BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy17648
(530 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2HV2|A Chain A, Crystal Structure Of Conserved Protein Of Unknown Function
From Enterococcus Faecalis V583 At 2.4 A Resolution,
Probable N- Acyltransferase
pdb|2HV2|B Chain B, Crystal Structure Of Conserved Protein Of Unknown Function
From Enterococcus Faecalis V583 At 2.4 A Resolution,
Probable N- Acyltransferase
pdb|2HV2|C Chain C, Crystal Structure Of Conserved Protein Of Unknown Function
From Enterococcus Faecalis V583 At 2.4 A Resolution,
Probable N- Acyltransferase
pdb|2HV2|D Chain D, Crystal Structure Of Conserved Protein Of Unknown Function
From Enterococcus Faecalis V583 At 2.4 A Resolution,
Probable N- Acyltransferase
pdb|2HV2|E Chain E, Crystal Structure Of Conserved Protein Of Unknown Function
From Enterococcus Faecalis V583 At 2.4 A Resolution,
Probable N- Acyltransferase
pdb|2HV2|F Chain F, Crystal Structure Of Conserved Protein Of Unknown Function
From Enterococcus Faecalis V583 At 2.4 A Resolution,
Probable N- Acyltransferase
Length = 400
Score = 30.8 bits (68), Expect = 1.8, Method: Compositional matrix adjust.
Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 2/42 (4%)
Query: 438 LMFRVAVVLFTIMMAVFIPH--FAILMGFIGSFTGTMLSFIW 477
+++R+A F I+ ++ + F L GFIGS +G++ SF W
Sbjct: 217 VIYRIAAGTFEIVEWNYLTNTAFKALAGFIGSHSGSVQSFHW 258
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.142 0.466
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,255,148
Number of Sequences: 62578
Number of extensions: 593444
Number of successful extensions: 1124
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1123
Number of HSP's gapped (non-prelim): 2
length of query: 530
length of database: 14,973,337
effective HSP length: 103
effective length of query: 427
effective length of database: 8,527,803
effective search space: 3641371881
effective search space used: 3641371881
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 54 (25.4 bits)