Query         psy17635
Match_columns 103
No_of_seqs    99 out of 124
Neff          4.5 
Searched_HMMs 29240
Date          Fri Aug 16 19:05:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17635.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/17635hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1q55_A EP-cadherin, C-cadherin  93.0   0.018 6.2E-07   50.3   0.0   36    6-41    702-737 (880)
  2 2knc_A Integrin alpha-IIB; tra  92.6   0.082 2.8E-06   32.5   2.6   30    7-36      9-43  (54)
  3 2k9y_A Ephrin type-A receptor   91.5    0.15   5E-06   28.6   2.7   27    8-34     11-38  (41)
  4 2l8s_A Integrin alpha-1; trans  90.3    0.24 8.2E-06   30.5   3.0   29    8-36      7-40  (54)
  5 2k1a_A Integrin alpha-IIB; sin  87.1    0.63 2.1E-05   27.1   3.2   29    8-36      8-41  (42)
  6 1cd1_A CD1, MCD1D.1; immunolog  83.0    0.24 8.1E-06   37.9   0.0   19   21-39    294-312 (315)
  7 2ks1_B Epidermal growth factor  82.6    0.82 2.8E-05   26.8   2.3   23   13-35     15-38  (44)
  8 2knc_B Integrin beta-3; transm  80.1     1.8 6.3E-05   27.8   3.5   21    9-29     11-31  (79)
  9 3lb6_C IL-13, interleukin-13 r  79.8    0.36 1.2E-05   37.2   0.0   25    9-33    339-363 (380)
 10 2jwa_A Receptor tyrosine-prote  79.3    0.95 3.3E-05   26.7   1.7   30    7-36      9-39  (44)
 11 2l2t_A Receptor tyrosine-prote  78.9     1.3 4.5E-05   26.0   2.3   24   12-35     13-37  (44)
 12 2w1k_A Putative sortase; pilus  78.8     0.4 1.4E-05   36.6   0.0   27   11-37    225-251 (252)
 13 2k1k_A Ephrin type-A receptor   76.5     1.8 6.3E-05   24.4   2.4    9   27-35     29-37  (38)
 14 2klu_A T-cell surface glycopro  74.4     2.6 8.9E-05   27.1   2.9   19   15-33     13-33  (70)
 15 2jo1_A Phospholemman; FXYD1, N  73.5       2 6.7E-05   27.8   2.2   17   13-29     19-35  (72)
 16 1iij_A ERBB-2 receptor protein  72.9    0.94 3.2E-05   25.6   0.5   10   27-36     26-35  (35)
 17 2k9j_B Integrin beta-3; transm  69.5       7 0.00024   22.4   3.8   23    7-29      8-30  (43)
 18 2l34_A TYRO protein tyrosine k  66.1     5.8  0.0002   21.7   2.8   14   21-34     19-32  (33)
 19 2l6w_A Beta-type platelet-deri  66.5     1.6 5.4E-05   25.2   0.0   18   16-33     14-31  (39)
 20 1zza_A Stannin, AG8_1; helix,   61.5     9.5 0.00032   25.1   3.6   25   12-36     17-42  (90)
 21 1s7q_A H-2KB, H-2 class I hist  58.8       2 6.9E-05   33.5   0.0    9   13-21    284-292 (348)
 22 3arc_J Photosystem II reaction  52.0      18 0.00061   20.8   3.3   19    9-27      9-27  (40)
 23 2zxe_G FXYD10, phospholemman-l  50.3      12 0.00042   24.2   2.7   18   12-29     21-38  (74)
 24 2lk9_A Bone marrow stromal ant  50.1      21  0.0007   20.0   3.3   14   22-35     19-32  (35)
 25 2jp3_A FXYD domain-containing   48.3      10 0.00036   24.1   2.1   18   12-29     19-36  (67)
 26 4hkr_A Calcium release-activat  46.0      13 0.00045   28.3   2.7   26    9-34    114-139 (214)
 27 1fjk_A Cardiac phospholamban;   44.8      17 0.00058   21.8   2.5   22    8-29     28-49  (52)
 28 2llm_A Amyloid beta A4 protein  47.9     5.4 0.00019   23.4   0.0   27    8-34     15-42  (43)
 29 3hb3_B Cytochrome C oxidase su  40.5      22 0.00077   27.7   3.4   14   19-32     74-87  (298)
 30 2kse_A Sensor protein QSEC; me  38.3      28 0.00095   22.3   3.1   24   11-34    162-185 (186)
 31 2akh_X Protein-export membrane  36.9      41  0.0014   21.1   3.6   13   26-38     16-28  (77)
 32 1cz6_A Protein (androctonin);   35.7      12  0.0004   19.5   0.7   10   32-41      9-18  (26)
 33 2gsm_B Cytochrome C oxidase su  34.9      35  0.0012   25.9   3.6   14   19-32     43-56  (262)
 34 1jb0_X Photosystem I subunit P  33.7      32  0.0011   19.2   2.4   15    8-23     12-26  (35)
 35 3j0f_E E1 envelope glycoprotei  33.0      36  0.0012   28.2   3.6    9    9-17    407-415 (439)
 36 1vry_A Glycine receptor alpha-  30.1      45  0.0016   21.1   3.0   29    9-37     36-64  (76)
 37 3j1r_A Archaeal adhesion filam  29.4      39  0.0013   17.7   2.1   10   17-26      5-14  (26)
 38 1z65_A PRPLP, prion-like prote  29.3      33  0.0011   18.6   1.8   12   10-21      7-18  (30)
 39 1jdm_A Sarcolipin; helix, memb  28.1      26  0.0009   19.0   1.3   10   26-35     19-28  (31)
 40 3j0c_A E1 envelope glycoprotei  28.0      21 0.00071   29.7   1.3    7   10-16    408-414 (442)
 41 1pi7_A VPU protein, U ORF prot  27.3      77  0.0026   17.5   3.3   12   17-28      9-20  (36)
 42 2jln_A MHP1; hydantoin, transp  24.5      49  0.0017   26.6   2.9   14   33-46    448-461 (501)
 43 2h8a_A Microsomal glutathione   22.7      65  0.0022   21.9   2.9   35    6-40      7-41  (154)
 44 3qho_A Endoglucanase, 458AA lo  22.5      18 0.00062   29.2   0.0   24   13-36    434-457 (458)
 45 3mk7_C Cytochrome C oxidase, C  22.5      69  0.0024   24.1   3.2   21    8-28     55-75  (311)
 46 2l35_A DAP12-NKG2C_TM; immunor  21.1      85  0.0029   19.6   2.9   23   13-35     10-33  (63)
 47 2wy3_A MHC class I polypeptide  20.2      22 0.00074   27.0   0.0    8   12-19    291-298 (319)

No 1  
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A*
Probab=92.96  E-value=0.018  Score=50.32  Aligned_cols=36  Identities=25%  Similarity=0.282  Sum_probs=0.0

Q ss_pred             hhhhhHHHHHHHHHHHHHHHHHHHhheeecCCCccc
Q psy17635          6 VATAGWFIGMLLAIAFLILVLILVCLIKRNRGGKYA   41 (103)
Q Consensus         6 ~at~gWfIg~~~ai~lLllilli~C~i~R~rGgKY~   41 (103)
                      +...++++.++|+++||+++|+++|+.||++..|-+
T Consensus       702 l~~~aii~il~~~~~ll~~~ll~~~~~~~~~~~k~~  737 (880)
T 1q55_A          702 FDLPIILVILGSVLALLILFLLLLLFLKRKKVVKEP  737 (880)
T ss_dssp             ------------------------------------
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHhhhhhcccccCC
Confidence            444455555666666666666666665554444444


No 2  
>2knc_A Integrin alpha-IIB; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens}
Probab=92.58  E-value=0.082  Score=32.51  Aligned_cols=30  Identities=27%  Similarity=0.524  Sum_probs=15.0

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHH--H---hheeecC
Q psy17635          7 ATAGWFIGMLLAIAFLILVLIL--V---CLIKRNR   36 (103)
Q Consensus         7 at~gWfIg~~~ai~lLllilli--~---C~i~R~r   36 (103)
                      ....|+|.+-+...||+|.+++  +   -|.||++
T Consensus         9 ~vp~wiIi~svl~GLllL~li~~~LwK~GFFkR~~   43 (54)
T 2knc_A            9 AIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNR   43 (54)
T ss_dssp             TCCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTC
T ss_pred             CcchHHHHHHHHHHHHHHHHHHHHHHHcCcccCCC
Confidence            3456766554443444433333  2   4557765


No 3  
>2k9y_A Ephrin type-A receptor 2; receptor tyrosine kinase, membrane protein, dimeric transmembrane domain, ephrin receptor, ATP-binding, glycoprotein; NMR {Homo sapiens}
Probab=91.54  E-value=0.15  Score=28.60  Aligned_cols=27  Identities=15%  Similarity=0.191  Sum_probs=12.8

Q ss_pred             hhhH-HHHHHHHHHHHHHHHHHHhheee
Q psy17635          8 TAGW-FIGMLLAIAFLILVLILVCLIKR   34 (103)
Q Consensus         8 t~gW-fIg~~~ai~lLllilli~C~i~R   34 (103)
                      +..+ .++++.++++|+++++++++++|
T Consensus        11 ~~~~I~~~vv~Gv~ll~~iv~~~~~~~r   38 (41)
T 2k9y_A           11 GNLAVIGGVAVGVVLLLVLAGVGFFIHR   38 (41)
T ss_dssp             SSTHHHHHHHHHHHHHHHHHHHHHSSSS
T ss_pred             ceEEEEeehhHHHHHHHHHHHHheeEee
Confidence            3355 34455556665523344444444


No 4  
>2l8s_A Integrin alpha-1; transmembrane region, detergent micelle, CE adhesion; NMR {Homo sapiens}
Probab=90.26  E-value=0.24  Score=30.47  Aligned_cols=29  Identities=24%  Similarity=0.410  Sum_probs=14.1

Q ss_pred             hhhHHHHHHHHHHHHHHHHH--H---HhheeecC
Q psy17635          8 TAGWFIGMLLAIAFLILVLI--L---VCLIKRNR   36 (103)
Q Consensus         8 t~gWfIg~~~ai~lLllill--i---~C~i~R~r   36 (103)
                      ...|+|.+-....||+|+++  +   +-|.||+|
T Consensus         7 vp~WiIi~svl~GLLLL~Lii~~LwK~GFFKR~~   40 (54)
T 2l8s_A            7 VPLWVILLSAFAGLLLLMLLILALWKIGFFKRPL   40 (54)
T ss_dssp             CCTHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCC
T ss_pred             CchHHHHHHHHHHHHHHHHHHHHHHHcCcccCCC
Confidence            34676654443333333333  3   24667776


No 5  
>2k1a_A Integrin alpha-IIB; single-PASS transmembrane segment, alternative splicing, calcium, cell adhesion, cleavage on PAIR of basic residues; NMR {Homo sapiens} PDB: 2k9j_A
Probab=87.13  E-value=0.63  Score=27.08  Aligned_cols=29  Identities=24%  Similarity=0.517  Sum_probs=13.6

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHH-----hheeecC
Q psy17635          8 TAGWFIGMLLAIAFLILVLILV-----CLIKRNR   36 (103)
Q Consensus         8 t~gWfIg~~~ai~lLllilli~-----C~i~R~r   36 (103)
                      ...|.|.+-+...+|+|.+++.     -|.||+|
T Consensus         8 vp~wiIi~s~l~GLllL~li~~~LwK~GFFkR~~   41 (42)
T 2k1a_A            8 IPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNR   41 (42)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHTTTTCCCC
T ss_pred             cchHHHHHHHHHHHHHHHHHHHHHHHcCcccCCC
Confidence            3467665544433444333332     3556654


No 6  
>1cd1_A CD1, MCD1D.1; immunology, MHC, TCR, glycoprotein, signal, immunoglobulin fold, T-cell; 2.67A {Mus musculus} SCOP: b.1.1.2 d.19.1.1
Probab=83.02  E-value=0.24  Score=37.95  Aligned_cols=19  Identities=5%  Similarity=0.247  Sum_probs=0.0

Q ss_pred             HHHHHHHHHhheeecCCCc
Q psy17635         21 FLILVLILVCLIKRNRGGK   39 (103)
Q Consensus        21 lLllilli~C~i~R~rGgK   39 (103)
                      |+||++|++++++|+++.|
T Consensus       294 l~ll~~~~~~~~~~~~~~~  312 (315)
T 1cd1_A          294 LVVVGAVVYYIWRRRSAYQ  312 (315)
T ss_dssp             -------------------
T ss_pred             HHHHHHHHHhheehhcCCC
Confidence            4444455344456655544


No 7  
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens}
Probab=82.60  E-value=0.82  Score=26.79  Aligned_cols=23  Identities=26%  Similarity=0.532  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHHHH-hheeec
Q psy17635         13 IGMLLAIAFLILVLILV-CLIKRN   35 (103)
Q Consensus        13 Ig~~~ai~lLllilli~-C~i~R~   35 (103)
                      .|++.+++++++|++.+ +|++|.
T Consensus        15 ~gVVgGv~~~~ii~~~~~~~~RRr   38 (44)
T 2ks1_B           15 TGMVGALLLLLVVALGIGLFMRRR   38 (44)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             eehhHHHHHHHHHHHHHHHHhhhh
Confidence            56666666666555554 444444


No 8  
>2knc_B Integrin beta-3; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens}
Probab=80.13  E-value=1.8  Score=27.80  Aligned_cols=21  Identities=19%  Similarity=0.262  Sum_probs=10.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHH
Q psy17635          9 AGWFIGMLLAIAFLILVLILV   29 (103)
Q Consensus         9 ~gWfIg~~~ai~lLllilli~   29 (103)
                      .+-++|++.+|+|+-|++|++
T Consensus        11 ~~Iv~gvi~gilliGllllli   31 (79)
T 2knc_B           11 LVVLLSVMGAILLIGLAALLI   31 (79)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhhHHHHHHHHHHHHHHHHHH
Confidence            344456666555555544443


No 9  
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D*
Probab=79.83  E-value=0.36  Score=37.25  Aligned_cols=25  Identities=24%  Similarity=0.115  Sum_probs=0.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhee
Q psy17635          9 AGWFIGMLLAIAFLILVLILVCLIK   33 (103)
Q Consensus         9 ~gWfIg~~~ai~lLllilli~C~i~   33 (103)
                      .+++|.+|.++++++|++++.|++.
T Consensus       339 ~~~~~~~i~~~~~~~~~l~~~~~~~  363 (380)
T 3lb6_C          339 KTLLRFWLPFGFILILVIFVTGLLL  363 (380)
T ss_dssp             -------------------------
T ss_pred             CccEEEEhHHHHHHHHHHHHHHHHH
Confidence            3466666666666666677777763


No 10 
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A
Probab=79.29  E-value=0.95  Score=26.65  Aligned_cols=30  Identities=20%  Similarity=0.353  Sum_probs=16.6

Q ss_pred             hhhhHHHHHHHHHHHHHHHHH-HHhheeecC
Q psy17635          7 ATAGWFIGMLLAIAFLILVLI-LVCLIKRNR   36 (103)
Q Consensus         7 at~gWfIg~~~ai~lLllill-i~C~i~R~r   36 (103)
                      ....++++.+..+++++++++ +.+|+||+|
T Consensus         9 ~~~~~Ia~~vVGvll~vi~~l~~~~~~RRR~   39 (44)
T 2jwa_A            9 SPLTSIISAVVGILLVVVLGVVFGILIKRRQ   39 (44)
T ss_dssp             CSHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             CcccchHHHHHHHHHHHHHHHHHHhheehhh
Confidence            344566666666554444433 356666654


No 11 
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens}
Probab=78.92  E-value=1.3  Score=25.99  Aligned_cols=24  Identities=17%  Similarity=0.380  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHHHHHH-hheeec
Q psy17635         12 FIGMLLAIAFLILVLILV-CLIKRN   35 (103)
Q Consensus        12 fIg~~~ai~lLllilli~-C~i~R~   35 (103)
                      -.|++..++++++|++.+ +|++|.
T Consensus        13 A~gVVgGv~~v~ii~~~~~~~~RRR   37 (44)
T 2l2t_A           13 AAGVIGGLFILVIVGLTFAVYVRRK   37 (44)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             EEeehHHHHHHHHHHHHHHHHhhhh
Confidence            345666566665555444 455543


No 12 
>2w1k_A Putative sortase; pilus, pneumococcus, pathogenicity, transferase; HET: MES; 2.14A {Streptococcus pneumoniae}
Probab=78.83  E-value=0.4  Score=36.64  Aligned_cols=27  Identities=33%  Similarity=0.604  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHhheeecCC
Q psy17635         11 WFIGMLLAIAFLILVLILVCLIKRNRG   37 (103)
Q Consensus        11 WfIg~~~ai~lLllilli~C~i~R~rG   37 (103)
                      |++..+.++++|++++++..++|+.||
T Consensus       225 ~~~~~~~~~~~~~~~~~~~~~~~~~r~  251 (252)
T 2w1k_A          225 WLYRGLVVLAFLGILFVLWKLARLLRG  251 (252)
T ss_dssp             ---------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            444444444555555555555555554


No 13 
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A
Probab=76.54  E-value=1.8  Score=24.39  Aligned_cols=9  Identities=11%  Similarity=0.180  Sum_probs=3.7

Q ss_pred             HHHhheeec
Q psy17635         27 ILVCLIKRN   35 (103)
Q Consensus        27 li~C~i~R~   35 (103)
                      .++||..|+
T Consensus        29 ~l~~~~~rr   37 (38)
T 2k1k_A           29 GILVFRSRR   37 (38)
T ss_dssp             HHHHHHHCC
T ss_pred             HHHHHHeec
Confidence            333444444


No 14 
>2klu_A T-cell surface glycoprotein CD4; cell membrane, disulfide bond, HOST- virus interaction, immune response, immunoglobulin domain, lipoprotein; NMR {Homo sapiens}
Probab=74.38  E-value=2.6  Score=27.08  Aligned_cols=19  Identities=26%  Similarity=0.373  Sum_probs=10.8

Q ss_pred             HHHHHHHHHH-H-HHHHhhee
Q psy17635         15 MLLAIAFLIL-V-LILVCLIK   33 (103)
Q Consensus        15 ~~~ai~lLll-i-lli~C~i~   33 (103)
                      ++.+++.|++ + ++|+|++|
T Consensus        13 vlGg~~~lll~~glcI~ccvk   33 (70)
T 2klu_A           13 VLGGVAGLLLFIGLGIFFSVR   33 (70)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHhHHHHHHHHHHHHHHHhhH
Confidence            5555554443 3 67777773


No 15 
>2jo1_A Phospholemman; FXYD1, Na,K-ATPase, micelle, hydrolase regulator; NMR {Homo sapiens}
Probab=73.54  E-value=2  Score=27.80  Aligned_cols=17  Identities=29%  Similarity=0.532  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy17635         13 IGMLLAIAFLILVLILV   29 (103)
Q Consensus        13 Ig~~~ai~lLllilli~   29 (103)
                      -||++|.+|.++-++|+
T Consensus        19 GGLifA~vLfi~GI~ii   35 (72)
T 2jo1_A           19 GGLVIAGILFILGILIV   35 (72)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             cchHHHHHHHHHHHHHH
Confidence            46666654444444443


No 16 
>1iij_A ERBB-2 receptor protein-tyrosine kinase; alpha-helix-PI-bulge-alpha-helix, signaling protein; NMR {Synthetic} SCOP: j.35.1.1
Probab=72.92  E-value=0.94  Score=25.55  Aligned_cols=10  Identities=50%  Similarity=0.713  Sum_probs=5.2

Q ss_pred             HHHhheeecC
Q psy17635         27 ILVCLIKRNR   36 (103)
Q Consensus        27 li~C~i~R~r   36 (103)
                      .+..++||+|
T Consensus        26 ~~~~~iRRr~   35 (35)
T 1iij_A           26 VVGILIKRRR   35 (35)
T ss_dssp             TTTHHHHHCC
T ss_pred             HhheEEeecC
Confidence            3345566654


No 17 
>2k9j_B Integrin beta-3; transmembrane complex, cell adhesion, cleavage on basic residues, disease mutation, glycoprotein, pyrrolidone carboxylic acid; NMR {Homo sapiens} PDB: 2rmz_A 2rn0_A 2l91_A
Probab=69.52  E-value=7  Score=22.40  Aligned_cols=23  Identities=17%  Similarity=0.226  Sum_probs=12.1

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHHH
Q psy17635          7 ATAGWFIGMLLAIAFLILVLILV   29 (103)
Q Consensus         7 at~gWfIg~~~ai~lLllilli~   29 (103)
                      ...+-+.|++.+|+++=+++|++
T Consensus         8 n~~~Iv~gvi~~ivliGl~lLli   30 (43)
T 2k9j_B            8 DILVVLLSVMGAILLIGLAALLI   30 (43)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CEeehHHHHHHHHHHHHHHHHHH
Confidence            33344456666666555554444


No 18 
>2l34_A TYRO protein tyrosine kinase-binding protein; immunoreceptor, transmembrane assembly, DAP12, protein bindi; NMR {Homo sapiens} PDB: 2l35_B
Probab=66.14  E-value=5.8  Score=21.75  Aligned_cols=14  Identities=21%  Similarity=0.539  Sum_probs=6.5

Q ss_pred             HHHHHHHHHhheee
Q psy17635         21 FLILVLILVCLIKR   34 (103)
Q Consensus        21 lLllilli~C~i~R   34 (103)
                      ..+++++.+.|+.|
T Consensus        19 ~t~~i~~~vy~~~r   32 (33)
T 2l34_A           19 LTVLIALAVYFLGR   32 (33)
T ss_dssp             HHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHhheec
Confidence            33344444555544


No 19 
>2l6w_A Beta-type platelet-derived growth factor receptor; transmembrane helix, receptor tyrosine kinase, heptad repeat membrane protein; NMR {Homo sapiens}
Probab=66.47  E-value=1.6  Score=25.23  Aligned_cols=18  Identities=17%  Similarity=0.552  Sum_probs=7.9

Q ss_pred             HHHHHHHHHHHHHHhhee
Q psy17635         16 LLAIAFLILVLILVCLIK   33 (103)
Q Consensus        16 ~~ai~lLllilli~C~i~   33 (103)
                      +.|++.++++.||+-+++
T Consensus        14 vlal~vi~iisLIiLi~~   31 (39)
T 2l6w_A           14 ILALVVLTIISLIILIML   31 (39)
Confidence            334444444444444443


No 20 
>1zza_A Stannin, AG8_1; helix, membrane protein; NMR {Homo sapiens}
Probab=61.47  E-value=9.5  Score=25.14  Aligned_cols=25  Identities=32%  Similarity=0.509  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHHHHH-hheeecC
Q psy17635         12 FIGMLLAIAFLILVLILV-CLIKRNR   36 (103)
Q Consensus        12 fIg~~~ai~lLllilli~-C~i~R~r   36 (103)
                      +|.+++||+-|-.++|.+ |+.+-+|
T Consensus        17 v~viliavaalg~li~gcwcylrlqr   42 (90)
T 1zza_A           17 VIVILIAIAALGALILGCWCYLRLQR   42 (90)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTTSSCS
T ss_pred             ehhHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344555555554444444 4334344


No 21 
>1s7q_A H-2KB, H-2 class I histocompatibility antigen, K-B alpha chain; LCMV, MHC class I, immune escape, immune system; 1.99A {Mus musculus} SCOP: b.1.1.2 d.19.1.1 PDB: 1s7r_A 1s7s_A 1s7t_A 1bii_A 3qul_A 1s7v_A 1s7w_A 1s7x_A 3quk_A 1s7u_A 1nez_A*
Probab=58.83  E-value=2  Score=33.49  Aligned_cols=9  Identities=0%  Similarity=0.228  Sum_probs=0.0

Q ss_pred             HHHHHHHHH
Q psy17635         13 IGMLLAIAF   21 (103)
Q Consensus        13 Ig~~~ai~l   21 (103)
                      ||++.++++
T Consensus       284 ~~i~~~~~~  292 (348)
T 1s7q_A          284 MATVAVLVV  292 (348)
T ss_dssp             ---------
T ss_pred             EEEEeehhh
Confidence            445444433


No 22 
>3arc_J Photosystem II reaction center protein J; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 1s5l_J* 3a0b_J* 3a0h_J* 2axt_J* 3bz1_J* 3bz2_J* 3kzi_J* 3prq_J* 3prr_J*
Probab=51.97  E-value=18  Score=20.85  Aligned_cols=19  Identities=11%  Similarity=0.506  Sum_probs=14.0

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q psy17635          9 AGWFIGMLLAIAFLILVLI   27 (103)
Q Consensus         9 ~gWfIg~~~ai~lLllill   27 (103)
                      --|+|+.+..++.+-++-+
T Consensus         9 PLWlvgtv~G~~vi~~~gi   27 (40)
T 3arc_J            9 PLWIVATVAGMGVIVIVGL   27 (40)
T ss_dssp             CHHHHHHHHHHHHHHHHHH
T ss_pred             cEEeeeeehhhhhhheeeE
Confidence            4699999998777655543


No 23 
>2zxe_G FXYD10, phospholemman-like protein; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_G*
Probab=50.29  E-value=12  Score=24.16  Aligned_cols=18  Identities=17%  Similarity=0.619  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q psy17635         12 FIGMLLAIAFLILVLILV   29 (103)
Q Consensus        12 fIg~~~ai~lLllilli~   29 (103)
                      +-||++|.+|.++-++|+
T Consensus        21 igGLifA~vLfi~GI~ii   38 (74)
T 2zxe_G           21 VVGLIVAAVLCVIGIIIL   38 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             eccchhHHHHHHHHHHHH
Confidence            346777755555544444


No 24 
>2lk9_A Bone marrow stromal antigen 2; membrane, micelle, antiviral protein-immune system complex; NMR {Homo sapiens}
Probab=50.11  E-value=21  Score=20.01  Aligned_cols=14  Identities=21%  Similarity=0.467  Sum_probs=5.2

Q ss_pred             HHHHHHHHhheeec
Q psy17635         22 LILVLILVCLIKRN   35 (103)
Q Consensus        22 Lllilli~C~i~R~   35 (103)
                      .+.+++|+..++-|
T Consensus        19 ~LgV~LI~f~~kAn   32 (35)
T 2lk9_A           19 ILGVPLIIFTIKKK   32 (35)
T ss_dssp             HHHHHHHHHC----
T ss_pred             HhcchheEEeeecc
Confidence            34455555544433


No 25 
>2jp3_A FXYD domain-containing ION transport regulator 4; protein, transcription; NMR {Rattus norvegicus}
Probab=48.29  E-value=10  Score=24.05  Aligned_cols=18  Identities=17%  Similarity=0.235  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q psy17635         12 FIGMLLAIAFLILVLILV   29 (103)
Q Consensus        12 fIg~~~ai~lLllilli~   29 (103)
                      .-||++|.+|.++-++|+
T Consensus        19 igGLifA~vLfi~GI~ii   36 (67)
T 2jp3_A           19 LGGLIFGGLLCIAGIALA   36 (67)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             ecchhhHHHHHHHHHHHH
Confidence            346777755555444443


No 26 
>4hkr_A Calcium release-activated calcium channel protein; ORAI1, eukaryotic membrane protein, membran protein, ION channel, STIM, membrane; 3.35A {Drosophila melanogaster} PDB: 4hks_A
Probab=45.95  E-value=13  Score=28.28  Aligned_cols=26  Identities=23%  Similarity=0.689  Sum_probs=20.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhheee
Q psy17635          9 AGWFIGMLLAIAFLILVLILVCLIKR   34 (103)
Q Consensus         9 ~gWfIg~~~ai~lLllilli~C~i~R   34 (103)
                      -+|.......|.|.+.-+.++|+||=
T Consensus       114 ~AW~fST~lGi~LFL~evall~WVKF  139 (214)
T 4hkr_A          114 TAWAFSTLLGLILFLLEIAILCWVKF  139 (214)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHhheEEe
Confidence            46888888888887777777888764


No 27 
>1fjk_A Cardiac phospholamban; helix, membrane protein; NMR {Sus scrofa} SCOP: j.37.1.1 PDB: 1fjp_A 2kyv_A 1zll_A 2hyn_A 1n7l_A 2kb7_P 1plp_A
Probab=44.84  E-value=17  Score=21.77  Aligned_cols=22  Identities=36%  Similarity=0.674  Sum_probs=12.3

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHH
Q psy17635          8 TAGWFIGMLLAIAFLILVLILV   29 (103)
Q Consensus         8 t~gWfIg~~~ai~lLllilli~   29 (103)
                      -|--|+-+...+..|+||.+|+
T Consensus        28 lqelfvnfclilicllli~iiv   49 (52)
T 1fjk_A           28 LQNLFINFCLILIFLLLICIIV   49 (52)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3556666655555555555554


No 28 
>2llm_A Amyloid beta A4 protein; alzheimer'S disease, protein fibril; NMR {Homo sapiens} PDB: 2loh_A
Probab=47.93  E-value=5.4  Score=23.38  Aligned_cols=27  Identities=19%  Similarity=0.589  Sum_probs=18.4

Q ss_pred             hhhHHHHHHHH-HHHHHHHHHHHhheee
Q psy17635          8 TAGWFIGMLLA-IAFLILVLILVCLIKR   34 (103)
Q Consensus         8 t~gWfIg~~~a-i~lLllilli~C~i~R   34 (103)
                      +.+=+||++.+ +++..+|++.+.+.||
T Consensus        15 srga~iGL~v~gVai~~vIVvsl~mlRr   42 (43)
T 2llm_A           15 NKGAIIGLMVGGVVIATVIVITLVMLKK   42 (43)
Confidence            45667888844 7777777777766665


No 29 
>3hb3_B Cytochrome C oxidase subunit 2; electron transfer, proton transfer, proton pumping, membrane protein, cell inner membrane, cell membrane, copper; HET: HEA LDA LMT; 2.25A {Paracoccus denitrificans} PDB: 1ar1_B* 3ehb_B* 1qle_B*
Probab=40.53  E-value=22  Score=27.69  Aligned_cols=14  Identities=21%  Similarity=0.985  Sum_probs=6.5

Q ss_pred             HHHHHHHHHHHhhe
Q psy17635         19 IAFLILVLILVCLI   32 (103)
Q Consensus        19 i~lLllilli~C~i   32 (103)
                      |.++++.+++.|++
T Consensus        74 I~v~V~~l~~~~~~   87 (298)
T 3hb3_B           74 VTIFVCLLLLICIV   87 (298)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            34444444455554


No 30 
>2kse_A Sensor protein QSEC; methods development, histidine kinase receptor, membrane domain, two-helical hairpin, cell-free synthesis, ATP- binding; NMR {Escherichia coli}
Probab=38.34  E-value=28  Score=22.30  Aligned_cols=24  Identities=21%  Similarity=0.260  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHhheee
Q psy17635         11 WFIGMLLAIAFLILVLILVCLIKR   34 (103)
Q Consensus        11 WfIg~~~ai~lLllilli~C~i~R   34 (103)
                      |.+.+..+++++++++++...++|
T Consensus       162 ~~~~~~~~~~~~~~~~~~~~~vrr  185 (186)
T 2kse_A          162 AGQLIPWLVALPIMLIIMMVLLGR  185 (186)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcc
Confidence            333333333333344444444443


No 31 
>2akh_X Protein-export membrane protein SECG; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_X
Probab=36.91  E-value=41  Score=21.05  Aligned_cols=13  Identities=15%  Similarity=0.570  Sum_probs=7.2

Q ss_pred             HHHHhheeecCCC
Q psy17635         26 LILVCLIKRNRGG   38 (103)
Q Consensus        26 lli~C~i~R~rGg   38 (103)
                      ++++.+..+.||+
T Consensus        16 LI~~VLlQ~~Kg~   28 (77)
T 2akh_X           16 LVGLIMLQQGKGA   28 (77)
T ss_pred             HHHHheeeCCCCC
Confidence            3334556776765


No 32 
>1cz6_A Protein (androctonin); peptide, beta sheet, toxin; NMR {Androctonus australis} SCOP: j.3.1.3
Probab=35.69  E-value=12  Score=19.53  Aligned_cols=10  Identities=60%  Similarity=0.896  Sum_probs=7.4

Q ss_pred             eeecCCCccc
Q psy17635         32 IKRNRGGKYA   41 (103)
Q Consensus        32 i~R~rGgKY~   41 (103)
                      |+|.|||-|-
T Consensus         9 icrrrggcyy   18 (26)
T 1cz6_A            9 ICRRRGGCYY   18 (26)
T ss_dssp             ECCSSSCCEE
T ss_pred             HHHhcCceEE
Confidence            4688898873


No 33 
>2gsm_B Cytochrome C oxidase subunit 2; transmembrane protein complex, oxidoreductase; HET: DMU HEA TRD; 2.00A {Rhodobacter sphaeroides} SCOP: b.6.1.2 f.17.2.1 PDB: 3dtu_B* 3fye_B* 3fyi_B* 3omi_B* 3om3_B* 3oma_B* 3omn_B* 1m56_B* 1m57_B*
Probab=34.94  E-value=35  Score=25.87  Aligned_cols=14  Identities=29%  Similarity=0.539  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHHhhe
Q psy17635         19 IAFLILVLILVCLI   32 (103)
Q Consensus        19 i~lLllilli~C~i   32 (103)
                      |.++++.+++.+++
T Consensus        43 I~v~V~~ll~~~~~   56 (262)
T 2gsm_B           43 ITIFVTLLILYAVW   56 (262)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            33444444445554


No 34 
>1jb0_X Photosystem I subunit PSAX; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: f.23.20.1 PDB: 3pcq_X*
Probab=33.72  E-value=32  Score=19.20  Aligned_cols=15  Identities=47%  Similarity=0.915  Sum_probs=10.3

Q ss_pred             hhhHHHHHHHHHHHHH
Q psy17635          8 TAGWFIGMLLAIAFLI   23 (103)
Q Consensus         8 t~gWfIg~~~ai~lLl   23 (103)
                      ..+|.| ++.+|-+|+
T Consensus        12 rt~Wal-llLaINflV   26 (35)
T 1jb0_X           12 RTFWAV-LLLAINFLV   26 (35)
T ss_dssp             HHHHHH-HHHHHHHHH
T ss_pred             HHHHHH-HHHHHHHHH
Confidence            457988 666666665


No 35 
>3j0f_E E1 envelope glycoprotein; alphavirus, virus assembly; 7.00A {Sindbis virus} PDB: 1ld4_M 1z8y_I
Probab=33.02  E-value=36  Score=28.25  Aligned_cols=9  Identities=11%  Similarity=0.552  Sum_probs=5.6

Q ss_pred             hhHHHHHHH
Q psy17635          9 AGWFIGMLL   17 (103)
Q Consensus         9 ~gWfIg~~~   17 (103)
                      -.|+-.++.
T Consensus       407 w~W~~~l~g  415 (439)
T 3j0f_E          407 WSWLFALFG  415 (439)
T ss_pred             HHHHHHHhc
Confidence            357777763


No 36 
>1vry_A Glycine receptor alpha-1 chain; second transmembrane domain, third transmembrane domain, membrane protein; NMR {Homo sapiens} SCOP: j.35.1.1
Probab=30.08  E-value=45  Score=21.15  Aligned_cols=29  Identities=21%  Similarity=0.297  Sum_probs=15.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhheeecCC
Q psy17635          9 AGWFIGMLLAIAFLILVLILVCLIKRNRG   37 (103)
Q Consensus         9 ~gWfIg~~~ai~lLllilli~C~i~R~rG   37 (103)
                      --|+++-++.+.+.||=..++.++.|++.
T Consensus        36 Dvw~~~C~~FVF~aLlEya~V~y~~r~~~   64 (76)
T 1vry_A           36 DIWLAVCLLFVFSALLEYAAVNFVSRKKK   64 (76)
T ss_dssp             HHTHHHHHHHHHHHHHHHHHHHHHCC---
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhcc
Confidence            34665555555554544667777766544


No 37 
>3j1r_A Archaeal adhesion filament core; helical polymer, flagellar filament, cell adhesion, structur protein; 7.50A {Ignicoccus hospitalis}
Probab=29.43  E-value=39  Score=17.70  Aligned_cols=10  Identities=40%  Similarity=0.644  Sum_probs=4.4

Q ss_pred             HHHHHHHHHH
Q psy17635         17 LAIAFLILVL   26 (103)
Q Consensus        17 ~ai~lLllil   26 (103)
                      .|.+||++|.
T Consensus         5 VA~~lLIvia   14 (26)
T 3j1r_A            5 IATLLLILIA   14 (26)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHHH
Confidence            3444444443


No 38 
>1z65_A PRPLP, prion-like protein doppel, doppelganger; transmembrane helix, DHPC, mouse doppel, unknown function; NMR {Synthetic}
Probab=29.31  E-value=33  Score=18.58  Aligned_cols=12  Identities=17%  Similarity=0.664  Sum_probs=8.2

Q ss_pred             hHHHHHHHHHHH
Q psy17635         10 GWFIGMLLAIAF   21 (103)
Q Consensus        10 gWfIg~~~ai~l   21 (103)
                      +|-++++|++++
T Consensus         7 ~~wlai~c~LLf   18 (30)
T 1z65_A            7 TWWVAILCMLLA   18 (30)
T ss_dssp             SHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHH
Confidence            677777776543


No 39 
>1jdm_A Sarcolipin; helix, membrane protein; NMR {Synthetic} SCOP: j.35.1.1
Probab=28.12  E-value=26  Score=19.01  Aligned_cols=10  Identities=40%  Similarity=0.703  Sum_probs=4.7

Q ss_pred             HHHHhheeec
Q psy17635         26 LILVCLIKRN   35 (103)
Q Consensus        26 lli~C~i~R~   35 (103)
                      ++++|++-|+
T Consensus        19 vlLi~llVrs   28 (31)
T 1jdm_A           19 VILMWLLVRS   28 (31)
T ss_dssp             HHHHHHHTTS
T ss_pred             HHHHHHHHHh
Confidence            3344555454


No 40 
>3j0c_A E1 envelope glycoprotein; alphavirus, bioweapon; 4.80A {Venezuelan equine encephalitis virus}
Probab=27.99  E-value=21  Score=29.72  Aligned_cols=7  Identities=29%  Similarity=1.032  Sum_probs=3.6

Q ss_pred             hHHHHHH
Q psy17635         10 GWFIGML   16 (103)
Q Consensus        10 gWfIg~~   16 (103)
                      .|+-.++
T Consensus       408 ~W~~~l~  414 (442)
T 3j0c_A          408 TWLTSLL  414 (442)
T ss_dssp             HHHHTTS
T ss_pred             HHHHHHh
Confidence            4555544


No 41 
>1pi7_A VPU protein, U ORF protein; alpha helix, viral protein; NMR {Human immunodeficiency virus 1} SCOP: j.35.1.1 PDB: 1pi8_A 1pje_A 2gof_A 2goh_A 2jpx_A
Probab=27.29  E-value=77  Score=17.53  Aligned_cols=12  Identities=25%  Similarity=0.570  Sum_probs=4.3

Q ss_pred             HHHHHHHHHHHH
Q psy17635         17 LAIAFLILVLIL   28 (103)
Q Consensus        17 ~ai~lLllilli   28 (103)
                      .|++.++++.++
T Consensus         9 valivalIiaIV   20 (36)
T 1pi7_A            9 VALVVAIIIAIV   20 (36)
T ss_pred             HHHHHHHHHHHH
Confidence            333333333333


No 42 
>2jln_A MHP1; hydantoin, transporter, membrane protein, nucleobase-cation-symport-1 family; 2.85A {Microbacterium liquefaciens} PDB: 2jlo_A* 2x79_A
Probab=24.48  E-value=49  Score=26.56  Aligned_cols=14  Identities=7%  Similarity=-0.076  Sum_probs=8.6

Q ss_pred             eecCCCcccchhhh
Q psy17635         33 KRNRGGKYAVHERE   46 (103)
Q Consensus        33 ~R~rGgKY~VkeKE   46 (103)
                      .+..-.||+-++-|
T Consensus       448 ~~~~~~~~~~~~~~  461 (501)
T 2jln_A          448 VAKTFPLFSEAESR  461 (501)
T ss_dssp             HTTTSCSCCGGGGG
T ss_pred             Cchhhhhccccccc
Confidence            34447899865533


No 43 
>2h8a_A Microsomal glutathione S-transferase 1; membrane protein; HET: GSH; 3.20A {Rattus norvegicus} SCOP: f.56.1.1
Probab=22.72  E-value=65  Score=21.92  Aligned_cols=35  Identities=11%  Similarity=-0.040  Sum_probs=20.9

Q ss_pred             hhhhhHHHHHHHHHHHHHHHHHHHhheeecCCCcc
Q psy17635          6 VATAGWFIGMLLAIAFLILVLILVCLIKRNRGGKY   40 (103)
Q Consensus         6 ~at~gWfIg~~~ai~lLllilli~C~i~R~rGgKY   40 (103)
                      ..+..|-+-.+++.++++.+++....+-|.|+-+.
T Consensus         7 ~~~~~~~~~~~~a~ll~l~~l~~s~~v~~~R~~~~   41 (154)
T 2h8a_A            7 MDNEVLMAFTSYATIILAKMMFLSSATAFQRLTNK   41 (154)
T ss_dssp             --CHHHHHHHHHHHHHHTTHHHHGGGSCCCCCCCT
T ss_pred             cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
Confidence            45556667777776666666666666666655543


No 44 
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A*
Probab=22.51  E-value=18  Score=29.16  Aligned_cols=24  Identities=21%  Similarity=0.353  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHhheeecC
Q psy17635         13 IGMLLAIAFLILVLILVCLIKRNR   36 (103)
Q Consensus        13 Ig~~~ai~lLllilli~C~i~R~r   36 (103)
                      -+-+|..++|+.+++|-.+.+|+|
T Consensus       434 ~~~~~~~~~~~~~~~~~~~~~~~~  457 (458)
T 3qho_A          434 SKKICGPAILIILAVFSLLLRRAP  457 (458)
T ss_dssp             ------------------------
T ss_pred             CCeeeHHHHHHHHHHHHHHHHhcc
Confidence            356888888888888877777654


No 45 
>3mk7_C Cytochrome C oxidase, CBB3-type, subunit P; TM helices, oxidoreductase; HET: HEM HEC FC6; 3.20A {Pseudomonas stutzeri}
Probab=22.47  E-value=69  Score=24.06  Aligned_cols=21  Identities=33%  Similarity=0.622  Sum_probs=16.0

Q ss_pred             hhhHHHHHHHHHHHHHHHHHH
Q psy17635          8 TAGWFIGMLLAIAFLILVLIL   28 (103)
Q Consensus         8 t~gWfIg~~~ai~lLllilli   28 (103)
                      -.+|++.+++.|++.++.+++
T Consensus        55 p~ww~~~f~~~iv~~~~y~~~   75 (311)
T 3mk7_C           55 PRWWFLLFIGTLVFGILYLVL   75 (311)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHH
T ss_pred             ChHHHHHHHHHHHHHHHHHHH
Confidence            357888888888888777654


No 46 
>2l35_A DAP12-NKG2C_TM; immunoreceptor, transmembrane assembly, DAP12-NKG2C complex; NMR {Homo sapiens}
Probab=21.13  E-value=85  Score=19.55  Aligned_cols=23  Identities=17%  Similarity=0.507  Sum_probs=11.2

Q ss_pred             HHHHHH-HHHHHHHHHHHhheeec
Q psy17635         13 IGMLLA-IAFLILVLILVCLIKRN   35 (103)
Q Consensus        13 Ig~~~a-i~lLllilli~C~i~R~   35 (103)
                      .|++.+ |++.+++++.+.++-|+
T Consensus        10 aGIIv~DIi~TllLal~VY~~A~~   33 (63)
T 2l35_A           10 AGIVVGDLVLTVLIALAVYFLGRL   33 (63)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCCS
T ss_pred             ehhHHHHHHHHHHHHHHHHhhccc
Confidence            445555 45555555555444333


No 47 
>2wy3_A MHC class I polypeptide-related sequence B; immune system-viral protein complex, immune response, innate immunity, structural mimicry; HET: NAG PEU; 1.80A {Homo sapiens} PDB: 1je6_A 1hyr_C 1b3j_A*
Probab=20.20  E-value=22  Score=26.98  Aligned_cols=8  Identities=0%  Similarity=0.007  Sum_probs=0.0

Q ss_pred             HHHHHHHH
Q psy17635         12 FIGMLLAI   19 (103)
Q Consensus        12 fIg~~~ai   19 (103)
                      ..|++.+|
T Consensus       291 ~~g~~~gl  298 (319)
T 2wy3_A          291 VSAAMPCF  298 (319)
T ss_dssp             --------
T ss_pred             cchhhhhH
Confidence            44555553


Done!