BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy177
(608 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2K49|A Chain A, Solution Nmr Structure Of Upf0339 Protein So3888 From
Shewanella Oneidensis. Northeast Structural Genomics
Consortium Target Sor190
Length = 118
Score = 31.2 bits (69), Expect = 1.7, Method: Composition-based stats.
Identities = 13/51 (25%), Positives = 26/51 (50%)
Query: 49 DSTQSDTPVESSKASDVESDEDVEVNLKKTHHDFLNFQDYYNEIGCKDKLI 99
+S Q+++P+E+ A +V ++ NLK +H + Y+ +D I
Sbjct: 44 ESVQTNSPIEARYAKEVAKNDKPYFNLKAANHQIIGTSQMYSSTAARDNGI 94
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.135 0.384
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,959,736
Number of Sequences: 62578
Number of extensions: 617339
Number of successful extensions: 1756
Number of sequences better than 100.0: 27
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 26
Number of HSP's that attempted gapping in prelim test: 1754
Number of HSP's gapped (non-prelim): 29
length of query: 608
length of database: 14,973,337
effective HSP length: 104
effective length of query: 504
effective length of database: 8,465,225
effective search space: 4266473400
effective search space used: 4266473400
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)