666666  689999999999875


No 275
>KOG1167|consensus
Probab=73.77  E-value=0.69  Score=33.96  Aligned_cols=23  Identities=26%  Similarity=0.510  Sum_probs=19.9

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...|..+..||.|+|+.|++|.+
T Consensus        35 ~~~~~~v~kigeGsFssv~~a~~   57 (418)
T KOG1167|consen   35 SNAYKVVNKIGEGSFSSVYKATD   57 (418)
T ss_pred             hhhhhhhccccccchhhhhhhhH
Confidence            35788899999999999999864


No 276
>KOG0582|consensus
Probab=72.21  E-value=2.3  Score=32.01  Aligned_cols=25  Identities=32%  Similarity=0.325  Sum_probs=23.2

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++.++|++...||.|.=+.||+|+
T Consensus        22 p~n~~~YeL~e~IG~G~sa~V~~A~   46 (516)
T KOG0582|consen   22 PLNAKDYELQEVIGVGASAVVYLAR   46 (516)
T ss_pred             CCCccceeEEEEEeccceeEeeeee
Confidence            5788999999999999999999997


No 277
>PF11181 YflT:  Heat induced stress protein YflT
Probab=72.18  E-value=6.4  Score=22.89  Aligned_cols=25  Identities=20%  Similarity=0.287  Sum_probs=20.9

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHH
Q psy17601          2 AKLEESLKDESLSETQRQEKRQQHA   26 (64)
Q Consensus         2 ~~Le~~l~~~~l~~~~~~~~~~~~~   26 (64)
                      ..+..+|.++|||+++..++...+.
T Consensus        71 d~~~~~l~~lGl~~~ea~~y~~~l~   95 (103)
T PF11181_consen   71 DELRSKLESLGLSEDEAERYEEELD   95 (103)
T ss_pred             HHHHHHHHHcCCCHHHHHHHHHHHH
Confidence            3578899999999999888877664


No 278
>KOG0200|consensus
Probab=71.72  E-value=2  Score=32.20  Aligned_cols=20  Identities=35%  Similarity=0.645  Sum_probs=15.7

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      ++.+.+.||.|+||+|+.+.
T Consensus       297 ~l~~~~~lg~g~fG~v~~~~  316 (609)
T KOG0200|consen  297 NLKLGKYLGEGAFGQVVKAL  316 (609)
T ss_pred             hccccceeecccccceEeEE
Confidence            34455699999999999874


No 279
>KOG4257|consensus
Probab=71.38  E-value=2.8  Score=33.18  Aligned_cols=16  Identities=38%  Similarity=0.796  Sum_probs=13.6

Q ss_pred             cccccCCccceEeeec
Q psy17601         48 LKVIGRGAFGECPKKI   63 (64)
Q Consensus        48 ~~~iG~G~fG~V~La~   63 (64)
                      -++||.|-||.||.+.
T Consensus       394 ~r~iG~GqFGdVy~gv  409 (974)
T KOG4257|consen  394 KRLIGEGQFGDVYKGV  409 (974)
T ss_pred             HHhhcCCcccceeeeE
Confidence            4489999999999864


No 280
>KOG1989|consensus
Probab=71.03  E-value=2.2  Score=33.42  Aligned_cols=21  Identities=24%  Similarity=0.302  Sum_probs=17.6

Q ss_pred             CCCccccccCCccceEeeecC
Q psy17601         44 DFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~~   64 (64)
                      ...+.+.|-.|||+.||||.+
T Consensus        38 ~v~V~~vLAEGGFa~VYla~~   58 (738)
T KOG1989|consen   38 RVTVEKVLAEGGFAQVYLAQD   58 (738)
T ss_pred             EEEEEEEEccCCcEEEEEEEe
Confidence            445677999999999999974


No 281
>KOG0587|consensus
Probab=70.81  E-value=2.2  Score=34.18  Aligned_cols=23  Identities=35%  Similarity=0.586  Sum_probs=19.9

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      --+-|+++-+||.|.||+||.+.
T Consensus        17 p~d~~ei~evig~Gtygkv~k~k   39 (953)
T KOG0587|consen   17 PADIFEIIEVIGNGTYGKVYKGR   39 (953)
T ss_pred             CCCccEEEEEEeeccceeEEEEe
Confidence            34679999999999999999874


No 282
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed
Probab=70.76  E-value=2.3  Score=31.85  Aligned_cols=21  Identities=14%  Similarity=0.267  Sum_probs=18.1

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .++|+. +.||.||+|+|+.|.
T Consensus       119 F~~fd~-~PlasaSiaQVh~A~  139 (537)
T PRK04750        119 FDDFDI-KPLASASIAQVHFAR  139 (537)
T ss_pred             HHhcCh-hhhcCCCccEEEEEE
Confidence            356887 899999999999985


No 283
>KOG1033|consensus
Probab=68.80  E-value=2.1  Score=32.24  Aligned_cols=23  Identities=39%  Similarity=0.678  Sum_probs=19.6

Q ss_pred             CCCCCCCccccccCCccceEeee
Q psy17601         40 LGVEDFEPLKVIGRGAFGECPKK   62 (64)
Q Consensus        40 ~~~~dF~~~~~iG~G~fG~V~La   62 (64)
                      ...++|+...++|+|+||.|+-|
T Consensus        46 r~a~~~e~~~~~~~~g~~~~~~~   68 (516)
T KOG1033|consen   46 REANDFEPGQCLGRGGFGVVFSA   68 (516)
T ss_pred             hhhccccccccccccCccccCCc
Confidence            34689999999999999999754


No 284
>KOG0596|consensus
Probab=68.05  E-value=2.1  Score=33.05  Aligned_cols=22  Identities=32%  Similarity=0.431  Sum_probs=19.6

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      =..|++++.||+|+=.+||+|.
T Consensus       360 g~~Yeilk~iG~GGSSkV~kV~  381 (677)
T KOG0596|consen  360 GREYEILKQIGSGGSSKVFKVL  381 (677)
T ss_pred             cchhhHHHhhcCCCcceeeeee
Confidence            3579999999999999999986


No 285
>KOG4258|consensus
Probab=67.42  E-value=2.8  Score=33.77  Aligned_cols=15  Identities=27%  Similarity=0.525  Sum_probs=12.9

Q ss_pred             cccccCCccceEeee
Q psy17601         48 LKVIGRGAFGECPKK   62 (64)
Q Consensus        48 ~~~iG~G~fG~V~La   62 (64)
                      .+.||.|+||.||+.
T Consensus       999 ~relg~gsfg~Vy~g 1013 (1025)
T KOG4258|consen  999 GRELGQGSFGMVYEG 1013 (1025)
T ss_pred             hhhhccCccceEEEe
Confidence            557999999999974


No 286
>KOG4717|consensus
Probab=67.00  E-value=1.6  Score=33.89  Aligned_cols=21  Identities=24%  Similarity=0.336  Sum_probs=18.2

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .-|+.-+.||+|+|..|.||+
T Consensus        18 GLYDLekTlG~GHFAVVKLAr   38 (864)
T KOG4717|consen   18 GLYDLEKTLGRGHFAVVKLAR   38 (864)
T ss_pred             eeehhhhhhcCCceehhhhhh
Confidence            357778899999999999986


No 287
>KOG0664|consensus
Probab=65.35  E-value=4.4  Score=29.34  Aligned_cols=23  Identities=39%  Similarity=0.567  Sum_probs=18.9

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      --|.+.=+.||=|+||.||-+-|
T Consensus        52 q~Di~PDRPIGYGAFGVVWsVTD   74 (449)
T KOG0664|consen   52 QQDIQPDRPIGYGAFGVVWSVTD   74 (449)
T ss_pred             cccCCCCCcccccceeEEEeccC
Confidence            35677889999999999997654


No 288
>KOG0199|consensus
Probab=64.23  E-value=4.8  Score=32.30  Aligned_cols=57  Identities=19%  Similarity=0.376  Sum_probs=33.7

Q ss_pred             HHHhcCCCCHHHHHHHHHHHHHHHHH----------HHhh---hccCC--------------CCCCCCccccccCCccce
Q psy17601          6 ESLKDESLSETQRQEKRQQHAQKETE----------FLRL---KRSRL--------------GVEDFEPLKVIGRGAFGE   58 (64)
Q Consensus         6 ~~l~~~~l~~~~~~~~~~~~~~~e~~----------~~r~---~~~~~--------------~~~dF~~~~~iG~G~fG~   58 (64)
                      ..|.+.|+..-+++++++++.+....          |.+.   ++...              ..++......||.|+||.
T Consensus        46 eDLl~IGMgRp~qRRLrea~kkm~~~~k~kswvkKvf~ga~p~h~~~t~~~~~p~~~lkclIpee~i~l~e~LG~GsFgv  125 (1039)
T KOG0199|consen   46 EDLLEIGMGRPQQRRLREAIKKMSREMKNKSWVKKVFIGADPSHPAQTNSVANPSIDLKCLIPEEQIKLYELLGEGSFGV  125 (1039)
T ss_pred             hhhhhhccCcHHHHHHHHHHHHhhhhccccchHHHHhccCCccccccccCCCCcCCCcceeccHHHHHHHHHhcCcceee
Confidence            45667777777777888877764333          1111   11110              112333455799999999


Q ss_pred             Eeee
Q psy17601         59 CPKK   62 (64)
Q Consensus        59 V~La   62 (64)
                      |+-+
T Consensus       126 V~rg  129 (1039)
T KOG0199|consen  126 VKRG  129 (1039)
T ss_pred             Eeec
Confidence            9865


No 289
>KOG0196|consensus
Probab=62.47  E-value=4  Score=32.80  Aligned_cols=25  Identities=32%  Similarity=0.379  Sum_probs=19.1

Q ss_pred             CCCCCCCCccccccCCccceEeeec
Q psy17601         39 RLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        39 ~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      -+..+.-.+-++||.|-||+|+..+
T Consensus       625 EId~s~i~Ie~VIGaGEFGEVc~Gr  649 (996)
T KOG0196|consen  625 EIDPSCVKIEKVIGAGEFGEVCSGR  649 (996)
T ss_pred             hcChhheEEEEEEecccccceeccc
Confidence            3455566667799999999998754


No 290
>PF08988 DUF1895:  Protein of unknown function (DUF1895);  InterPro: IPR015081 The YscE protein, produced by the pathogen Yersinia, assumes a secondary structure composed of two anti-parallel alpha-helices separated by a flexible loop. The function of this protein is, as yet, unknown. ; PDB: 1ZW0_B 2P58_A 2UWJ_E 2Q1K_D 3PH0_B.
Probab=57.78  E-value=18  Score=20.11  Aligned_cols=44  Identities=20%  Similarity=0.244  Sum_probs=33.1

Q ss_pred             HHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHhhhccCCCCCCCCcc
Q psy17601          3 KLEESLKDESLSETQRQEKRQQHAQKETEFLRLKRSRLGVEDFEPL   48 (64)
Q Consensus         3 ~Le~~l~~~~l~~~~~~~~~~~~~~~e~~~~r~~~~~~~~~dF~~~   48 (64)
                      +||+.|..  -+++++..+...+....+..-|.-..-..+++|...
T Consensus         3 ~LE~~L~~--~~~~~~~~i~~~L~~a~~~vkr~L~~G~~P~eyQq~   46 (68)
T PF08988_consen    3 NLEQRLSN--ASGEEARAIEQQLRQAQSQVKRKLDRGGTPQEYQQL   46 (68)
T ss_dssp             HHHHHHTC--TSHHHHHHHHHHHHHHHHHHHHHHTCTSSHHHHHHH
T ss_pred             hHHHHHHh--ccHHHHHHHHHHHHHHHHHHHHHhcCCCCHHHHHHH
Confidence            68888887  578888888888888888777766656666666543


No 291
>PF02216 B:  B domain;  InterPro: IPR003132 This entry represents the immunoglobulin-binding domain found in the Staphylococcus aureus virulence factor protein A (SpA). Protein A contains five highly homologous Ig-binding domains in tandem (designated domains E, D, A, B and C), which share a common structure consisting of three helices in a closed left-handed twist. Protein A can exist in both secreted and membrane-bound forms, and has two distinct Ig-binding activities: each domain can bind Fc-gamma (the constant region of IgG involved in effector functions) and Fab (the Ig fragment responsible for antigen recognition) [].; GO: 0019865 immunoglobulin binding, 0009405 pathogenesis; PDB: 1EDL_A 1EDI_A 1EDJ_A 1EDK_A 2B88_A 2B87_A 2B89_A 1FC2_C 1DEE_H 1ZXG_A ....
Probab=56.93  E-value=17  Score=19.54  Aligned_cols=24  Identities=29%  Similarity=0.241  Sum_probs=18.2

Q ss_pred             HHHHHhcCCCCHHHHHHHHHHHHH
Q psy17601          4 LEESLKDESLSETQRQEKRQQHAQ   27 (64)
Q Consensus         4 Le~~l~~~~l~~~~~~~~~~~~~~   27 (64)
                      .=+.|...+|++++|+.+...+-.
T Consensus        13 FY~vl~~~nLteeQrn~yI~~lKd   36 (54)
T PF02216_consen   13 FYEVLHMPNLTEEQRNGYIQSLKD   36 (54)
T ss_dssp             HHHHHCSTTS-HHHHHHHHHHHHH
T ss_pred             HHHHHcCCCcCHHHHHhHHHHHhh
Confidence            446788999999999998877643


No 292
>KOG0984|consensus
Probab=56.16  E-value=3.5  Score=28.62  Aligned_cols=19  Identities=32%  Similarity=0.711  Sum_probs=14.6

Q ss_pred             CCCCCccccccCCccceEe
Q psy17601         42 VEDFEPLKVIGRGAFGECP   60 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~   60 (64)
                      .+|...+.-||+|+||.|-
T Consensus        45 ad~L~~i~elGrGayG~ve   63 (282)
T KOG0984|consen   45 ADDLVGIEELGRGAYGVVE   63 (282)
T ss_pred             hhhhhhhhhhcCCccchhh
Confidence            3556667789999999873


No 293
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase. This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol - 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species.
Probab=53.28  E-value=6.4  Score=28.42  Aligned_cols=20  Identities=15%  Similarity=0.343  Sum_probs=15.7

Q ss_pred             CCCCccccccCCccceEeeec
Q psy17601         43 EDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ..|+. ..||.||+|+||.|.
T Consensus       118 ~~fd~-~plasaSigQVh~A~  137 (437)
T TIGR01982       118 AEFEE-KPLAAASIAQVHRAR  137 (437)
T ss_pred             hhCCC-cceeeeehhheEEEE
Confidence            34443 579999999999985


No 294
>KOG1094|consensus
Probab=51.37  E-value=8  Score=30.42  Aligned_cols=19  Identities=32%  Similarity=0.385  Sum_probs=15.3

Q ss_pred             CCccccccCCccceEeeec
Q psy17601         45 FEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        45 F~~~~~iG~G~fG~V~La~   63 (64)
                      .-+.+-||.|-||+|.|+.
T Consensus       540 L~~~ekiGeGqFGEVhLCe  558 (807)
T KOG1094|consen  540 LRFKEKIGEGQFGEVHLCE  558 (807)
T ss_pred             eehhhhhcCcccceeEEEE
Confidence            3445679999999999975


No 295
>cd07921 PCA_45_Doxase_A_like Subunit A of the Class III Extradiol dioxygenase, Protocatechuate 4,5-dioxygenase, and similar enzymes. This subfamily includes the A subunit of protocatechuate (PCA) 4,5-dioxygenase (LigAB) and two subfamilies of unknown function. The A subunit is the smaller, non-catalytic subunit of LigAB. PCA 4,5-dioxygenase catalyzes the oxidization and subsequent ring-opening of PCA (or 3,4-dihydroxybenzoic acid), which is an intermediate in the breakdown of lignin and other compounds. PCA 4,5-dioxygenase is one of the aromatic ring opening dioxygenases which play key roles in the degradation of aromatic compounds. As members of the Class III extradiol dioxygenase family, the enzymes use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit.
Probab=50.78  E-value=19  Score=21.85  Aligned_cols=18  Identities=28%  Similarity=0.204  Sum_probs=15.1

Q ss_pred             HHHHhcCCCCHHHHHHHH
Q psy17601          5 EESLKDESLSETQRQEKR   22 (64)
Q Consensus         5 e~~l~~~~l~~~~~~~~~   22 (64)
                      +..|++.+||++|++.+.
T Consensus        37 eAy~~~~gLTeEe~~AV~   54 (106)
T cd07921          37 EAYCDKFGLTEEQKQAVL   54 (106)
T ss_pred             HHHHHHcCCCHHHHHHHH
Confidence            678899999999987764


No 296
>cd07321 Extradiol_Dioxygenase_3A_like Subunit A of Class III extradiol dioxygenases. Extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings.  There are two major groups of dioxygenases according to the cleavage site of the aromatic ring. Intradiol enzymes cleave the aromatic ring between two hydroxyl groups, whereas extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes are evolutionary related and show sequence similarity, with the two domain class II enzymes evolving from the class I enzyme through gene duplication. Class III enzymes are different in sequence and structure and usually have two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents subunit A of c
Probab=50.72  E-value=17  Score=20.38  Aligned_cols=19  Identities=16%  Similarity=0.162  Sum_probs=14.9

Q ss_pred             HHHHHhcCCCCHHHHHHHH
Q psy17601          4 LEESLKDESLSETQRQEKR   22 (64)
Q Consensus         4 Le~~l~~~~l~~~~~~~~~   22 (64)
                      =+..|++.+||++|++.+.
T Consensus        26 p~a~~~~~~Lt~eE~~al~   44 (77)
T cd07321          26 PEAVLAEYGLTPEEKAALL   44 (77)
T ss_pred             HHHHHHHcCCCHHHHHHHH
Confidence            3567889999999987654


No 297
>cd07923 Gallate_dioxygenase_C The C-terminal domain of Gallate Dioxygenase, which catalyzes the oxidization and subsequent ring-opening of gallate. Gallate Dioxygenase catalyzes the oxidization and subsequent ring-opening of gallate, an intermediate in the degradation of the aromatic compound, syringate. The reaction product of gallate dioxygenase is 4-oxalomesaconate. The amino acid sequence of the N-terminal and C-terminal regions of gallate dioxygenase exhibits homology with the sequence of the PCA 4,5-dioxygenase B (catalytic) and A subunits, respectively. This model represents the C-terminal domain, which is similar to the A subunit of PCA 4,5-dioxygenase (or LigAB). The enzyme is estimated to be a homodimer according to the Escherichia coli enzyme. Since enzymes in this subfamily have fused A and B subunits, the dimer interface may resemble the tetramer interface of classical LigAB enzymes. This enzyme belongs to the class III extradiol dioxygenase family, composed of enzymes whi
Probab=49.09  E-value=18  Score=21.46  Aligned_cols=20  Identities=25%  Similarity=0.343  Sum_probs=16.0

Q ss_pred             HHHHHHhcCCCCHHHHHHHH
Q psy17601          3 KLEESLKDESLSETQRQEKR   22 (64)
Q Consensus         3 ~Le~~l~~~~l~~~~~~~~~   22 (64)
                      +-|..|.+.+||++|++.+.
T Consensus        27 D~ea~~~e~gLt~Ee~~av~   46 (94)
T cd07923          27 DPEALFDEAGLTEEERTLIR   46 (94)
T ss_pred             CHHHHHHHcCCCHHHHHHHH
Confidence            34778999999999987654


No 298
>KOG4236|consensus
Probab=48.21  E-value=7.3  Score=30.53  Aligned_cols=19  Identities=26%  Similarity=0.543  Sum_probs=14.4

Q ss_pred             CCccc--cccCCccceEeeec
Q psy17601         45 FEPLK--VIGRGAFGECPKKI   63 (64)
Q Consensus        45 F~~~~--~iG~G~fG~V~La~   63 (64)
                      |+++.  +||.|-||.||=++
T Consensus       564 YQif~devLGSGQFG~VYgg~  584 (888)
T KOG4236|consen  564 YQIFADEVLGSGQFGTVYGGK  584 (888)
T ss_pred             HHhhhHhhccCCcceeeecce
Confidence            44443  89999999999653


No 299
>PF10346 Con-6:  Conidiation protein 6;  InterPro: IPR018824 This entry represents a conserved region found in fungal conidiation-specific protein 6 []. This protein is expressed approximately 6 hours after the induction of development and is induced just prior to major constriction-chain growth []. 
Probab=45.83  E-value=39  Score=16.68  Aligned_cols=23  Identities=22%  Similarity=0.410  Sum_probs=18.3

Q ss_pred             HHHHHhcCCCCHHHHHHHHHHHH
Q psy17601          4 LEESLKDESLSETQRQEKRQQHA   26 (64)
Q Consensus         4 Le~~l~~~~l~~~~~~~~~~~~~   26 (64)
                      +...|.+++.|++-|+...+.+.
T Consensus        10 ~KAal~NPnvSeeaK~~A~~~Le   32 (36)
T PF10346_consen   10 YKAALHNPNVSEEAKQHAREKLE   32 (36)
T ss_pred             HHHHhcCCCcCHHHHHHHHHHHH
Confidence            56778999999998887766654


No 300
>PF14167 YfkD:  YfkD-like protein
Probab=44.42  E-value=11  Score=25.65  Aligned_cols=13  Identities=23%  Similarity=0.284  Sum_probs=11.1

Q ss_pred             cccCCccceEeee
Q psy17601         50 VIGRGAFGECPKK   62 (64)
Q Consensus        50 ~iG~G~fG~V~La   62 (64)
                      -=|+-+||+|||+
T Consensus       181 EkGkvtyGEVYl~  193 (232)
T PF14167_consen  181 EKGKVTYGEVYLV  193 (232)
T ss_pred             ccCceeEEEEEEE
Confidence            4688999999986


No 301
>KOG1024|consensus
Probab=44.18  E-value=12  Score=28.18  Aligned_cols=28  Identities=14%  Similarity=0.180  Sum_probs=21.0

Q ss_pred             hccCCCCCCCCccccccCCccceEeeec
Q psy17601         36 KRSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        36 ~~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +...+....|....++..|.||+||-++
T Consensus       277 ~~l~v~r~Rv~l~~llqEGtFGri~~gI  304 (563)
T KOG1024|consen  277 QELTVQRCRVRLSCLLQEGTFGRIYRGI  304 (563)
T ss_pred             HhhhhhhhheechhhhhcCchhheeeee
Confidence            3334445567778899999999999874


No 302
>KOG4645|consensus
Probab=44.11  E-value=12  Score=31.59  Aligned_cols=14  Identities=36%  Similarity=0.748  Sum_probs=12.6

Q ss_pred             cccCCccceEeeec
Q psy17601         50 VIGRGAFGECPKKI   63 (64)
Q Consensus        50 ~iG~G~fG~V~La~   63 (64)
                      .||.|.||+||-|.
T Consensus      1242 ~Ig~G~fG~VYtav 1255 (1509)
T KOG4645|consen 1242 FIGGGTFGKVYTAV 1255 (1509)
T ss_pred             ccCCcceeeeEEee
Confidence            59999999999875


No 303
>cd07922 CarBa CarBa is the A subunit of 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and   subsequent ring-opening of 2-aminophenyl-2,3-diol. CarBa is the A subunit of 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-aminophenyl-2,3-diol. 2-aminophenol 1,6-dioxygenase is a key enzyme in the carbazole degradation pathway isolated from bacterial strains with carbazole degradation ability. The enzyme is a heterotetramer composed of two A and two B subunits. CarB belongs to the class III extradiol dioxygenase family, composed of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Although the enzyme was originally isolated as a meta-cleavage enzyme for 2'-aminobiphenyl-2,3-diol involved in carbazole degradation, the enzyme has also shown high specificity for 2,3-dihydroxybiphenyl.
Probab=43.70  E-value=25  Score=20.18  Aligned_cols=19  Identities=16%  Similarity=0.263  Sum_probs=15.4

Q ss_pred             HHHHHhcCCCCHHHHHHHH
Q psy17601          4 LEESLKDESLSETQRQEKR   22 (64)
Q Consensus         4 Le~~l~~~~l~~~~~~~~~   22 (64)
                      =+..+++.+||++|++.+.
T Consensus        27 Pea~~~~~gLt~eE~~aL~   45 (81)
T cd07922          27 PSAVFEEYGLTPAERAALR   45 (81)
T ss_pred             HHHHHHHcCCCHHHHHHHH
Confidence            4677899999999987764


No 304
>KOG0033|consensus
Probab=43.61  E-value=3.4  Score=29.42  Aligned_cols=20  Identities=20%  Similarity=0.562  Sum_probs=16.9

Q ss_pred             CCCCccccccCCccceEeee
Q psy17601         43 EDFEPLKVIGRGAFGECPKK   62 (64)
Q Consensus        43 ~dF~~~~~iG~G~fG~V~La   62 (64)
                      +.|++...||+|.|..|+-+
T Consensus        11 d~y~l~e~igkG~FSvVrRc   30 (355)
T KOG0033|consen   11 DNYDVKEELGKGAFSVVRRC   30 (355)
T ss_pred             hhhhHHHHHccCchHHHHHH
Confidence            67888889999999998743


No 305
>PF14531 Kinase-like:  Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A.
Probab=40.74  E-value=8.9  Score=26.68  Aligned_cols=19  Identities=26%  Similarity=0.413  Sum_probs=15.5

Q ss_pred             CccccccCCccceEeeecC
Q psy17601         46 EPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        46 ~~~~~iG~G~fG~V~La~~   64 (64)
                      ..-.+||.|+|+.|+.|.|
T Consensus        15 ~~~~~i~~g~~~~v~~v~d   33 (288)
T PF14531_consen   15 VRGRIIGKGGFSIVFEVTD   33 (288)
T ss_dssp             EEEEEEEEETTEEEEEEEE
T ss_pred             EEccccccCCceEEEEEEE
Confidence            3455899999999998864


No 306
>PF07746 LigA:  Aromatic-ring-opening dioxygenase LigAB, LigA subunit;  InterPro: IPR011986  Dioxygenases catalyse the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms. Cleavage of aromatic rings is one of the most important functions of dioxygenases, which play key roles in the degradation of aromatic compounds. The substrates of ring-cleavage dioxygenases can be classified into two groups according to the mode of scission of the aromatic ring. Intradiol enzymes (IPR000627 from INTERPRO) use a non-haem Fe(III) to cleave the aromatic ring between two hydroxyl groups (ortho-cleavage), whereas extradiol enzymes use a non-haem Fe(II) to cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon (meta-cleavage) [, ]. These two subfamilies differ in sequence, structural fold, iron ligands, and the orientation of second sphere active site amino acid residues. Extradiol dioxygenases are usually homo-multimeric, bind one atom of ferrous ion per subunit and have a subunit size of about 33 kDa. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes (IPR000486 from INTERPRO) show sequence similarity, with the two-domain class II enzymes having evolved from a class I enzyme through gene duplication. Class III enzymes are different in sequence and structure, but they do share several common active-site characteristics with the class II enzymes, in particular the coordination sphere and the disposition of the putative catalytic base are very similar. Class III enzymes usually have two subunits, designated A (IPR004183 from INTERPRO) and B (IPR004183 from INTERPRO). LigAB is a protocatechuate 4,5-dioxygenase (1.13.11.8 from EC) that belongs to the extradiol class III enzyme family. The LigA subunit of this enzyme is multi-helical, containing a compact array of 6 short helices [].; PDB: 1BOU_A 1B4U_A.
Probab=40.50  E-value=34  Score=19.84  Aligned_cols=20  Identities=30%  Similarity=0.318  Sum_probs=13.6

Q ss_pred             HHHHHHhcCCCCHHHHHHHH
Q psy17601          3 KLEESLKDESLSETQRQEKR   22 (64)
Q Consensus         3 ~Le~~l~~~~l~~~~~~~~~   22 (64)
                      +=+..|++.+||++|++.+.
T Consensus        20 D~~a~~~~~~Lt~eer~av~   39 (88)
T PF07746_consen   20 DPEAYLDEYGLTEEERQAVL   39 (88)
T ss_dssp             -HHHHHHCCT--HHHHHHHH
T ss_pred             CHHHHHHHcCCCHHHHHHHH
Confidence            34678899999999987753


No 307
>cd07925 LigA_like_1 The A subunit of Uncharacterized proteins with similarity to Protocatechuate 4,5-dioxygenase (LigAB). The proteins of unknown function in this subfamily are similar to the A subunit of the Protocatechuate (PCA) 4,5-dioxygenase (LigAB). LigAB belongs to the class III extradiol dioxygenase family, composed of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Dioxygenases play key roles in the degradation of aromatic compounds. PCA 4,5-dioxygenase catalyzes the oxidization and subsequent ring-opening of PCA (or 3,4-dihydroxybenzoic acid), which is an intermediate in the breakdown of lignin and other compounds.
Probab=40.05  E-value=37  Score=20.61  Aligned_cols=18  Identities=28%  Similarity=0.268  Sum_probs=14.9

Q ss_pred             HHHHhcCCCCHHHHHHHH
Q psy17601          5 EESLKDESLSETQRQEKR   22 (64)
Q Consensus         5 e~~l~~~~l~~~~~~~~~   22 (64)
                      +..|++.+||++|++.+.
T Consensus        37 ~Ay~~~~~Lteeqr~av~   54 (106)
T cd07925          37 EAYCEKFGLTPEQKQAVR   54 (106)
T ss_pred             HHHHHHcCCCHHHHHHHH
Confidence            567889999999987764


No 308
>KOG0983|consensus
Probab=37.82  E-value=14  Score=26.73  Aligned_cols=27  Identities=30%  Similarity=0.432  Sum_probs=22.7

Q ss_pred             ccCCCCCCCCccccccCCccceEeeec
Q psy17601         37 RSRLGVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      +.+..+++.+++..||.|+-|.|+.++
T Consensus        86 r~~~dindl~~l~dlGsGtcG~V~k~~  112 (391)
T KOG0983|consen   86 RYQADINDLENLGDLGSGTCGQVWKMR  112 (391)
T ss_pred             ccccChHHhhhHHhhcCCCccceEEEE
Confidence            345677899999999999999998764


No 309
>PF04201 TPD52:  Tumour protein D52 family;  InterPro: IPR007327 The hD52 gene was originally identified through its elevated expression level in human breast carcinoma. Cloning of D52 homologues from other species has indicated that D52 may play roles in calcium-mediated signal transduction and cell proliferation. Two human homologues of hD52, hD53 and hD54, have also been identified, demonstrating the existence of a novel gene/protein family []. These proteins have an N-terminal coiled-coil that allows members to form homo- and heterodimers with each other [].
Probab=37.29  E-value=55  Score=21.25  Aligned_cols=22  Identities=45%  Similarity=0.607  Sum_probs=18.7

Q ss_pred             cCCCCHHHHHHHHHHHHHHHHH
Q psy17601         10 DESLSETQRQEKRQQHAQKETE   31 (64)
Q Consensus        10 ~~~l~~~~~~~~~~~~~~~e~~   31 (64)
                      ..+|++++++.++..+.+-|.+
T Consensus        23 ~~~LsEeE~eeLr~EL~KvEeE   44 (162)
T PF04201_consen   23 EEGLSEEEREELRSELAKVEEE   44 (162)
T ss_pred             cccCCHHHHHHHHHHHHHHHHH
Confidence            3789999999999999987655


No 310
>PF14385 DUF4416:  Domain of unknown function (DUF4416)
Probab=37.02  E-value=1e+02  Score=19.88  Aligned_cols=51  Identities=16%  Similarity=0.330  Sum_probs=31.1

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHhhhccCCCCC---------------CCCccccccCCccceEeeec
Q psy17601         13 LSETQRQEKRQQHAQKETEFLRLKRSRLGVE---------------DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        13 l~~~~~~~~~~~~~~~e~~~~r~~~~~~~~~---------------dF~~~~~iG~G~fG~V~La~   63 (64)
                      +++++--.+......-|..|....+.++|++               +|-.---||+|-|++|-|.+
T Consensus        68 i~~~~L~~iK~~tn~iE~~~~~~g~R~VNiDPGYl~~~~lVLAt~K~~~HRIYL~~GIyaE~tL~y  133 (164)
T PF14385_consen   68 IHPEELADIKLETNEIEKEFAKDGKRRVNIDPGYLTLERLVLATTKNFSHRIYLGDGIYAELTLIY  133 (164)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHhcCCceEEeCceecccCeEEEEecCCCCcceeccCCEEEEEEEEE
Confidence            3455555555555556777776434444433               44444469999999987653


No 311
>PF08006 DUF1700:  Protein of unknown function (DUF1700);  InterPro: IPR012963 This family contains many hypothetical bacterial proteins and two putative membrane proteins (Q6GFD0 from SWISSPROT and Q6G806 from SWISSPROT).
Probab=34.78  E-value=77  Score=19.90  Aligned_cols=24  Identities=33%  Similarity=0.416  Sum_probs=17.4

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHHH
Q psy17601          2 AKLEESLKDESLSETQRQEKRQQHAQ   27 (64)
Q Consensus         2 ~~Le~~l~~~~l~~~~~~~~~~~~~~   27 (64)
                      ++|++.|.  .+|+++++...+.+..
T Consensus         8 ~~L~~~L~--~lp~~e~~e~l~~Y~e   31 (181)
T PF08006_consen    8 NELEKYLK--KLPEEEREEILEYYEE   31 (181)
T ss_pred             HHHHHHHH--cCCHHHHHHHHHHHHH
Confidence            46888887  4888888877666554


No 312
>PF13019 Telomere_Sde2:  Telomere stability and silencing
Probab=34.62  E-value=14  Score=24.02  Aligned_cols=10  Identities=40%  Similarity=0.710  Sum_probs=8.2

Q ss_pred             cccCCccceE
Q psy17601         50 VIGRGAFGEC   59 (64)
Q Consensus        50 ~iG~G~fG~V   59 (64)
                      +-|+|+||.-
T Consensus        86 ~GGKGGFGs~   95 (162)
T PF13019_consen   86 RGGKGGFGSQ   95 (162)
T ss_pred             cCCCccHHHH
Confidence            5799999963


No 313
>PRK13378 protocatechuate 4,5-dioxygenase subunit alpha; Provisional
Probab=34.56  E-value=49  Score=20.42  Aligned_cols=18  Identities=22%  Similarity=0.290  Sum_probs=14.8

Q ss_pred             HHHHhcCCCCHHHHHHHH
Q psy17601          5 EESLKDESLSETQRQEKR   22 (64)
Q Consensus         5 e~~l~~~~l~~~~~~~~~   22 (64)
                      +..+++-+||++|++.+.
T Consensus        48 ~Ay~~~~~Lteeqk~aV~   65 (117)
T PRK13378         48 AAYCRKYGLNEEQKEAIR   65 (117)
T ss_pred             HHHHHHcCCCHHHHHHHH
Confidence            567889999999987764


No 314
>PF03109 ABC1:  ABC1 family;  InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli []. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex [] and E. coli AarF is required for ubiquinone production []. It has been suggested that members of the ABC1 family are novel chaperonins []. These proteins are unrelated to the ABC transporter proteins.
Probab=34.40  E-value=14  Score=22.02  Aligned_cols=19  Identities=5%  Similarity=0.286  Sum_probs=15.1

Q ss_pred             CCCccccccCCccceEeeec
Q psy17601         44 DFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        44 dF~~~~~iG~G~fG~V~La~   63 (64)
                      +|+ -..||.||.|+|+.|.
T Consensus        13 ~fd-~~PlasASiaQVh~a~   31 (119)
T PF03109_consen   13 EFD-PEPLASASIAQVHRAR   31 (119)
T ss_pred             HCC-cchhhheehhhheeee
Confidence            444 3579999999999885


No 315
>PRK13379 protocatechuate 4,5-dioxygenase subunit alpha; Provisional
Probab=33.93  E-value=51  Score=20.43  Aligned_cols=19  Identities=21%  Similarity=0.400  Sum_probs=15.3

Q ss_pred             HHHHHhcCCCCHHHHHHHH
Q psy17601          4 LEESLKDESLSETQRQEKR   22 (64)
Q Consensus         4 Le~~l~~~~l~~~~~~~~~   22 (64)
                      -+..|++.+||++|++.+.
T Consensus        48 e~ay~~~~~Lt~eqk~aV~   66 (119)
T PRK13379         48 AEALMQEAGLTEQEKELIR   66 (119)
T ss_pred             HHHHHHHcCCCHHHHHHHH
Confidence            4677899999999987654


No 316
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms]
Probab=33.40  E-value=22  Score=23.88  Aligned_cols=16  Identities=13%  Similarity=-0.018  Sum_probs=13.7

Q ss_pred             cccccCCccceEeeec
Q psy17601         48 LKVIGRGAFGECPKKI   63 (64)
Q Consensus        48 ~~~iG~G~fG~V~La~   63 (64)
                      .+.||+|++|.||++.
T Consensus        27 ~~~L~KG~~s~Vyl~~   42 (201)
T COG2112          27 EKELAKGTTSVVYLGE   42 (201)
T ss_pred             hhhhhcccccEEEEee
Confidence            5579999999999964


No 317
>TIGR02792 PCA_ligA protocatechuate 4,5-dioxygenase, alpha subunit. Protocatechuate (PCA) 4,5-dioxygenase is the first enzyme in the PCA 4,5-cleavage pathway that is an alternative to PCA 3,4-cleavage and PCA 2,3 cleavage pathways. PCA is an intermediate in the breakdown of lignin (hence the gene symbol ligA) and other compounds. Members of this family are the alpha chain of PCA 4,5-dioxygenase, or the equivalent domain of a fusion protein.
Probab=32.87  E-value=54  Score=20.24  Aligned_cols=18  Identities=22%  Similarity=0.222  Sum_probs=14.8

Q ss_pred             HHHHhcCCCCHHHHHHHH
Q psy17601          5 EESLKDESLSETQRQEKR   22 (64)
Q Consensus         5 e~~l~~~~l~~~~~~~~~   22 (64)
                      +..+++-+||++|++.+.
T Consensus        42 ~Ay~d~~~Lt~eqk~av~   59 (117)
T TIGR02792        42 SAYLDEWNLTPAQKQAVL   59 (117)
T ss_pred             HHHHHHcCCCHHHHHHHH
Confidence            567889999999987754


No 318
>cd07924 PCA_45_Doxase_A The A subunit of Protocatechuate 4,5-dioxygenase (LigAB) is the smaller, non-catalytic subunit. The A subunit is the non-catalytic subunit of Protocatechuate (PCA) 4,5-dioxygenase (LigAB), which is composed of A and B subunits that form a tetramer. PCA 4,5-dioxygenase catalyzes the oxidization and subsequent ring-opening of PCA (or 3,4-dihydroxybenzoic acid), which is an intermediate in the breakdown of lignin and other compounds. PCA 4,5-dioxygenase is one of the aromatic ring opening dioxygenases which  play key roles in the degradation of aromatic compounds. As a member of the Class III extradiol dioxygenase family, LigAB uses a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon.
Probab=31.81  E-value=59  Score=20.20  Aligned_cols=18  Identities=22%  Similarity=0.217  Sum_probs=14.8

Q ss_pred             HHHHhcCCCCHHHHHHHH
Q psy17601          5 EESLKDESLSETQRQEKR   22 (64)
Q Consensus         5 e~~l~~~~l~~~~~~~~~   22 (64)
                      +..|++-+||++|++.+.
T Consensus        45 ~Ay~~~~~Lteeqr~aV~   62 (121)
T cd07924          45 RAYLDKWPMTEEQKQAVL   62 (121)
T ss_pred             HHHHHHcCCCHHHHHHHH
Confidence            567889999999987754


No 319
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional
Probab=30.66  E-value=2e+02  Score=20.37  Aligned_cols=15  Identities=33%  Similarity=1.015  Sum_probs=12.2

Q ss_pred             CCCcccccc-CCccce
Q psy17601         44 DFEPLKVIG-RGAFGE   58 (64)
Q Consensus        44 dF~~~~~iG-~G~fG~   58 (64)
                      ++..+-+|| -|.+|.
T Consensus        97 ~~~~I~IiGG~GlmG~  112 (374)
T PRK11199         97 DLRPVVIVGGKGQLGR  112 (374)
T ss_pred             ccceEEEEcCCChhhH
Confidence            667788998 898885


No 320
>PRK13377 protocatechuate 4,5-dioxygenase subunit alpha; Provisional
Probab=29.44  E-value=67  Score=20.18  Aligned_cols=18  Identities=22%  Similarity=0.257  Sum_probs=14.8

Q ss_pred             HHHHhcCCCCHHHHHHHH
Q psy17601          5 EESLKDESLSETQRQEKR   22 (64)
Q Consensus         5 e~~l~~~~l~~~~~~~~~   22 (64)
                      +..+++-+||++|++.+.
T Consensus        48 ~Ay~de~~Lteeqr~aV~   65 (129)
T PRK13377         48 RAYLDEWPMTEEQKQAVL   65 (129)
T ss_pred             HHHHHHcCCCHHHHHHHH
Confidence            567889999999987754


No 321
>PF08312 cwf21:  cwf21 domain;  InterPro: IPR013170 The cwf21 domain is found in proteins involved in mRNA splicing. Proteins containing this domain have been isolated as a subcomplex of the splicosome in Schizosaccharomyces pombe (Fission yeast) []. In yeast, this domain binds the protein Prp8p [], a large and highly conserved U5 snRNP protein which has been proposed as a protein cofactor at the spliceosomal catalytic centre []. The cwf21 domain is found in, amongst others, the small Cwc21p protein in yeast as well as in the much larger human ortholog SRm300 (serine/arginine repetitive matrix protein). ; PDB: 2E62_A.
Probab=29.36  E-value=89  Score=15.97  Aligned_cols=25  Identities=24%  Similarity=0.423  Sum_probs=15.8

Q ss_pred             HHHHHHhcCCCCHHHHHHHHHHHHH
Q psy17601          3 KLEESLKDESLSETQRQEKRQQHAQ   27 (64)
Q Consensus         3 ~Le~~l~~~~l~~~~~~~~~~~~~~   27 (64)
                      .|...|.+.|+++++...-.+.+..
T Consensus        15 elrd~LEe~g~~~eeIe~kv~~~R~   39 (46)
T PF08312_consen   15 ELRDELEEQGYSEEEIEEKVDELRK   39 (46)
T ss_dssp             HHHHHHHHHT--HHHHHHHHHHHHH
T ss_pred             HHHHHHHhCCCCHHHHHHHHHHHHH
Confidence            4677888889988877665555443


No 322
>KOG0590|consensus
Probab=28.56  E-value=20  Score=27.16  Aligned_cols=22  Identities=18%  Similarity=0.413  Sum_probs=18.9

Q ss_pred             CCCCCccccccCCccceEeeec
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      ...|..++.||+|+|+.|.++.
T Consensus        19 ~~~~~~~~~ig~gs~~~~~~~~   40 (601)
T KOG0590|consen   19 NSQYKLSRSIGKGSFSSSALAS   40 (601)
T ss_pred             cccccccccccccccchhhhhh
Confidence            5678999999999999998764


No 323
>PF08278 DnaG_DnaB_bind:  DNA primase DnaG DnaB-binding ;  InterPro: IPR013173 Eubacterial DnaG primases interact with several factors to form the replisome. One of these factors is DnaB, a helicase. This domain has been demonstrated to be responsible for the interaction between DnaG and DnaB []. This domain has a multi-helical structure that forms an orthogonal bundle [].; GO: 0003896 DNA primase activity, 0006269 DNA replication, synthesis of RNA primer; PDB: 2HAJ_A 1T3W_B.
Probab=28.51  E-value=82  Score=18.36  Aligned_cols=21  Identities=24%  Similarity=0.463  Sum_probs=12.4

Q ss_pred             HHHHHHhcCCCCHHHHHHHHH
Q psy17601          3 KLEESLKDESLSETQRQEKRQ   23 (64)
Q Consensus         3 ~Le~~l~~~~l~~~~~~~~~~   23 (64)
                      .|.++....+|+++||+.++.
T Consensus       105 ~L~~k~~~~~Lt~eEk~el~~  125 (127)
T PF08278_consen  105 ELKAKPRRGGLTDEEKQELRR  125 (127)
T ss_dssp             HHHHHHTTT---HHHHHHHHH
T ss_pred             HHHHhhccCCcCHHHHHHHHH
Confidence            455666667899999887654


No 324
>PF13348 Y_phosphatase3C:  Tyrosine phosphatase family C-terminal region; PDB: 1YWF_A 2OZ5_B.
Probab=28.50  E-value=98  Score=16.17  Aligned_cols=22  Identities=27%  Similarity=0.367  Sum_probs=13.7

Q ss_pred             HHHHH-hcCCCCHHHHHHHHHHH
Q psy17601          4 LEESL-KDESLSETQRQEKRQQH   25 (64)
Q Consensus         4 Le~~l-~~~~l~~~~~~~~~~~~   25 (64)
                      .+..| +..||++++.+.+++.+
T Consensus        45 ~e~Yl~~~lgl~~~~i~~Lr~~l   67 (68)
T PF13348_consen   45 VENYLREELGLSEEDIERLRERL   67 (68)
T ss_dssp             HHHHHHHT-T--HHHHHHHHHHH
T ss_pred             HHHHHHHcCCCCHHHHHHHHHHc
Confidence            46677 55699999888877654


No 325
>PF15188 CCDC-167:  Coiled-coil domain-containing protein 167
Probab=27.96  E-value=1.2e+02  Score=17.53  Aligned_cols=23  Identities=22%  Similarity=0.368  Sum_probs=17.3

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHH
Q psy17601          2 AKLEESLKDESLSETQRQEKRQQ   24 (64)
Q Consensus         2 ~~Le~~l~~~~l~~~~~~~~~~~   24 (64)
                      +.++..|....|||+.|....+.
T Consensus        22 e~ve~rL~~~eLs~e~R~~lE~E   44 (85)
T PF15188_consen   22 EAVESRLRRRELSPEARRSLEKE   44 (85)
T ss_pred             HHHHHHHcccCCChHHHHHHHHH
Confidence            35678899999999987665433


No 326
>PF06154 YagB_YeeU_YfjZ:  YagB/YeeU/YfjZ family;  InterPro: IPR009320 This family of proteins includes three proteins from Escherichia coli proteins YagB, YeeU and YfjZ. The function of these proteins is unknown. They are about 120 amino acids in length.; PDB: 2H28_A 2INW_B 2JN7_A 2EA9_A.
Probab=26.76  E-value=40  Score=20.38  Aligned_cols=11  Identities=27%  Similarity=0.214  Sum_probs=8.3

Q ss_pred             CCccceEeeec
Q psy17601         53 RGAFGECPKKI   63 (64)
Q Consensus        53 ~G~fG~V~La~   63 (64)
                      -|++|=||+|+
T Consensus        89 lGS~GYVYiaI   99 (103)
T PF06154_consen   89 LGSCGYVYIAI   99 (103)
T ss_dssp             TT-SSEEEEEE
T ss_pred             CCCccEEEEEE
Confidence            37889999986


No 327
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=25.94  E-value=30  Score=21.72  Aligned_cols=17  Identities=12%  Similarity=0.442  Sum_probs=14.4

Q ss_pred             CCCCCCccccccCCccc
Q psy17601         41 GVEDFEPLKVIGRGAFG   57 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG   57 (64)
                      --++|+.|++++.|.|-
T Consensus        82 ~~~~iESIrI~~pG~YE   98 (131)
T PF09845_consen   82 LNDRIESIRILEPGSYE   98 (131)
T ss_pred             cccCcceEEEecCceEE
Confidence            34789999999999984


No 328
>PF10777 YlaC:  Inner membrane protein YlaC;  InterPro: IPR019713  The extracytoplasmic function (ECF) sigma factors are small regulatory proteins that are quite divergent in sequence relative to most other sigma factors. YlaC, regulated by YlaA, is important in oxidative stress resistance. It contributes to hydrogen peroxide resistance in Bacillus subtilis []. 
Probab=25.75  E-value=1.2e+02  Score=19.62  Aligned_cols=27  Identities=11%  Similarity=0.231  Sum_probs=22.1

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHHHH
Q psy17601          2 AKLEESLKDESLSETQRQEKRQQHAQK   28 (64)
Q Consensus         2 ~~Le~~l~~~~l~~~~~~~~~~~~~~~   28 (64)
                      +.+++.|+++..+++.|+++...+..+
T Consensus       113 ~ai~~iL~~p~V~~~~K~~i~~i~~~K  139 (155)
T PF10777_consen  113 QAIDKILQSPQVPDEIKQGIQRIISTK  139 (155)
T ss_pred             HHHHHHHcCCCCCHHHHHHHHHHHHhC
Confidence            467889999999999998887776654


No 329
>TIGR02433 lysidine_TilS_C tRNA(Ile)-lysidine synthetase, C-terminal domain. TIGRFAMs model TIGR02432 describes the family of the N-terminal domain of tRNA(Ile)-lysidine synthetase. This family (TIGR02433) describes a small C-terminal domain of about 50 residues present in about half the members of family TIGR02432,and in no other protein. Characterized examples of tRNA(Ile)-lysidine synthetase from E. coli and Bacillus subtilis both contain this domain.
Probab=25.01  E-value=45  Score=16.20  Aligned_cols=19  Identities=21%  Similarity=0.254  Sum_probs=14.5

Q ss_pred             hHHHHHHhcCCCCHHHHHH
Q psy17601          2 AKLEESLKDESLSETQRQE   20 (64)
Q Consensus         2 ~~Le~~l~~~~l~~~~~~~   20 (64)
                      +.|.+.+.+.++|+.+++.
T Consensus        21 k~lkk~~~e~kiP~~~R~~   39 (47)
T TIGR02433        21 KKLKKLFIDAKVPPWLRDR   39 (47)
T ss_pred             chHHHHHHHcCCCHHHHcC
Confidence            4577788889999887654


No 330
>KOG0588|consensus
Probab=24.46  E-value=32  Score=27.35  Aligned_cols=23  Identities=17%  Similarity=0.255  Sum_probs=19.3

Q ss_pred             CCCCCCccccccCCccceEeeec
Q psy17601         41 GVEDFEPLKVIGRGAFGECPKKI   63 (64)
Q Consensus        41 ~~~dF~~~~~iG~G~fG~V~La~   63 (64)
                      .+.-++.-+.||+|+=|.|.||.
T Consensus        10 tiGpwkLgkTLG~Gstg~vrlak   32 (786)
T KOG0588|consen   10 TIGPWKLGKTLGKGSTGCVRLAK   32 (786)
T ss_pred             cccceeccccccCCCCceehhhh
Confidence            34557788999999999999985


No 331
>TIGR03142 cytochro_ccmI cytochrome c-type biogenesis protein CcmI. This TPR repeat-containing protein is the CcmI protein (also called CycH) of c-type cytochrome biogenesis. CcmI is thought to act as an apo-cytochrome c chaperone. This model describes the N-terminal region of the protein, Members of this protein family
Probab=24.38  E-value=1.6e+02  Score=17.34  Aligned_cols=27  Identities=26%  Similarity=0.432  Sum_probs=21.1

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHHHHHHH
Q psy17601          2 AKLEESLKDESLSETQRQEKRQQHAQK   28 (64)
Q Consensus         2 ~~Le~~l~~~~l~~~~~~~~~~~~~~~   28 (64)
                      .+||+.+++--+++++.++...++.+.
T Consensus        46 ~ELe~d~~~G~l~~~e~~~~~~El~rr   72 (117)
T TIGR03142        46 AELERDLAEGLLDEAEAEAARAELQRR   72 (117)
T ss_pred             HHHHHHHHcCCCCHHHHHHHHHHHHHH
Confidence            468888888888998887777777664


No 332
>PF06570 DUF1129:  Protein of unknown function (DUF1129);  InterPro: IPR009214 There are currently no experimental data for members of this group or their homologues. However, these proteins contain predicted integral membrane proteins (with several transmembrane segments).
Probab=24.19  E-value=1.6e+02  Score=18.99  Aligned_cols=25  Identities=20%  Similarity=0.263  Sum_probs=19.7

Q ss_pred             HHHHHHhcCCCCHHHHHHHHHHHHH
Q psy17601          3 KLEESLKDESLSETQRQEKRQQHAQ   27 (64)
Q Consensus         3 ~Le~~l~~~~l~~~~~~~~~~~~~~   27 (64)
                      +|.+.|.+.+++|++.+....+...
T Consensus        12 ~l~~~L~~~~~~e~~~e~~L~eil~   36 (206)
T PF06570_consen   12 DLRKYLRSSGVSEEEIEELLEEILP   36 (206)
T ss_pred             HHHHHHHHcCCCHHHHHHHHHHHHH
Confidence            5788889999999998887666543


No 333
>PF07798 DUF1640:  Protein of unknown function (DUF1640);  InterPro: IPR024461 This family consists of uncharacterised proteins.
Probab=23.50  E-value=1.6e+02  Score=18.66  Aligned_cols=25  Identities=16%  Similarity=0.230  Sum_probs=19.1

Q ss_pred             HHHHHHhcCCCCHHHHHHHHHHHHH
Q psy17601          3 KLEESLKDESLSETQRQEKRQQHAQ   27 (64)
Q Consensus         3 ~Le~~l~~~~l~~~~~~~~~~~~~~   27 (64)
                      .+-+.|.+.|+|+++.+.+...+..
T Consensus         6 ~~v~~Le~~Gft~~QAe~i~~~l~~   30 (177)
T PF07798_consen    6 KFVKRLEAAGFTEEQAEAIMKALRE   30 (177)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHH
Confidence            3567889999999998887665444


No 334
>KOG0578|consensus
Probab=22.77  E-value=40  Score=25.82  Aligned_cols=23  Identities=26%  Similarity=0.351  Sum_probs=19.7

Q ss_pred             CCCCCccccccCCccceEeeecC
Q psy17601         42 VEDFEPLKVIGRGAFGECPKKID   64 (64)
Q Consensus        42 ~~dF~~~~~iG~G~fG~V~La~~   64 (64)
                      .+.|....-||+|+=|-||+|++
T Consensus       272 ~~~y~~~~kigqgaSG~vy~A~~  294 (550)
T KOG0578|consen  272 RSKYTDFKKIGQGATGGVYVARK  294 (550)
T ss_pred             hhhhcchhhhccccccceeeeee
Confidence            45788888999999999999963


No 335
>PRK07668 hypothetical protein; Validated
Probab=22.76  E-value=1.7e+02  Score=20.18  Aligned_cols=25  Identities=8%  Similarity=0.009  Sum_probs=19.9

Q ss_pred             HHHHHHhcCCCCHHHHHHHHHHHHH
Q psy17601          3 KLEESLKDESLSETQRQEKRQQHAQ   27 (64)
Q Consensus         3 ~Le~~l~~~~l~~~~~~~~~~~~~~   27 (64)
                      +|+..|...++||++++....++..
T Consensus        12 ~L~~yL~~~glseeeieeiL~Ei~~   36 (254)
T PRK07668         12 DTRVYLIAKGIKEEDIESFLEDAEL   36 (254)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHH
Confidence            6788888899999998887666543


No 336
>PF13095 FTA2:  Kinetochore Sim4 complex subunit FTA2
Probab=22.75  E-value=56  Score=21.83  Aligned_cols=21  Identities=33%  Similarity=0.477  Sum_probs=19.1

Q ss_pred             CCCCccccccCCcc-ceEeeec
Q psy17601         43 EDFEPLKVIGRGAF-GECPKKI   63 (64)
Q Consensus        43 ~dF~~~~~iG~G~f-G~V~La~   63 (64)
                      ++|+.+..||.|+= |.|+.+.
T Consensus        37 ~~I~flefLg~g~~~~~V~kv~   58 (207)
T PF13095_consen   37 DDIEFLEFLGHGSHDGYVFKVE   58 (207)
T ss_pred             CcEeeeeecCCCCceeEEEEEE
Confidence            78999999999999 9999874


No 337
>PF06371 Drf_GBD:  Diaphanous GTPase-binding Domain;  InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division []. Drf proteins are characterised by a variety of shared domains: an N-terminal GTPase-binding domain (GBD), formin-homology domains FH1, FH2 (IPR003104 from INTERPRO) and FH3 (IPR010472 from INTERPRO), and a C-terminal conserved Dia-autoregulatory domain (DAD) that binds the GBD. This entry represents the GBD, which is a bifunctional autoinhibitory domain that interacts with and is regulated by activated Rho family members. Mammalian Drf3 contains a CRIB-like motif within its GBD for binding to Cdc42, which is required for Cdc42 to activate and guide Drf3 towards the cell cortex where it remodels the actin skeleton [].; GO: 0003779 actin binding, 0017048 Rho GTPase binding, 0030036 actin cytoskeleton organization; PDB: 3OBV_A 2BNX_A 3EG5_D 2BAP_B 3O4X_B 1Z2C_B 2F31_A.
Probab=22.02  E-value=1.5e+02  Score=18.08  Aligned_cols=22  Identities=36%  Similarity=0.519  Sum_probs=14.5

Q ss_pred             hHHHHHHhcCCCCHHHHHHHHH
Q psy17601          2 AKLEESLKDESLSETQRQEKRQ   23 (64)
Q Consensus         2 ~~Le~~l~~~~l~~~~~~~~~~   23 (64)
                      ...++.|.++++|++.++.+.+
T Consensus        10 ~~F~~ll~~~~~~~~~r~~l~~   31 (187)
T PF06371_consen   10 EMFEELLEELNLPEEKRKELRN   31 (187)
T ss_dssp             HHHHHHHHHTT--HHHHHHHHT
T ss_pred             HHHHHHHHhcCCCHHHHHHHHC
Confidence            3567888999999887666543


No 338
>PF02750 Synapsin_C:  Synapsin, ATP binding domain;  InterPro: IPR020898 The synapsins are a family of neuron-specific phosphoproteins that coat synaptic vesicles and are involved in the binding between these vesicles and the cytoskeleton (including actin filaments). The family comprises 5 homologous proteins Ia, Ib, IIa, IIb and III. Synapsins I, II, and III are encoded by 3 different genes. The a and b isoforms of synapsin I and II are splice variants of the primary transcripts []. Synapsin I is mainly associated with regulation of neurotransmitter release from presynaptic neuron terminals []. Synapsin II, as well as being involved in neurotransmitter release, has a role in the synaptogenesis and synaptic plasticity responsible for long term potentiation []. Recent studies implicate synapsin III with a developmental role in neurite elongation and synapse formation that is distinct from the functions of synapsins I and II []. Structurally, synapsins are multidomain proteins, of which 3 domains are common to all the mammalian forms. The N-terminal `A' domain is ~30 residues long and contains a serine residue that serves as an acceptor site for protein kinase-mediated phosphorylation. This is followed by the `B' linker domain, which is ~80 residues long and is relatively poorly conserved. Domain `C' is the longest, spanning approximately 300 residues. This domain is highly conserved across all the synapsins (including those from Drosophila) and is possessed by all splice variants. The remaining six domains, D-I, are not shared by all the synapsins and differ both between the primary transcripts and the splice variants. This entry represent the ATP-grasp fold found in synapsins, which is responsible for Ca dependent ATP binding. ; PDB: 1PX2_A 1PK8_F 1AUV_B 1AUX_A 2P0A_A 1I7N_A 1I7L_A.
Probab=20.78  E-value=49  Score=22.26  Aligned_cols=25  Identities=20%  Similarity=0.380  Sum_probs=18.5

Q ss_pred             ccCCCCCCCCcccccc--CCccceEee
Q psy17601         37 RSRLGVEDFEPLKVIG--RGAFGECPK   61 (64)
Q Consensus        37 ~~~~~~~dF~~~~~iG--~G~fG~V~L   61 (64)
                      +......+|.++--+|  .|++|+|.+
T Consensus        43 ~em~s~~~fPvVvKvG~~h~G~GKvkv   69 (203)
T PF02750_consen   43 REMLSAPRFPVVVKVGHAHAGMGKVKV   69 (203)
T ss_dssp             GGGCS-SSSSEEEEESS-STTTTEEEE
T ss_pred             hhhccCCCCCEEEEEccccCceeEEEE
Confidence            3345556899888899  899999954


No 339
>PF08671 SinI:  Anti-repressor SinI;  InterPro: IPR010981 The SinR repressor is part of a group of Sin (sporulation inhibition) proteins in Bacillus subtilis that regulate the commitment to sporulation in response to extreme adversity []. SinR is a tetrameric repressor protein that binds to the promoters of genes essential for entry into sporulation and prevents their transcription. This repression is overcome through the activity of SinI, which disrupts the SinR tetramer through the formation of a SinI-SinR heterodimer, thereby allowing sporulation to proceed. The SinR structure consists of two domains: a dimerisation domain stabilised by a hydrophobic core, and a DNA-binding domain that is identical to domains of the bacteriophage 434 CI and Cro proteins that regulate prophage induction. The dimerisation domain is a four-helical bundle formed from two helices from the C-terminal residues of SinR and two helices from the central residues of SinI. These regions in SinR and SinI are similar in both structure and sequence. The interaction of SinR monomers to form tetramers is weaker than between SinR and SinI, since SinI can effectively disrupt SinR tetramers. This entry represents the dimerisation domain in both SinI and SinR proteins.; GO: 0005488 binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1B0N_A 2YAL_A.
Probab=20.57  E-value=1.2e+02  Score=14.25  Aligned_cols=20  Identities=25%  Similarity=0.307  Sum_probs=12.4

Q ss_pred             ChHHHHHHhcCCCCHHHHHH
Q psy17601          1 QAKLEESLKDESLSETQRQE   20 (64)
Q Consensus         1 ~~~Le~~l~~~~l~~~~~~~   20 (64)
                      |..|=+.-.++|+|.++-+.
T Consensus         5 W~~Li~eA~~~Gls~eeir~   24 (30)
T PF08671_consen    5 WVELIKEAKESGLSKEEIRE   24 (30)
T ss_dssp             HHHHHHHHHHTT--HHHHHH
T ss_pred             HHHHHHHHHHcCCCHHHHHH
Confidence            55666777789999886443


Done!