Diaphorina citri psyllid: psy17681

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MFYRNVLAAVCVLCVVSCQGDLSRGFGGHINWKSLDAGLQAAKTSGKPLMVLIHKSYCAACHELSPKFAASPEIAELAPKFEMVNISDDEEPQDPKYAPDGDYVPRILYFGPQGEPKSQVFNAKSPQVYRHYYYDVPSIVQAMKSALN
ccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHcccHHHHHHccccEEEEEcccccccccccccccccccEEEEEcccccEEEEccccccccccccccccHHHHHHHHHHHHc
*FYRNVLAAVCVLCVVSCQGDLSRGFGGHINWKSLDAGLQAAKTSGKPLMVLIHKSYCAACHELSPKFAASPEIAELAPKFEMVNISDDEEPQDPKYAPDGDYVPRILYFGPQGEPKSQVFNAKSPQVYRHYYYDVPSIVQAMKSAL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFYRNVLAAVCVLCVVSCQGDLSRGFGGHINWKSLDAGLQAAKTSGKPLMVLIHKSYCAACHELSPKFAASPEIAELAPKFEMVNISDDEEPQDPKYAPDGDYVPRILYFGPQGEPKSQVFNAKSPQVYRHYYYDVPSIVQAMKSALN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin domain-containing protein 12 Possesses significant protein thiol-disulfide oxidase activity.confidentO95881
Thioredoxin domain-containing protein 12 Possesses significant protein thiol-disulfide oxidase activity.confidentQ5E936
Thioredoxin domain-containing protein 12 Possesses significant protein thiol-disulfide oxidase activity.confidentQ9CQU0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0002162 [MF]dystroglycan bindingprobableGO:0001948, GO:0003674, GO:0005488, GO:0005515
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SEN, chain A
Confidence level:very confident
Coverage over the Query: 22-147
View the alignment between query and template
View the model in PyMOL