Query         psy17710
Match_columns 75
No_of_seqs    65 out of 67
Neff          4.4 
Searched_HMMs 46136
Date          Fri Aug 16 21:02:54 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17710.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17710hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1826|consensus               99.6 1.3E-15 2.7E-20  134.8   4.4   68    1-73    973-1040(2724)
  2 PF01843 DIL:  DIL domain;  Int  72.7     8.1 0.00018   24.2   3.9   39   13-52     12-50  (105)
  3 PF08203 RNA_polI_A14:  Yeast R  44.8      11 0.00023   23.9   0.8    9   62-70     60-68  (76)
  4 PF11108 Phage_glycop_gL:  Vira  40.0      45 0.00098   22.4   3.3   40   14-53     61-100 (111)
  5 PRK03907 fliE flagellar hook-b  38.1      29 0.00063   22.7   2.1   23   22-44     69-91  (97)
  6 PRK01699 fliE flagellar hook-b  37.0      31 0.00067   22.6   2.1   23   22-44     71-93  (99)
  7 PRK00732 fliE flagellar hook-b  36.5      32 0.00069   22.6   2.1   23   22-44     74-96  (102)
  8 PRK00790 fliE flagellar hook-b  34.3      36 0.00078   22.6   2.1   22   23-44     82-103 (109)
  9 PF10547 P22_AR_N:  P22_AR N-te  31.3      16 0.00036   24.6   0.1   36   39-75     73-108 (120)
 10 PRK00253 fliE flagellar hook-b  31.2      43 0.00094   22.0   2.1   23   22-44     80-102 (108)
 11 cd06405 PB1_Mekk2_3 The PB1 do  30.1      23 0.00049   22.8   0.5   11   64-74     50-60  (79)
 12 cd03568 VHS_STAM VHS domain fa  28.9      97  0.0021   21.0   3.5   35   11-51     80-114 (144)
 13 PRK01482 fliE flagellar hook-b  28.7      51  0.0011   22.0   2.1   23   22-44     81-103 (108)
 14 TIGR00205 fliE flagellar hook-  28.4      52  0.0011   21.8   2.1   23   22-44     81-103 (108)
 15 PRK12728 fliE flagellar hook-b  27.9      54  0.0012   21.4   2.1   23   22-44     74-96  (102)
 16 PF02049 FliE:  Flagellar hook-  27.3      57  0.0012   20.5   2.1   23   22-44     68-90  (96)
 17 PRK12729 fliE flagellar hook-b  27.0      55  0.0012   22.6   2.1   23   22-44    100-122 (127)
 18 PF00790 VHS:  VHS domain;  Int  26.8 1.1E+02  0.0024   20.1   3.5   18   34-51    105-122 (140)
 19 PF14922 FWWh:  Protein of unkn  26.2      70  0.0015   22.3   2.5   19   34-52    135-153 (161)
 20 cd03569 VHS_Hrs_Vps27p VHS dom  24.1 1.3E+02  0.0029   20.1   3.5   23   29-51     96-118 (142)
 21 COG5606 Uncharacterized conser  23.4      92   0.002   20.5   2.5   22   27-48     18-39  (91)
 22 smart00288 VHS Domain present   23.1 1.7E+02  0.0037   19.2   3.9   36   11-51     80-115 (133)
 23 PF08514 STAG:  STAG domain  ;   22.4 1.3E+02  0.0029   19.6   3.2   42    6-52     16-57  (118)
 24 PF08236 SRI:  SRI (Set2 Rpb1 i  22.1 1.2E+02  0.0025   19.0   2.7   41   29-74      4-44  (88)
 25 TIGR02837 spore_II_R stage II   21.6   1E+02  0.0022   22.2   2.6   20   32-51     58-77  (168)
 26 cd03561 VHS VHS domain family;  21.4 1.6E+02  0.0035   19.2   3.4   23   30-52     95-117 (133)
 27 PF11081 DUF2890:  Protein of u  21.3 1.4E+02   0.003   21.9   3.3   39    4-44    120-158 (187)
 28 COG1677 FliE Flagellar hook-ba  20.9      88  0.0019   20.5   2.1   23   22-44     77-99  (105)

No 1  
>KOG1826|consensus
Probab=99.57  E-value=1.3e-15  Score=134.84  Aligned_cols=68  Identities=38%  Similarity=0.561  Sum_probs=61.7

Q ss_pred             CcchhhHHHHHHHHHHHHHHcccccchhhhHHHHHHHHHHHHHHHhcCcCCCCCCCCCCCCchhhhhhhhhhh
Q psy17710          1 MTVHAVHIKTKLCNLIEAMMRRRDDLAFRREMSFRNKLVDYLMDWVLGSANQVTIPPTPGESFVSISRDLLKF   73 (75)
Q Consensus         1 ~t~~slRiKik~CqL~e~vm~rkd~l~~r~e~~~RNkLle~i~eW~~~~s~~~~~~~~~~d~~~rlqrDLD~a   73 (75)
                      |||..+|||+|+|||+|+||.|||+|+|++|++|||+|+||+++|+|+.+...+    .++ ..++-||||||
T Consensus       973 i~V~~irvrskLcqL~Evmi~rredLtf~~em~f~nkl~e~L~d~vmgt~~~aa----l~~-~~~~~rdlDQa 1040 (2724)
T KOG1826|consen  973 ITVKFIRVRSKLCQLAEVMISRREDLTFPLEMGFVNKLFESLYDSVMGTEYLAA----LNF-HERNIRDLDQA 1040 (2724)
T ss_pred             hhhhhhhHHHHHHHHHHHHHhhhhhchhHHHHHHHHHHHHHHHHhhcchhHHHh----hhh-HHHHhhhHHHH
Confidence            689999999999999999999999999999999999999999999999665532    344 88999999998


No 2  
>PF01843 DIL:  DIL domain;  InterPro: IPR018444 Dilute encodes a novel type of myosin heavy chain, with a tail, or C-terminal, region that has elements of both type II (alpha-helical coiled-coil) and type I (non-coiled-coil) myosin heavy chains. The DIL non alpha-helical domain is found in dilute myosin heavy chain proteins and other myosins. In mouse the dilute protein may play a role in the elaboration, maintenance, or function of cellular processes of melanocytes and neurons []. The MYO2 protein of Saccharomyces cerevisiae is implicated in vectorial vesicle transport and is homologous to the dilute protein over practically its entire length [].; PDB: 3MMI_B 2F6H_X.
Probab=72.75  E-value=8.1  Score=24.23  Aligned_cols=39  Identities=18%  Similarity=0.416  Sum_probs=31.7

Q ss_pred             HHHHHHHHcccccchhhhHHHHHHHHHHHHHHHhcCcCCC
Q psy17710         13 CNLIEAMMRRRDDLAFRREMSFRNKLVDYLMDWVLGSANQ   52 (75)
Q Consensus        13 CqL~e~vm~rkd~l~~r~e~~~RNkLle~i~eW~~~~s~~   52 (75)
                      |.+.+.+|.+++..+....+++|-. |..|.+|.......
T Consensus        12 ~~~fN~ll~~~~~~~~~~g~qi~~n-ls~l~~W~~~~~l~   50 (105)
T PF01843_consen   12 ASLFNSLLLRRKYCSWSKGVQIRYN-LSELEDWARSHGLE   50 (105)
T ss_dssp             HHHHHHHHCHSS-B-HHHHHHHHHH-HHHHHHCCCCTTST
T ss_pred             HHHHHHHHCCCCccccccHHHHHHH-HHHHHHHHHhcccc
Confidence            6788999999999999999999965 57999999866554


No 3  
>PF08203 RNA_polI_A14:  Yeast RNA polymerase I subunit RPA14;  InterPro: IPR013239 Saccharomyces cerevisiae RNA polymerase I (Pol I) is a complex consisting of 14 subunits. Subunit RPA14 forms part of a Pol I subcomplex consisting of RPA14 and and RPA43. The RPA14 and RPA43 heterodimer is proposed to play a role in the recruitment of Pol I to the promoter []. ; PDB: 2RF4_F.
Probab=44.81  E-value=11  Score=23.93  Aligned_cols=9  Identities=44%  Similarity=0.663  Sum_probs=7.9

Q ss_pred             chhhhhhhh
Q psy17710         62 SFVSISRDL   70 (75)
Q Consensus        62 ~~~rlqrDL   70 (75)
                      +++|+||||
T Consensus        60 QLKRiQRdl   68 (76)
T PF08203_consen   60 QLKRIQRDL   68 (76)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHhh
Confidence            489999998


No 4  
>PF11108 Phage_glycop_gL:  Viral glycoprotein L;  InterPro: IPR020175 Herpesviruses are enveloped by a lipid bilayer that contains at least a dozen glycoproteins. The virion surface glycoproteins mediate recognition of susceptible cells and promote fusion of the viral envelope with the cell membrane, leading to virus entry. No single glycoprotein associated with the virion membrane has been identified as the fusogen []. Glycoprotein L (gL) forms a non-covalently linked heterodimer with glycoprotein H (gH). This heterodimer is essential for virus-cell and cell-cell fusion since the association of gH and gL is necessary for correct localisation of gH to the virion or cell surface. gH anchoring the heterodimer to the plasma membrane through its transmembrane domain. gL lacks a transmembrane domain and is secreted from cells when expressed in the absence of gH [].; PDB: 3PHF_N.
Probab=40.01  E-value=45  Score=22.43  Aligned_cols=40  Identities=10%  Similarity=0.090  Sum_probs=32.4

Q ss_pred             HHHHHHHcccccchhhhHHHHHHHHHHHHHHHhcCcCCCC
Q psy17710         14 NLIEAMMRRRDDLAFRREMSFRNKLVDYLMDWVLGSANQV   53 (75)
Q Consensus        14 qL~e~vm~rkd~l~~r~e~~~RNkLle~i~eW~~~~s~~~   53 (75)
                      ..+.+|++|-+.=+-..|.+|.|.|..+..++.+..+...
T Consensus        61 SFllAvl~rl~~~~~~~~~~lln~L~~~~~~F~~~f~~~t  100 (111)
T PF11108_consen   61 SFLLAVLDRLPSNTPPEDLELLNHLQRLKDSFLEKFSAVT  100 (111)
T ss_dssp             HHHHHHHHGGGGG--THHHHHHHHHHHHHTTSGGGGGGS-
T ss_pred             HHHHHHHHhccccCCHHHHHHHHHHHHHHHHHHHHhcccc
Confidence            4578999999777779999999999999999988877753


No 5  
>PRK03907 fliE flagellar hook-basal body protein FliE; Reviewed
Probab=38.06  E-value=29  Score=22.67  Aligned_cols=23  Identities=13%  Similarity=0.296  Sum_probs=19.6

Q ss_pred             ccccchhhhHHHHHHHHHHHHHH
Q psy17710         22 RRDDLAFRREMSFRNKLVDYLMD   44 (75)
Q Consensus        22 rkd~l~~r~e~~~RNkLle~i~e   44 (75)
                      .+..++|+--+.+|||+||.--|
T Consensus        69 ~kA~ls~q~~vqVRNKlveAYqE   91 (97)
T PRK03907         69 GKAETSMKLMLEVRNKAISAYKE   91 (97)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            46789999999999999997655


No 6  
>PRK01699 fliE flagellar hook-basal body protein FliE; Reviewed
Probab=36.96  E-value=31  Score=22.56  Aligned_cols=23  Identities=9%  Similarity=0.322  Sum_probs=19.6

Q ss_pred             ccccchhhhHHHHHHHHHHHHHH
Q psy17710         22 RRDDLAFRREMSFRNKLVDYLMD   44 (75)
Q Consensus        22 rkd~l~~r~e~~~RNkLle~i~e   44 (75)
                      .|..++|.=-+.+|||++|---|
T Consensus        71 ~kA~lslq~~vqVRNK~veAYqE   93 (99)
T PRK01699         71 KKAESQMKTAALVRDNLIENYKS   93 (99)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            56789999999999999997655


No 7  
>PRK00732 fliE flagellar hook-basal body protein FliE; Reviewed
Probab=36.48  E-value=32  Score=22.58  Aligned_cols=23  Identities=17%  Similarity=0.341  Sum_probs=19.8

Q ss_pred             ccccchhhhHHHHHHHHHHHHHH
Q psy17710         22 RRDDLAFRREMSFRNKLVDYLMD   44 (75)
Q Consensus        22 rkd~l~~r~e~~~RNkLle~i~e   44 (75)
                      .+..|+|.-=+.+|||++|---|
T Consensus        74 ~kA~lslq~~vqVRNKlveAYqE   96 (102)
T PRK00732         74 AETDVAVSTLVSVRDRVIQAYEE   96 (102)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            56789999999999999997655


No 8  
>PRK00790 fliE flagellar hook-basal body protein FliE; Reviewed
Probab=34.30  E-value=36  Score=22.62  Aligned_cols=22  Identities=18%  Similarity=0.501  Sum_probs=18.5

Q ss_pred             cccchhhhHHHHHHHHHHHHHH
Q psy17710         23 RDDLAFRREMSFRNKLVDYLMD   44 (75)
Q Consensus        23 kd~l~~r~e~~~RNkLle~i~e   44 (75)
                      +..++|+==+.+|||++|---|
T Consensus        82 kA~lslq~~vqVRNKlVeAYqE  103 (109)
T PRK00790         82 QAEQALQTAVAIRDKVVEAYLE  103 (109)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4568999999999999997655


No 9  
>PF10547 P22_AR_N:  P22_AR N-terminal domain;  InterPro: IPR018875  The antirepressor protein, ANT, prevents the prophage p22 c2 repressor protein from binding to its operators; it also inhibits the action of other prophage repressor proteins, including those of phages lambda and 434. The synthesis of antirepressor is negatively regulated by the protein products of the two other immi genes, mnt and arc. 
Probab=31.28  E-value=16  Score=24.57  Aligned_cols=36  Identities=14%  Similarity=0.374  Sum_probs=25.5

Q ss_pred             HHHHHHHhcCcCCCCCCCCCCCCchhhhhhhhhhhhC
Q psy17710         39 VDYLMDWVLGSANQVTIPPTPGESFVSISRDLLKFIW   75 (75)
Q Consensus        39 le~i~eW~~~~s~~~~~~~~~~d~~~rlqrDLD~a~~   75 (75)
                      |++|..|+...+...+ .+.-.|-+..+|++-+.|+|
T Consensus        73 l~~L~~WL~~I~p~kV-~pelr~kvi~YQ~Ec~~vL~  108 (120)
T PF10547_consen   73 LRKLPGWLFTINPNKV-KPELREKVIAYQEECDDVLW  108 (120)
T ss_pred             HHHHHHHHhhCChhhc-CHHHHHHHHHHHHHHHHHHH
Confidence            6899999998766544 22222348889999888775


No 10 
>PRK00253 fliE flagellar hook-basal body protein FliE; Reviewed
Probab=31.22  E-value=43  Score=22.01  Aligned_cols=23  Identities=26%  Similarity=0.515  Sum_probs=19.0

Q ss_pred             ccccchhhhHHHHHHHHHHHHHH
Q psy17710         22 RRDDLAFRREMSFRNKLVDYLMD   44 (75)
Q Consensus        22 rkd~l~~r~e~~~RNkLle~i~e   44 (75)
                      .+..++|.-=+.+|||+||---|
T Consensus        80 ~kA~lslq~~~qVRNKlv~AYqE  102 (108)
T PRK00253         80 QKASVSFQAGIQVRNKLVAAYQE  102 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            35678999999999999997654


No 11 
>cd06405 PB1_Mekk2_3 The PB1 domain is present in the two mitogen-activated protein kinase kinases MEKK2 and MEKK3 which are two members of the signaling kinase cascade involved in angiogenesis and early cardiovascular development. The PB1 domain of MEKK2 (and/or MEKK3) interacts with the PB1 domain of another member of the kinase cascade Map2k5.  A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, f
Probab=30.10  E-value=23  Score=22.81  Aligned_cols=11  Identities=27%  Similarity=0.268  Sum_probs=8.6

Q ss_pred             hhhhhhhhhhh
Q psy17710         64 VSISRDLLKFI   74 (75)
Q Consensus        64 ~rlqrDLD~a~   74 (75)
                      -+=|-|||+||
T Consensus        50 l~~Q~DLDkAi   60 (79)
T cd06405          50 LKNQEDLDRAI   60 (79)
T ss_pred             ccCHHHHHHHH
Confidence            34578999997


No 12 
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein). Collectively, they are referred to as STAM. All STAMs have at their N-termini a VHS domain, which is involved in cytokine-mediated intracellular signal transduction and has a superhelical structure similar to the structure of ARM (Armadillo) repeats, followed by a SH3 (Src homology 3) domain, a well-established protein-protein interaction domain. At the C-termini of most vertebrate STAMS, an ITAM (Immunoreceptor Tyrosine-based Activation) motif is present, which mediates the binding of HRS (hepatocyte growth factor-regulated tyrosine kinase substrate) in endocytic and exocytic machineries.
Probab=28.87  E-value=97  Score=20.96  Aligned_cols=35  Identities=14%  Similarity=0.315  Sum_probs=26.1

Q ss_pred             HHHHHHHHHHcccccchhhhHHHHHHHHHHHHHHHhcCcCC
Q psy17710         11 KLCNLIEAMMRRRDDLAFRREMSFRNKLVDYLMDWVLGSAN   51 (75)
Q Consensus        11 k~CqL~e~vm~rkd~l~~r~e~~~RNkLle~i~eW~~~~s~   51 (75)
                      .|.+-+..+..++      -...+++++++.|-+|...+..
T Consensus        80 ~Fl~eL~kl~~~~------~~~~Vk~kil~li~~W~~~f~~  114 (144)
T cd03568          80 DFTQELKKLINDR------VHPTVKEKLREVVKQWADEFKN  114 (144)
T ss_pred             HHHHHHHHHhccc------CCHHHHHHHHHHHHHHHHHhCC
Confidence            4555555556665      4679999999999999887664


No 13 
>PRK01482 fliE flagellar hook-basal body protein FliE; Reviewed
Probab=28.74  E-value=51  Score=21.97  Aligned_cols=23  Identities=4%  Similarity=0.151  Sum_probs=19.5

Q ss_pred             ccccchhhhHHHHHHHHHHHHHH
Q psy17710         22 RRDDLAFRREMSFRNKLVDYLMD   44 (75)
Q Consensus        22 rkd~l~~r~e~~~RNkLle~i~e   44 (75)
                      .+..++|.--+.+|||+||.--|
T Consensus        81 qkA~lslql~vqVRNKlVeAYqE  103 (108)
T PRK01482         81 AKANMNLSIAKAVVERSIKAYQD  103 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            46788999999999999997655


No 14 
>TIGR00205 fliE flagellar hook-basal body complex protein FliE. fliE is a component of the flagellar hook-basal body complex located possibly at (MS-ring)-rod junction.
Probab=28.43  E-value=52  Score=21.76  Aligned_cols=23  Identities=17%  Similarity=0.252  Sum_probs=19.2

Q ss_pred             ccccchhhhHHHHHHHHHHHHHH
Q psy17710         22 RRDDLAFRREMSFRNKLVDYLMD   44 (75)
Q Consensus        22 rkd~l~~r~e~~~RNkLle~i~e   44 (75)
                      .+..++|.--+.+|||++|.--|
T Consensus        81 ~kA~lslq~~vqVRNKlveAYqE  103 (108)
T TIGR00205        81 QKASMSMSILKEVRNKAVKAYQE  103 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            45678999999999999997654


No 15 
>PRK12728 fliE flagellar hook-basal body protein FliE; Provisional
Probab=27.85  E-value=54  Score=21.37  Aligned_cols=23  Identities=17%  Similarity=0.456  Sum_probs=19.1

Q ss_pred             ccccchhhhHHHHHHHHHHHHHH
Q psy17710         22 RRDDLAFRREMSFRNKLVDYLMD   44 (75)
Q Consensus        22 rkd~l~~r~e~~~RNkLle~i~e   44 (75)
                      .+..++|.-=+.+|||+|+.--|
T Consensus        74 ~kA~lslq~~vqVRNKlv~AYqE   96 (102)
T PRK12728         74 QKASISLQLTVQIRNKVVEAYQE   96 (102)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            35678999999999999997655


No 16 
>PF02049 FliE:  Flagellar hook-basal body complex protein FliE;  InterPro: IPR001624 Four genes from the major Bacillus subtilis chemotaxis locus have been shown to encode proteins that are similar to the Salmonella typhimurium FlgB, FlgC, FlgG and FliF proteins; a further gene product is similar to the Escherichia coli FliE protein []. All of these proteins are thought to form part of the hook-basal body complex of the bacterial flagella []. The FlgB, FlgC and FlgG proteins are components of the proximal and distal rods; FliF forms the M-ring that anchors the rod assembly to the membrane; but the role of FliE has not yet been determined []. The similarity between the proteins in these two organisms suggests that the structures of the M-ring and the rod may be similar []. Nevertheless, some differences in size and amino acid composition between some of the homologues suggest the basal body proteins may be organised slightly differently within B. subtilis []. From gel electrophoresis and autoradiography of 35S-labelled S. typhimurium hook-basal body complexes and the deduced number of sulphur-containing residues in FliE, the stoichiometry of the protein in the hook-basal body complex has been estimated to be about nine subunits []. FliE does not undergo cleavage of a signal peptide, nor does it show any similarity to the axial components like the rod or hook proteins, which are thought to be exported by the flagellum-specific export pathway []. On this evidence, it has been suggested that FliE may be in the vicinity of the MS ring, perhaps acting as an adaptor protein between ring and rod substructures [].; GO: 0003774 motor activity, 0005198 structural molecule activity, 0001539 ciliary or flagellar motility, 0009288 bacterial-type flagellum
Probab=27.30  E-value=57  Score=20.52  Aligned_cols=23  Identities=22%  Similarity=0.418  Sum_probs=19.1

Q ss_pred             ccccchhhhHHHHHHHHHHHHHH
Q psy17710         22 RRDDLAFRREMSFRNKLVDYLMD   44 (75)
Q Consensus        22 rkd~l~~r~e~~~RNkLle~i~e   44 (75)
                      -+..++|.==+.+|||+++-.-|
T Consensus        68 ~kA~lslq~~vqVRnK~v~AYqE   90 (96)
T PF02049_consen   68 QKASLSLQLAVQVRNKAVEAYQE   90 (96)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            35678899999999999997655


No 17 
>PRK12729 fliE flagellar hook-basal body protein FliE; Provisional
Probab=26.98  E-value=55  Score=22.55  Aligned_cols=23  Identities=9%  Similarity=0.154  Sum_probs=19.7

Q ss_pred             ccccchhhhHHHHHHHHHHHHHH
Q psy17710         22 RRDDLAFRREMSFRNKLVDYLMD   44 (75)
Q Consensus        22 rkd~l~~r~e~~~RNkLle~i~e   44 (75)
                      .+..++|.==+.+|||+||.--|
T Consensus       100 qKAslSlql~vQVRNKvVeAYqE  122 (127)
T PRK12729        100 EKARVALTFTKTIADGVVRAYRE  122 (127)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            56789999999999999997655


No 18 
>PF00790 VHS:  VHS domain;  InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM. Based on regions surrounding the domain, VHS-proteins can be divided into 4 groups []:  STAM/EAST/Hbp which all share the domain composition VHS-SH3-ITAM and carry one or two ubiquitin-interacting motifs   Proteins with a FYVE domain (IPR000306 from INTERPRO) C-terminal to VHS which also carry one or two ubiquitin-interacting motifs   GGA proteins with a domain composition VHS-GAT (GGA and Tom1) homology domain   VHS domain alone or in combination with domains other than those listed above The VHS domain is always found at the N- terminus of proteins suggesting that such topology is important for function. The domain is considered to have a general membrane targeting/cargo recognition role in vesicular trafficking []. Resolution of the crystal structure of the VHS domain of Drosophila Hrs and human Tom1 revealed that it consists of eight helices arranged in a double-layer superhelix []. The existence of conserved patches of residues on the domain surface suggests that VHS domains may be involved in protein-protein recognition and docking. Overall, sequence similarity is low (approx 25%) amongst domain family members.; GO: 0006886 intracellular protein transport; PDB: 1X5B_A 2L0T_B 1DVP_A 3LDZ_C 3ZYQ_A 4AVX_A 3G2U_A 3G2W_A 1UJJ_A 3G2V_A ....
Probab=26.76  E-value=1.1e+02  Score=20.07  Aligned_cols=18  Identities=17%  Similarity=0.549  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHhcCcCC
Q psy17710         34 FRNKLVDYLMDWVLGSAN   51 (75)
Q Consensus        34 ~RNkLle~i~eW~~~~s~   51 (75)
                      +|+++++.|.+|-..+..
T Consensus       105 Vk~k~l~ll~~W~~~f~~  122 (140)
T PF00790_consen  105 VKEKILELLQEWAEAFKS  122 (140)
T ss_dssp             HHHHHHHHHHHHHHHTTT
T ss_pred             HHHHHHHHHHHHHHHHCC
Confidence            999999999999987744


No 19 
>PF14922 FWWh:  Protein of unknown function
Probab=26.24  E-value=70  Score=22.33  Aligned_cols=19  Identities=21%  Similarity=0.585  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHhcCcCCC
Q psy17710         34 FRNKLVDYLMDWVLGSANQ   52 (75)
Q Consensus        34 ~RNkLle~i~eW~~~~s~~   52 (75)
                      ||..|.+.+.+|++|.-..
T Consensus       135 FK~~l~~~~~~w~sGi~p~  153 (161)
T PF14922_consen  135 FKSNLYNTCSEWISGIKPS  153 (161)
T ss_pred             HHHHHHHHHHHHHcCCccC
Confidence            9999999999999987664


No 20 
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting). The VHS domain, an essential part of Hrs/Vps27p, has a superhelical structure similar to the structure of ARM (Armadillo) repeats and is present at the N-termini of proteins. Hrs also contains a FYVE (Fab1p, YOTB, Vac1p, and EEA1) zinc finger domain C-terminal to VHS, as well as two coiled-coil domains. Hrs has been proposed to play a role in at least three vesicle trafficking events: exocytosis, endocytosis, and endosome to lysosome trafficking. Hrs is involved in promoting rapid recycling of endocytosed signaling receptors to the plasma membrane.
Probab=24.13  E-value=1.3e+02  Score=20.14  Aligned_cols=23  Identities=22%  Similarity=0.556  Sum_probs=19.2

Q ss_pred             hhHHHHHHHHHHHHHHHhcCcCC
Q psy17710         29 RREMSFRNKLVDYLMDWVLGSAN   51 (75)
Q Consensus        29 r~e~~~RNkLle~i~eW~~~~s~   51 (75)
                      .-..++|+++++.|.+|...+..
T Consensus        96 ~~~~~Vk~kil~li~~W~~~f~~  118 (142)
T cd03569          96 TKNEEVRQKILELIQAWALAFRN  118 (142)
T ss_pred             cCCHHHHHHHHHHHHHHHHHhCC
Confidence            45678999999999999876654


No 21 
>COG5606 Uncharacterized conserved small protein [Function unknown]
Probab=23.44  E-value=92  Score=20.50  Aligned_cols=22  Identities=18%  Similarity=0.383  Sum_probs=18.4

Q ss_pred             hhhhHHHHHHHHHHHHHHHhcC
Q psy17710         27 AFRREMSFRNKLVDYLMDWVLG   48 (75)
Q Consensus        27 ~~r~e~~~RNkLle~i~eW~~~   48 (75)
                      .--.++++|-+|.+.|..|+--
T Consensus        18 e~a~~m~ir~~l~~~i~~~i~q   39 (91)
T COG5606          18 EAAENMKIRSALMMAIKQWIEQ   39 (91)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3456889999999999999863


No 22 
>smart00288 VHS Domain present in VPS-27, Hrs and STAM. Unpublished observations. Domain of unknown function.
Probab=23.13  E-value=1.7e+02  Score=19.17  Aligned_cols=36  Identities=11%  Similarity=0.383  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHcccccchhhhHHHHHHHHHHHHHHHhcCcCC
Q psy17710         11 KLCNLIEAMMRRRDDLAFRREMSFRNKLVDYLMDWVLGSAN   51 (75)
Q Consensus        11 k~CqL~e~vm~rkd~l~~r~e~~~RNkLle~i~eW~~~~s~   51 (75)
                      +|.+-+..+...+....     .+|+++++.|.+|...+..
T Consensus        80 ~fl~~L~~l~~~~~~~~-----~Vk~kil~li~~W~~~f~~  115 (133)
T smart00288       80 EFLNELVKLIKPKYPLP-----LVKKRILELIQEWADAFKN  115 (133)
T ss_pred             HHHHHHHHHHcCCCCcH-----HHHHHHHHHHHHHHHHHcC
Confidence            35554555555544321     2999999999999887755


No 23 
>PF08514 STAG:  STAG domain  ;  InterPro: IPR013721 STAG domain proteins are subunits of cohesin complex - a protein complex required for sister chromatid cohesion in eukaryotes. The STAG domain is present in Schizosaccharomyces pombe (Fission yeast) mitotic cohesin Psc3, and the meiosis specific cohesin Rec11. Many organisms express a meiosis-specific STAG protein, for example, mice and humans have a meiosis specific variant called STAG3, although budding yeast does not have a meiosis specific version []. 
Probab=22.41  E-value=1.3e+02  Score=19.64  Aligned_cols=42  Identities=12%  Similarity=0.512  Sum_probs=30.6

Q ss_pred             hHHHHHHHHHHHHHHcccccchhhhHHHHHHHHHHHHHHHhcCcCCC
Q psy17710          6 VHIKTKLCNLIEAMMRRRDDLAFRREMSFRNKLVDYLMDWVLGSANQ   52 (75)
Q Consensus         6 lRiKik~CqL~e~vm~rkd~l~~r~e~~~RNkLle~i~eW~~~~s~~   52 (75)
                      =..+-.||.+++.++..=.     .++-+-.-|+|.|..|+..-|..
T Consensus        16 k~Fr~~~~~F~~~lv~~~~-----~~~Lyd~~l~~~l~~wl~~lS~S   57 (118)
T PF08514_consen   16 KKFRKNFCEFFDQLVEQCH-----SSILYDDYLMDNLISWLTALSSS   57 (118)
T ss_pred             HHHHHHHHHHHHHHHHHhc-----ccccccHHHHHHHHHHHHHhccC
Confidence            3567788999888887543     33344448999999999977664


No 24 
>PF08236 SRI:  SRI (Set2 Rpb1 interacting) domain;  InterPro: IPR013257  The SRI (Set2 Rpb1 interacting) domain mediates RNA polymerase II interaction and couples histone H3 K36 methylation with transcript elongation []. This domain is conserved from yeast to humans. Members of this family form a compact, closed three-helix bundle, with an up-down-up topology. The first and second helices are antiparallel to each other and are of similar length; the third helix, which is packed across helices alpha1 and alpha2 is slightly shorter, consisting of only 15 amino acids. Most conserved hydrophobic residues are largely buried in the interior of the structure and form an extensive and contiguous hydrophobic core that stabilises the packing of the three-helix bundle. This domain mediates RNA polymerase II interaction and couples histone H3 K36 methylation with transcript elongation []. ; GO: 0018024 histone-lysine N-methyltransferase activity, 0006355 regulation of transcription, DNA-dependent, 0034968 histone lysine methylation, 0005694 chromosome; PDB: 2A7O_A 2C5Z_A.
Probab=22.06  E-value=1.2e+02  Score=18.97  Aligned_cols=41  Identities=17%  Similarity=0.345  Sum_probs=30.9

Q ss_pred             hhHHHHHHHHHHHHHHHhcCcCCCCCCCCCCCCchhhhhhhhhhhh
Q psy17710         29 RREMSFRNKLVDYLMDWVLGSANQVTIPPTPGESFVSISRDLLKFI   74 (75)
Q Consensus        29 r~e~~~RNkLle~i~eW~~~~s~~~~~~~~~~d~~~rlqrDLD~a~   74 (75)
                      +++-.||+.+-.++..-+.....+    ...+| +..+-|+|-+++
T Consensus         4 ~~~~~~~~~l~~~V~~~l~~y~~~----~~~dd-fK~~ar~lt~~l   44 (88)
T PF08236_consen    4 KQEKKFRKTLAKHVVNLLNKYRKK----LSKDD-FKHLARKLTHKL   44 (88)
T ss_dssp             HHHHHHHHHHHHHHHHHHCTTTTT------HHH-HHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHcccc----CCHHH-HHHHHHHHHHHH
Confidence            457789999999999988877665    22344 999999987764


No 25 
>TIGR02837 spore_II_R stage II sporulation protein R. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage II sporulation protein R.
Probab=21.55  E-value=1e+02  Score=22.17  Aligned_cols=20  Identities=15%  Similarity=0.504  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHHhcCcCC
Q psy17710         32 MSFRNKLVDYLMDWVLGSAN   51 (75)
Q Consensus        32 ~~~RNkLle~i~eW~~~~s~   51 (75)
                      .++|+.+++++.+|+.+...
T Consensus        58 l~VRD~Vl~~~~~~~~~~~s   77 (168)
T TIGR02837        58 LKVRDAVLKEIRPWLSGLKS   77 (168)
T ss_pred             HHHHHHHHHHHHHHhccCCC
Confidence            46899999999999986543


No 26 
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule). It has a superhelical structure similar to that of the ARM (Armadillo) repeats and is present at the N-termini of proteins involved in intracellular membrane trafficking. There are four general groups of VHS domain containing proteins based on their association with other domains. The first group consists of proteins of the STAM/EAST/Hbp family which has the domain composition VHS-SH3-ITAM. The second consists of proteins with a FYVE domain C-terminal to VHS. The third consists of GGA proteins with a domain composition VHS-GAT (GGA and TOM)-GAE (gamma-adaptin ear) domain. The fourth consists of proteins with a VHS domain alone or with domains other than those mentioned above. In GGA proteins, VHS domains are involved in cargo recognition in trans-Golgi, thereby having a general me
Probab=21.35  E-value=1.6e+02  Score=19.16  Aligned_cols=23  Identities=13%  Similarity=0.381  Sum_probs=19.5

Q ss_pred             hHHHHHHHHHHHHHHHhcCcCCC
Q psy17710         30 REMSFRNKLVDYLMDWVLGSANQ   52 (75)
Q Consensus        30 ~e~~~RNkLle~i~eW~~~~s~~   52 (75)
                      -+..+|+++++.|.+|...+...
T Consensus        95 ~~~~Vk~kil~ll~~W~~~f~~~  117 (133)
T cd03561          95 YDPKVREKALELILAWSESFGGH  117 (133)
T ss_pred             CCHHHHHHHHHHHHHHHHHhcCC
Confidence            47889999999999999866653


No 27 
>PF11081 DUF2890:  Protein of unknown function (DUF2890);  InterPro: IPR021304  This entry contains the 33kDa and 22kDa phosphoproteins from vertebrate adenoviruses.
Probab=21.29  E-value=1.4e+02  Score=21.86  Aligned_cols=39  Identities=10%  Similarity=0.252  Sum_probs=28.7

Q ss_pred             hhhHHHHHHHHHHHHHHcccccchhhhHHHHHHHHHHHHHH
Q psy17710          4 HAVHIKTKLCNLIEAMMRRRDDLAFRREMSFRNKLVDYLMD   44 (75)
Q Consensus         4 ~slRiKik~CqL~e~vm~rkd~l~~r~e~~~RNkLle~i~e   44 (75)
                      +.-+.|.++|+-+.+++...-.-  .++.++||+-|.-++-
T Consensus       120 swr~lR~~I~~tLyaifqqsrG~--~~~~kikNRtlrSlTR  158 (187)
T PF11081_consen  120 SWRELRNRIFPTLYAIFQQSRGN--EQELKIKNRTLRSLTR  158 (187)
T ss_pred             HHHHHHHHHHHHHHHHHHHhcCC--ccccchhhHHHHHHHH
Confidence            34567888888888888763322  7788999988887764


No 28 
>COG1677 FliE Flagellar hook-basal body protein [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=20.86  E-value=88  Score=20.50  Aligned_cols=23  Identities=22%  Similarity=0.472  Sum_probs=18.4

Q ss_pred             ccccchhhhHHHHHHHHHHHHHH
Q psy17710         22 RRDDLAFRREMSFRNKLVDYLMD   44 (75)
Q Consensus        22 rkd~l~~r~e~~~RNkLle~i~e   44 (75)
                      .|..++|.=-+.+|||+++..-|
T Consensus        77 ~KAs~sLq~ai~VRnKlV~AYqE   99 (105)
T COG1677          77 QKASVSLQTAIQVRNKLVSAYQE   99 (105)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            35667888889999999987655


Done!