Query         psy17730
Match_columns 101
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 46136
Date          Fri Aug 16 21:31:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17730.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17730hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG0165 ArgH Argininosuccinate  95.2  0.0078 1.7E-07   50.4   1.0   55    1-59    281-335 (459)
  2 PRK06389 argininosuccinate lya  94.1  0.0095 2.1E-07   48.7  -1.0   55    1-59    273-327 (434)
  3 KOG1316|consensus               90.5   0.081 1.8E-06   45.3   0.1   57    1-63    284-342 (464)
  4 PRK00485 fumC fumarate hydrata  87.4    0.18 3.8E-06   40.5   0.0   14    1-14    321-334 (464)
  5 PLN02646 argininosuccinate lya  86.9     0.2 4.4E-06   40.6   0.1   48    1-57    294-346 (474)
  6 cd01595 Adenylsuccinate_lyase_  86.7     0.2 4.4E-06   38.5   0.0   13    1-13    263-275 (381)
  7 TIGR02426 protocat_pcaB 3-carb  86.6    0.22 4.7E-06   38.2   0.1   13    1-13    269-281 (338)
  8 PRK06390 adenylosuccinate lyas  86.4    0.19 4.1E-06   40.0  -0.3   43    1-50    277-319 (451)
  9 PRK12425 fumarate hydratase; P  85.8    0.26 5.5E-06   40.0   0.2   13    1-13    319-331 (464)
 10 cd01334 Lyase_I Lyase class I   84.6    0.34 7.5E-06   36.2   0.4   13    1-13    253-265 (325)
 11 cd01360 Adenylsuccinate_lyase_  84.3    0.34 7.4E-06   37.7   0.2   13    1-13    262-274 (387)
 12 cd01597 pCLME prokaryotic 3-ca  84.1    0.31 6.8E-06   38.2  -0.1   13    1-13    272-284 (437)
 13 PRK08540 adenylosuccinate lyas  83.9    0.33 7.2E-06   38.4   0.0   13    1-13    277-289 (449)
 14 PRK06705 argininosuccinate lya  83.7    0.29 6.2E-06   40.0  -0.4   14    1-14    287-300 (502)
 15 PRK08937 adenylosuccinate lyas  82.7    0.35 7.5E-06   33.6  -0.3   13    1-13     62-74  (216)
 16 TIGR00928 purB adenylosuccinat  82.6    0.36 7.9E-06   37.9  -0.2   13    1-13    271-283 (435)
 17 PRK04833 argininosuccinate lya  82.4    0.44 9.6E-06   38.2   0.2   13    1-13    280-292 (455)
 18 TIGR00838 argH argininosuccina  82.3    0.38 8.2E-06   38.1  -0.2   13    1-13    278-290 (455)
 19 PRK12308 bifunctional arginino  82.2    0.41 8.8E-06   39.2  -0.1   13    1-13    280-292 (614)
 20 PLN00134 fumarate hydratase; P  81.6    0.49 1.1E-05   38.2   0.2   13    1-13    313-325 (458)
 21 PRK02186 argininosuccinate lya  81.4    0.56 1.2E-05   39.9   0.5   13    1-13    687-699 (887)
 22 PRK12273 aspA aspartate ammoni  80.6    0.46 9.9E-06   38.4  -0.3   13    1-13    323-335 (472)
 23 cd01596 Aspartase_like asparta  80.5    0.54 1.2E-05   37.9   0.1   13    1-13    316-328 (450)
 24 PRK13353 aspartate ammonia-lya  80.0     0.5 1.1E-05   38.2  -0.3   13    1-13    321-333 (473)
 25 PRK14515 aspartate ammonia-lya  79.7    0.58 1.3E-05   38.4   0.0   13    1-13    327-339 (479)
 26 TIGR00979 fumC_II fumarate hyd  79.4     0.5 1.1E-05   38.2  -0.4   13    1-13    318-330 (458)
 27 cd01362 Fumarase_classII Class  79.3    0.61 1.3E-05   37.6   0.0   13    1-13    317-329 (455)
 28 cd01357 Aspartase Aspartase. T  78.3    0.65 1.4E-05   37.3  -0.1   13    1-13    316-328 (450)
 29 PRK00855 argininosuccinate lya  77.8    0.77 1.7E-05   36.5   0.2   13    1-13    282-294 (459)
 30 cd03302 Adenylsuccinate_lyase_  77.0    0.78 1.7E-05   36.5   0.0   13    1-13    276-288 (436)
 31 cd01359 Argininosuccinate_lyas  76.7    0.98 2.1E-05   35.3   0.5   13    1-13    258-270 (435)
 32 PRK09053 3-carboxy-cis,cis-muc  75.5    0.86 1.9E-05   36.2  -0.1   13    1-13    281-293 (452)
 33 TIGR00839 aspA aspartate ammon  75.2     0.7 1.5E-05   37.6  -0.7   13    1-13    319-331 (468)
 34 PRK07492 adenylosuccinate lyas  73.9     1.2 2.6E-05   35.7   0.4   13    1-13    268-280 (435)
 35 PRK08470 adenylosuccinate lyas  73.5     1.3 2.9E-05   35.3   0.5   13    1-13    265-277 (442)
 36 PRK05975 3-carboxy-cis,cis-muc  73.3     1.1 2.4E-05   34.8   0.0   13    1-13    276-288 (351)
 37 PRK07380 adenylosuccinate lyas  72.8     1.3 2.8E-05   35.5   0.3   12    1-12    265-276 (431)
 38 PLN02848 adenylosuccinate lyas  63.7     2.6 5.5E-05   34.4   0.3   12    1-12    301-312 (458)
 39 cd01598 PurB PurB_like adenylo  62.3     3.2   7E-05   33.5   0.6   12    1-12    276-287 (425)
 40 PRK09285 adenylosuccinate lyas  61.2     3.6 7.7E-05   33.4   0.7   11    1-11    298-308 (456)
 41 cd01594 Lyase_I_like Lyase cla  57.5     2.5 5.4E-05   28.6  -0.7   15    1-15    168-182 (231)
 42 PF00403 HMA:  Heavy-metal-asso  48.9     7.9 0.00017   21.7   0.6   13   82-94      4-16  (62)
 43 TIGR00003 copper ion binding p  32.9      22 0.00047   16.5   0.7   14   81-94      7-20  (68)
 44 PF13931 Microtub_bind:  Kinesi  32.8      42 0.00092   24.5   2.4   27    2-28     12-38  (143)
 45 COG4187 RocB Arginine degradat  31.1     9.5 0.00021   33.6  -1.4   40   17-58    276-331 (553)
 46 PF09016 Pas_Saposin:  Pas fact  28.9      33 0.00072   23.6   1.2   23   13-35     12-36  (76)
 47 PF02945 Endonuclease_7:  Recom  28.7      24 0.00052   23.1   0.5   15   79-93     47-61  (81)
 48 COG2608 CopZ Copper chaperone   28.6      25 0.00055   21.3   0.6   15   80-94      6-20  (71)
 49 PF14049 Dppa2_A:  Dppa2/4 cons  25.1      23  0.0005   24.7  -0.1   24    6-31      2-25  (86)
 50 COG4107 PhnK ABC-type phosphon  23.1      96  0.0021   25.2   3.1   53    3-86    142-198 (258)

No 1  
>COG0165 ArgH Argininosuccinate lyase [Amino acid transport and metabolism]
Probab=95.18  E-value=0.0078  Score=50.43  Aligned_cols=55  Identities=33%  Similarity=0.443  Sum_probs=32.1

Q ss_pred             CCCCCCCCCcccccccCchhHHHHHHHHhhcCcccccccccccchhhhhcCccchhccc
Q psy17730          1 MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEISASSVHDKDMQECKQPRATAIDN   59 (101)
Q Consensus         1 mpqkknpdiprtlseakpesclrqrlfnmlthpmeisassvhdkdmqeckqprataidn   59 (101)
                      ||||||||...-+. +|--. .--.|.-|||=.+-  .-.-..|||||=|.|--.+++.
T Consensus       281 MPQKKNPD~~ELiR-gk~gr-v~G~l~~ll~~~k~--lPlaYnrDlQedke~lfds~~t  335 (459)
T COG0165         281 MPQKKNPDVLELIR-GKAGR-VIGALTGLLTIMKG--LPLAYNRDLQEDKEPLFDSVDT  335 (459)
T ss_pred             CCCCCCCcHHHHHH-Hhhhh-hHHHHHHHHHHHhc--CcccccHHHHhhhHHHHHHHHH
Confidence            99999999875432 22111 11123334433222  1234679999999987766653


No 2  
>PRK06389 argininosuccinate lyase; Provisional
Probab=94.06  E-value=0.0095  Score=48.73  Aligned_cols=55  Identities=25%  Similarity=0.323  Sum_probs=31.8

Q ss_pred             CCCCCCCCCcccccccCchhHHHHHHHHhhcCcccccccccccchhhhhcCccchhccc
Q psy17730          1 MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEISASSVHDKDMQECKQPRATAIDN   59 (101)
Q Consensus         1 mpqkknpdiprtlseakpesclrqrlfnmlthpmeisassvhdkdmqeckqprataidn   59 (101)
                      ||||+||+++..+.-.--.  +...+..+++  ++....+-+.+|+||-|.+-..++|.
T Consensus       273 MPqKrNP~~~E~ir~~a~~--v~g~~~~~~~--~~~n~~~~y~~D~q~~~~~~~~~~~~  327 (434)
T PRK06389        273 MPNKRNPDYLELFQGIAAE--SISVLSFIAQ--SELNKTTGYHRDFQIVKDSTISFINN  327 (434)
T ss_pred             CCCCcCcHHHHHHHHHHHH--HHHHHHHHHH--HHcCCcchhhHHHHHHHHHHHHHHHH
Confidence            9999999998654321100  1122222221  12233356788999999887777665


No 3  
>KOG1316|consensus
Probab=90.53  E-value=0.081  Score=45.29  Aligned_cols=57  Identities=39%  Similarity=0.461  Sum_probs=33.9

Q ss_pred             CCCCCCCCCcccccccCchhHHHHHHHHhhc-Cccccc-ccccccchhhhhcCccchhcccceee
Q psy17730          1 MPQKKNPDIPRTLSEAKPESCLRQRLFNMLT-HPMEIS-ASSVHDKDMQECKQPRATAIDNRLHV   63 (101)
Q Consensus         1 mpqkknpdiprtlseakpesclrqrlfnmlt-hpmeis-assvhdkdmqeckqprataidnrlhv   63 (101)
                      ||||||||--.-+ ..|.     -|.|.-|+ --|.+- -.|-.+||+||=|+|--...+.-.++
T Consensus       284 MPQKKNpDslELl-Rgks-----grV~gdl~g~lmt~KG~PstYnkDlQeDKep~Fds~~tv~~~  342 (464)
T KOG1316|consen  284 MPQKKNPDSLELL-RGKS-----GRVFGDLTGLLMTLKGLPSTYNKDLQEDKEPLFDSSKTVSDS  342 (464)
T ss_pred             CCCCCCCCHHHHh-cccc-----ceehhhhHHHHHHhcCCccccccchhhhhhHHHhhHHHHHHH
Confidence            9999999943322 1222     24453333 223222 34678999999999976665544443


No 4  
>PRK00485 fumC fumarate hydratase; Reviewed
Probab=87.38  E-value=0.18  Score=40.51  Aligned_cols=14  Identities=43%  Similarity=0.603  Sum_probs=11.8

Q ss_pred             CCCCCCCCCccccc
Q psy17730          1 MPQKKNPDIPRTLS   14 (101)
Q Consensus         1 mpqkknpdiprtls   14 (101)
                      ||||+||+++..+.
T Consensus       321 MPqKrNP~~~E~ir  334 (464)
T PRK00485        321 MPGKVNPTQCEALT  334 (464)
T ss_pred             CCCCCCcHHHHHHH
Confidence            99999999986653


No 5  
>PLN02646 argininosuccinate lyase
Probab=86.87  E-value=0.2  Score=40.55  Aligned_cols=48  Identities=29%  Similarity=0.456  Sum_probs=26.5

Q ss_pred             CCCCCCCCCcccccccCchhHHHHHHHHhhcCccccc-----ccccccchhhhhcCccchhc
Q psy17730          1 MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEIS-----ASSVHDKDMQECKQPRATAI   57 (101)
Q Consensus         1 mpqkknpdiprtlseakpesclrqrlfnmlthpmeis-----assvhdkdmqeckqpratai   57 (101)
                      ||||+||+++..+         |..-.-...+.+.+.     ...-|.+|+|+-+.+-..++
T Consensus       294 MPqKrNP~~~E~i---------r~~a~~v~G~~~~~~~~~~~~p~~~~rD~q~~~~~l~~~~  346 (474)
T PLN02646        294 MPQKKNPDPMELV---------RGKSARVIGDLVTVLALCKGLPTAYNRDLQEDKEPLFDSV  346 (474)
T ss_pred             CCCCCCCHHHHHH---------HHHHHHHHhhhHHHHHHhcCCchHhhcchhhHHHHHHHHH
Confidence            9999999987544         222111111111111     12358899998877644443


No 6  
>cd01595 Adenylsuccinate_lyase_like Adenylsuccinate lyase (ASL)_like. This group contains ASL, prokaryotic-type 3-carboxy-cis,cis-muconate cycloisomerase (pCMLE), and related proteins. These proteins are members of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two steps in the de novo purine biosynthesis: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and; the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP). pCMLE catalyzes the cyclization of 3-carboxy-cis,cis-muconate (3CM) to 4-carboxy-muconolactone, in the beta-ketoadipate pathway. ASL deficiency has been linked t
Probab=86.68  E-value=0.2  Score=38.53  Aligned_cols=13  Identities=38%  Similarity=0.690  Sum_probs=11.1

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+++..+
T Consensus       263 MPqK~NP~~~E~i  275 (381)
T cd01595         263 MPHKRNPIDSENI  275 (381)
T ss_pred             CCCcCCcHHHHHH
Confidence            9999999987654


No 7  
>TIGR02426 protocat_pcaB 3-carboxy-cis,cis-muconate cycloisomerase. Members of this family are 3-carboxy-cis,cis-muconate cycloisomerase, the enzyme the catalyzes the second step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate.
Probab=86.56  E-value=0.22  Score=38.23  Aligned_cols=13  Identities=46%  Similarity=0.652  Sum_probs=11.1

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+.+..+
T Consensus       269 MPqK~NP~~~E~i  281 (338)
T TIGR02426       269 MPHKRNPVGAALL  281 (338)
T ss_pred             CCCCCCcHHHHHH
Confidence            9999999987654


No 8  
>PRK06390 adenylosuccinate lyase; Provisional
Probab=86.37  E-value=0.19  Score=39.97  Aligned_cols=43  Identities=23%  Similarity=0.361  Sum_probs=26.2

Q ss_pred             CCCCCCCCCcccccccCchhHHHHHHHHhhcCcccccccccccchhhhhc
Q psy17730          1 MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEISASSVHDKDMQECK   50 (101)
Q Consensus         1 mpqkknpdiprtlseakpesclrqrlfnmlthpmeisassvhdkdmqeck   50 (101)
                      ||||+||+++..+..     .  -++...+....-..+.+.|..|+++-+
T Consensus       277 MP~KrNPv~~E~i~~-----~--a~~~~~l~~~~~~~~~~~~erd~~~~~  319 (451)
T PRK06390        277 MPSKVNPINSENVVS-----L--SRFIRSLIIPEYEAGVTWHERDLTNSA  319 (451)
T ss_pred             CCCCCCcHHHHHHHH-----H--HHHHHHhHHHHHHhhhHhhccCCcchH
Confidence            999999998875531     1  133333332444455556888888765


No 9  
>PRK12425 fumarate hydratase; Provisional
Probab=85.77  E-value=0.26  Score=40.00  Aligned_cols=13  Identities=46%  Similarity=0.611  Sum_probs=10.9

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+++..+
T Consensus       319 MPqK~NP~~~E~i  331 (464)
T PRK12425        319 MPGKVNPTQCEAL  331 (464)
T ss_pred             CCCCcCCHHHHHH
Confidence            9999999997543


No 10 
>cd01334 Lyase_I Lyase class I family; a group of proteins which catalyze similar beta-elimination reactions. The Lyase class I family contains class II fumarase, aspartase, adenylosuccinate lyase (ASL), argininosuccinate lyase (ASAL), prokaryotic-type 3-carboxy-cis,cis-muconate cycloisomerase (pCMLE), and related proteins. It belongs to the Lyase_I superfamily. Proteins of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits.
Probab=84.63  E-value=0.34  Score=36.18  Aligned_cols=13  Identities=54%  Similarity=0.698  Sum_probs=10.7

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+...-+
T Consensus       253 MP~KrNP~~~E~i  265 (325)
T cd01334         253 MPQKVNPVILELV  265 (325)
T ss_pred             CCCCCCCHHHHHH
Confidence            9999999986544


No 11 
>cd01360 Adenylsuccinate_lyase_1 Adenylsuccinate lyase (ASL)_subgroup 1. This subgroup contains bacterial and archeal proteins similar to ASL, a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two steps in the de novo purine biosynthesis: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and, the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP).
Probab=84.28  E-value=0.34  Score=37.70  Aligned_cols=13  Identities=38%  Similarity=0.859  Sum_probs=11.3

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+.+..+
T Consensus       262 MPqKrNP~~~E~i  274 (387)
T cd01360         262 MPHKRNPILSENI  274 (387)
T ss_pred             CCCCCCCHHHHHH
Confidence            9999999987655


No 12 
>cd01597 pCLME prokaryotic 3-carboxy-cis,cis-muconate cycloisomerase (CMLE)_like. This subgroup contains pCLME and related proteins, and belongs to the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. CMLE catalyzes the cyclization of 3-carboxy-cis,cis-muconate (3CM) to 4-carboxy-muconolactone in the beta-ketoadipate pathway. This pathway is responsible for the catabolism of a variety of aromatic compounds into intermediates of the citric cycle in prokaryotic and eukaryotic micro-organisms.
Probab=84.07  E-value=0.31  Score=38.16  Aligned_cols=13  Identities=38%  Similarity=0.559  Sum_probs=10.8

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+.+..+
T Consensus       272 MPqK~NP~~~E~i  284 (437)
T cd01597         272 MPHKRNPVGCELI  284 (437)
T ss_pred             CCCCcCcHHHHHH
Confidence            9999999986544


No 13 
>PRK08540 adenylosuccinate lyase; Reviewed
Probab=83.94  E-value=0.33  Score=38.38  Aligned_cols=13  Identities=38%  Similarity=0.759  Sum_probs=11.3

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+++..+
T Consensus       277 MP~K~NP~~~E~i  289 (449)
T PRK08540        277 MPHKRNPITSEQI  289 (449)
T ss_pred             CCCCcCcHHHHHH
Confidence            9999999988654


No 14 
>PRK06705 argininosuccinate lyase; Provisional
Probab=83.68  E-value=0.29  Score=40.00  Aligned_cols=14  Identities=43%  Similarity=0.555  Sum_probs=11.6

Q ss_pred             CCCCCCCCCccccc
Q psy17730          1 MPQKKNPDIPRTLS   14 (101)
Q Consensus         1 mpqkknpdiprtls   14 (101)
                      ||||+||+.+..+.
T Consensus       287 MPqKrNP~~~E~ir  300 (502)
T PRK06705        287 MPQKRNPVSIEHAR  300 (502)
T ss_pred             CCCCcCCHHHHHHH
Confidence            99999999876553


No 15 
>PRK08937 adenylosuccinate lyase; Provisional
Probab=82.73  E-value=0.35  Score=33.59  Aligned_cols=13  Identities=38%  Similarity=0.654  Sum_probs=10.8

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+.+..+
T Consensus        62 MP~K~NP~~~E~i   74 (216)
T PRK08937         62 MPHKRNPIGSERI   74 (216)
T ss_pred             CCCccCcHHHHHH
Confidence            9999999987444


No 16 
>TIGR00928 purB adenylosuccinate lyase. This family consists of adenylosuccinate lyase, the enzyme that catalyzes step 8 in the purine biosynthesis pathway for de novo synthesis of IMP and also the final reaction in the two-step sequence from IMP to AMP.
Probab=82.64  E-value=0.36  Score=37.88  Aligned_cols=13  Identities=38%  Similarity=0.557  Sum_probs=11.1

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+++..+
T Consensus       271 MP~K~NP~~~E~i  283 (435)
T TIGR00928       271 MPHKRNPIDFENV  283 (435)
T ss_pred             CCcCcCcHHHHHH
Confidence            9999999987654


No 17 
>PRK04833 argininosuccinate lyase; Provisional
Probab=82.42  E-value=0.44  Score=38.15  Aligned_cols=13  Identities=62%  Similarity=0.920  Sum_probs=10.7

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+....+
T Consensus       280 MPqKrNP~~~E~i  292 (455)
T PRK04833        280 MPQKKNPDALELI  292 (455)
T ss_pred             CCCCCCChHHHHH
Confidence            9999999986543


No 18 
>TIGR00838 argH argininosuccinate lyase. This model describes argininosuccinate lyase, but may include examples of avian delta crystallins, in which argininosuccinate lyase activity may or may not be present and the biological role is to provide the optically clear cellular protein of the eye lens.
Probab=82.35  E-value=0.38  Score=38.11  Aligned_cols=13  Identities=62%  Similarity=1.086  Sum_probs=10.9

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+++..+
T Consensus       278 MP~K~NP~~~E~i  290 (455)
T TIGR00838       278 MPQKKNPDVAELI  290 (455)
T ss_pred             CCCCcCChHHHHH
Confidence            9999999987543


No 19 
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional
Probab=82.25  E-value=0.41  Score=39.23  Aligned_cols=13  Identities=62%  Similarity=0.920  Sum_probs=11.1

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+++..+
T Consensus       280 MPqK~NP~~~E~i  292 (614)
T PRK12308        280 MPQKKNPDALELI  292 (614)
T ss_pred             CcCccCCcHHHHH
Confidence            9999999987654


No 20 
>PLN00134 fumarate hydratase; Provisional
Probab=81.58  E-value=0.49  Score=38.25  Aligned_cols=13  Identities=46%  Similarity=0.611  Sum_probs=11.4

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+++..+
T Consensus       313 MP~KrNPv~~E~i  325 (458)
T PLN00134        313 MPGKVNPTQCEAL  325 (458)
T ss_pred             CCCCcCCHHHHHH
Confidence            9999999998665


No 21 
>PRK02186 argininosuccinate lyase; Provisional
Probab=81.37  E-value=0.56  Score=39.88  Aligned_cols=13  Identities=46%  Similarity=0.690  Sum_probs=11.2

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+++..+
T Consensus       687 MPqKrNP~~~E~i  699 (887)
T PRK02186        687 LPQKKNPFLLEFV  699 (887)
T ss_pred             CCCCCCCcHHHHH
Confidence            9999999987654


No 22 
>PRK12273 aspA aspartate ammonia-lyase; Provisional
Probab=80.59  E-value=0.46  Score=38.44  Aligned_cols=13  Identities=54%  Similarity=0.889  Sum_probs=11.0

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+....+
T Consensus       323 MPqKrNP~~~E~i  335 (472)
T PRK12273        323 MPGKVNPVIPEVV  335 (472)
T ss_pred             CCcccCcHHHHHH
Confidence            9999999987554


No 23 
>cd01596 Aspartase_like aspartase (L-aspartate ammonia-lyase) and fumarase class II enzymes. This group contains aspartase (L-aspartate ammonia-lyase), fumarase class II enzymes, and related proteins. It is a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. Aspartase catalyzes the reversible deamination of aspartic acid. Fumarase catalyzes the reversible hydration/dehydration of fumarate to L-malate during the Krebs cycle.
Probab=80.55  E-value=0.54  Score=37.89  Aligned_cols=13  Identities=54%  Similarity=0.905  Sum_probs=10.9

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+.+..+
T Consensus       316 MPqKrNP~~~E~i  328 (450)
T cd01596         316 MPGKVNPVIPEAV  328 (450)
T ss_pred             CCCCCCCHHHHHH
Confidence            9999999987554


No 24 
>PRK13353 aspartate ammonia-lyase; Provisional
Probab=80.05  E-value=0.5  Score=38.24  Aligned_cols=13  Identities=46%  Similarity=0.851  Sum_probs=10.9

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+++..+
T Consensus       321 MPqKrNP~~~E~i  333 (473)
T PRK13353        321 MPGKVNPVMPEVV  333 (473)
T ss_pred             CCCCcCChHHHHH
Confidence            9999999987544


No 25 
>PRK14515 aspartate ammonia-lyase; Provisional
Probab=79.70  E-value=0.58  Score=38.38  Aligned_cols=13  Identities=46%  Similarity=0.876  Sum_probs=11.1

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+++..+
T Consensus       327 MP~KrNP~~~E~i  339 (479)
T PRK14515        327 MPGKVNPVMPEVI  339 (479)
T ss_pred             CCcccCchHHHHH
Confidence            9999999988644


No 26 
>TIGR00979 fumC_II fumarate hydratase, class II. Putative fumarases from several species (Mycobacterium tuberculosis, Streptomyces coelicolor, Pseudomonas aeruginosa) branch deeply, although within the same branch of a phylogenetic tree rooted by aspartate ammonia-lyase sequences, and score between the trusted and noise cutoffs.
Probab=79.37  E-value=0.5  Score=38.18  Aligned_cols=13  Identities=46%  Similarity=0.611  Sum_probs=11.2

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+++..+
T Consensus       318 MP~K~NP~~~E~i  330 (458)
T TIGR00979       318 MPGKVNPTQCEAL  330 (458)
T ss_pred             CCCCcCCHHHHHH
Confidence            9999999988654


No 27 
>cd01362 Fumarase_classII Class II fumarases. This subgroup contains Escherichia coli fumarase C, human mitochondrial fumarase, and related proteins.  It is a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. Fumarase catalyzes the reversible hydration/dehydration of fumarate to L-malate during the Krebs cycle.
Probab=79.29  E-value=0.61  Score=37.56  Aligned_cols=13  Identities=46%  Similarity=0.611  Sum_probs=11.1

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+.+..+
T Consensus       317 MPqKrNP~~~E~i  329 (455)
T cd01362         317 MPGKVNPTQCEAL  329 (455)
T ss_pred             CCCCCCcHHHHHH
Confidence            9999999987654


No 28 
>cd01357 Aspartase Aspartase. This subgroup contains Escherichia coli aspartase (L-aspartate ammonia-lyase), Bacillus aspartase and related proteins. It is a member of the Lyase class I family, which includes both aspartase (L-aspartate ammonia-lyase) and fumarase class II enzymes. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. Aspartase catalyzes the reversible deamination of aspartic acid.
Probab=78.29  E-value=0.65  Score=37.26  Aligned_cols=13  Identities=54%  Similarity=0.889  Sum_probs=10.9

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+....+
T Consensus       316 MPqKrNP~~~E~i  328 (450)
T cd01357         316 MPGKVNPVIPEVV  328 (450)
T ss_pred             CCCCcCcHHHHHH
Confidence            9999999987554


No 29 
>PRK00855 argininosuccinate lyase; Provisional
Probab=77.82  E-value=0.77  Score=36.52  Aligned_cols=13  Identities=62%  Similarity=1.086  Sum_probs=10.7

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||++...+
T Consensus       282 MPqK~NP~~~E~i  294 (459)
T PRK00855        282 MPQKKNPDVAELI  294 (459)
T ss_pred             CCCCCCCHHHHHH
Confidence            9999999987543


No 30 
>cd03302 Adenylsuccinate_lyase_2 Adenylsuccinate lyase (ASL)_subgroup 2. This subgroup contains mainly eukaryotic proteins similar to ASL, a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two steps in the de novo purine biosynthesis: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and, the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP). ASL deficiency has been linked to several pathologies including psychomotor retardation with autistic features, epilepsy and muscle wasting.
Probab=76.98  E-value=0.78  Score=36.48  Aligned_cols=13  Identities=38%  Similarity=0.544  Sum_probs=11.2

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+.+..+
T Consensus       276 MPhKrNPv~~E~i  288 (436)
T cd03302         276 MPYKRNPMRSERC  288 (436)
T ss_pred             CCCccCcHHHHHH
Confidence            9999999987655


No 31 
>cd01359 Argininosuccinate_lyase Argininosuccinate lyase (argininosuccinase, ASAL). This group contains ASAL and related proteins. It is a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASAL is a cytosolic enzyme which catalyzes the reversible breakdown of argininosuccinate to arginine and fumarate during arginine biosynthesis. In ureotelic species ASAL also catalyzes a reaction involved in the production of urea. Included in this group are the major soluble avian eye lens proteins from duck, delta 1 and delta 2 crystallin. Of these two isoforms only delta 2 has retained ASAL activity. These crystallins may have evolved by, gene recruitment of ASAL followed by gene duplication.
Probab=76.72  E-value=0.98  Score=35.30  Aligned_cols=13  Identities=62%  Similarity=1.020  Sum_probs=10.9

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||..+..+
T Consensus       258 MP~KrNP~~~E~i  270 (435)
T cd01359         258 MPQKKNPDVLELI  270 (435)
T ss_pred             CCCCCCCcHHHHH
Confidence            9999999987544


No 32 
>PRK09053 3-carboxy-cis,cis-muconate cycloisomerase; Provisional
Probab=75.51  E-value=0.86  Score=36.19  Aligned_cols=13  Identities=38%  Similarity=0.557  Sum_probs=11.0

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||.++..+
T Consensus       281 MP~KrNPv~~E~i  293 (452)
T PRK09053        281 MPHKRNPVGCAAV  293 (452)
T ss_pred             CCCCCCchHHHHH
Confidence            9999999987554


No 33 
>TIGR00839 aspA aspartate ammonia-lyase. Fumarate hydratase scores as high as 570 bits against this model.
Probab=75.22  E-value=0.7  Score=37.64  Aligned_cols=13  Identities=46%  Similarity=0.887  Sum_probs=11.1

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+.+..+
T Consensus       319 MPqKrNP~~~E~i  331 (468)
T TIGR00839       319 MPAKVNPVVPEVV  331 (468)
T ss_pred             CCCCcCcHHHHHH
Confidence            9999999987654


No 34 
>PRK07492 adenylosuccinate lyase; Provisional
Probab=73.90  E-value=1.2  Score=35.68  Aligned_cols=13  Identities=46%  Similarity=0.904  Sum_probs=10.8

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+....+
T Consensus       268 MPhKrNP~~~E~i  280 (435)
T PRK07492        268 MPHKRNPVLTENL  280 (435)
T ss_pred             CCCCCCcHHHHHH
Confidence            9999999987544


No 35 
>PRK08470 adenylosuccinate lyase; Provisional
Probab=73.47  E-value=1.3  Score=35.32  Aligned_cols=13  Identities=38%  Similarity=0.882  Sum_probs=10.7

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||+....+
T Consensus       265 MPhKrNPv~~E~i  277 (442)
T PRK08470        265 MPHKRNPVLSENI  277 (442)
T ss_pred             CCCCcCcHHHHHH
Confidence            9999999976544


No 36 
>PRK05975 3-carboxy-cis,cis-muconate cycloisomerase; Provisional
Probab=73.26  E-value=1.1  Score=34.80  Aligned_cols=13  Identities=54%  Similarity=0.838  Sum_probs=11.1

Q ss_pred             CCCCCCCCCcccc
Q psy17730          1 MPQKKNPDIPRTL   13 (101)
Q Consensus         1 mpqkknpdiprtl   13 (101)
                      ||||+||..+..+
T Consensus       276 MPhKrNPv~~E~i  288 (351)
T PRK05975        276 MPHKQNPVAAETL  288 (351)
T ss_pred             CCCCcCcHHHHHH
Confidence            9999999987655


No 37 
>PRK07380 adenylosuccinate lyase; Provisional
Probab=72.84  E-value=1.3  Score=35.48  Aligned_cols=12  Identities=42%  Similarity=0.689  Sum_probs=10.3

Q ss_pred             CCCCCCCCCccc
Q psy17730          1 MPQKKNPDIPRT   12 (101)
Q Consensus         1 mpqkknpdiprt   12 (101)
                      ||||+||+....
T Consensus       265 MPhKrNP~~~E~  276 (431)
T PRK07380        265 MPHKRNPIRSER  276 (431)
T ss_pred             CCCCCCCHHHHH
Confidence            999999998654


No 38 
>PLN02848 adenylosuccinate lyase
Probab=63.66  E-value=2.6  Score=34.41  Aligned_cols=12  Identities=42%  Similarity=0.432  Sum_probs=9.9

Q ss_pred             CCCCCCCCCccc
Q psy17730          1 MPQKKNPDIPRT   12 (101)
Q Consensus         1 mpqkknpdiprt   12 (101)
                      ||||+||++...
T Consensus       301 MP~KrNPv~~E~  312 (458)
T PLN02848        301 MPHKVNPIDFEN  312 (458)
T ss_pred             CCCCcCcHHHHH
Confidence            999999987543


No 39 
>cd01598 PurB PurB_like adenylosuccinases (adenylsuccinate lyase, ASL). This subgroup contains EcASL, the product of the purB gene in Escherichia coli, and related proteins. It is a member of the Lyase class I family of the Lyase_I superfamily. Members of the Lyase class I family function as homotetramers to catalyze similar beta-elimination reactions in which a Calpha-N or Calpha-O bond is cleaved with the subsequent release of fumarate as one of the products. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two non-sequential steps in the de novo purine biosynthesis pathway: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and; the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP).
Probab=62.28  E-value=3.2  Score=33.53  Aligned_cols=12  Identities=42%  Similarity=0.432  Sum_probs=9.8

Q ss_pred             CCCCCCCCCccc
Q psy17730          1 MPQKKNPDIPRT   12 (101)
Q Consensus         1 mpqkknpdiprt   12 (101)
                      ||||+||+....
T Consensus       276 MPhKrNPv~~E~  287 (425)
T cd01598         276 MPHKVNPIDFEN  287 (425)
T ss_pred             CCCCcCchHHHH
Confidence            999999987543


No 40 
>PRK09285 adenylosuccinate lyase; Provisional
Probab=61.17  E-value=3.6  Score=33.41  Aligned_cols=11  Identities=45%  Similarity=0.456  Sum_probs=9.3

Q ss_pred             CCCCCCCCCcc
Q psy17730          1 MPQKKNPDIPR   11 (101)
Q Consensus         1 mpqkknpdipr   11 (101)
                      ||||+||....
T Consensus       298 MPhKrNPv~~E  308 (456)
T PRK09285        298 MPHKVNPIDFE  308 (456)
T ss_pred             CCCCcCchHHH
Confidence            99999998743


No 41 
>cd01594 Lyase_I_like Lyase class I_like superfamily: contains the lyase class I family, histidine ammonia-lyase and phenylalanine ammonia-lyase, which catalyze similar beta-elimination reactions. Lyase class I_like superfamily of enzymes that catalyze beta-elimination reactions and are active as homotetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. This superfamily contains the lyase class I family, histidine ammonia-lyase and phenylalanine ammonia-lyase. The lyase class I family comprises proteins similar to class II fumarase, aspartase, adenylosuccinate lyase, argininosuccinate lyase, and 3-carboxy-cis, cis-muconate lactonizing enzyme which, for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. Histidine or phenylalanine ammonia-lyase catalyze a beta-elimination of ammonia from histidine and phenylalanine, respective
Probab=57.50  E-value=2.5  Score=28.64  Aligned_cols=15  Identities=40%  Similarity=0.534  Sum_probs=12.2

Q ss_pred             CCCCCCCCCcccccc
Q psy17730          1 MPQKKNPDIPRTLSE   15 (101)
Q Consensus         1 mpqkknpdiprtlse   15 (101)
                      ||||+||.....+.+
T Consensus       168 mp~k~Np~~~e~~~~  182 (231)
T cd01594         168 MPQKVNPVAAELVRG  182 (231)
T ss_pred             CCCCCCCHHHHHHHH
Confidence            899999998766654


No 42 
>PF00403 HMA:  Heavy-metal-associated domain;  InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures.  These proteins provide an important focus for research, some being involved in bacterial resistance to toxic metals, such as lead and cadmium, while others are involved in inherited human syndromes, such as Wilson's and Menke's diseases [].  A conserved domain has been found in a number of these heavy metal transport or detoxification proteins []. The domain, which has been termed Heavy-Metal-Associated (HMA), contains two conserved cysteines that are probably involved in metal binding.  Structure solution of the fourth HMA domain of the Menke's copper transporting ATPase shows a well-defined structure comprising a four-stranded antiparallel beta-sheet and two alpha helices packed in an alpha-beta sandwich fold []. This fold is common to other domains and is classified as "ferredoxin-like".; GO: 0046872 metal ion binding, 0030001 metal ion transport; PDB: 2VOY_A 1P6T_A 1KQK_A 2RML_A 1JWW_A 3K7R_F 1FES_A 1CC8_A 1FD8_A 2GGP_A ....
Probab=48.87  E-value=7.9  Score=21.67  Aligned_cols=13  Identities=38%  Similarity=1.045  Sum_probs=10.8

Q ss_pred             hhcccchhhhhHH
Q psy17730         82 VRGLACTSCAAEL   94 (101)
Q Consensus        82 vrglactscaael   94 (101)
                      |.|+.|.+|+..+
T Consensus         4 v~~m~C~~C~~~v   16 (62)
T PF00403_consen    4 VPGMTCEGCAKKV   16 (62)
T ss_dssp             EESTTSHHHHHHH
T ss_pred             ECCcccHHHHHHH
Confidence            6799999999754


No 43 
>TIGR00003 copper ion binding protein. This model describes an apparently copper-specific subfamily of the metal-binding domain HMA (Pfam family pfam00403). Closely related sequences outside this model include mercury resistance proteins and repeated domains of eukaryotic eukaryotic copper transport proteins. Members of this family are strictly prokaryotic. The model identifies both small proteins consisting of just this domain and N-terminal regions of cation (probably copper) transporting ATPases.
Probab=32.91  E-value=22  Score=16.53  Aligned_cols=14  Identities=21%  Similarity=0.769  Sum_probs=10.5

Q ss_pred             hhhcccchhhhhHH
Q psy17730         81 SVRGLACTSCAAEL   94 (101)
Q Consensus        81 svrglactscaael   94 (101)
                      .+.|+.|.+|+..+
T Consensus         7 ~v~~~~~~~c~~~~   20 (68)
T TIGR00003         7 QVMSMTCQHCVDKI   20 (68)
T ss_pred             EECCeEcHHHHHHH
Confidence            36788999997654


No 44 
>PF13931 Microtub_bind:  Kinesin-associated microtubule-binding
Probab=32.81  E-value=42  Score=24.53  Aligned_cols=27  Identities=41%  Similarity=0.634  Sum_probs=24.7

Q ss_pred             CCCCCCCCcccccccCchhHHHHHHHH
Q psy17730          2 PQKKNPDIPRTLSEAKPESCLRQRLFN   28 (101)
Q Consensus         2 pqkknpdiprtlseakpesclrqrlfn   28 (101)
                      ||++.-..|++|..-.|...|.+||-.
T Consensus        12 P~rk~y~YP~~L~~T~ph~~ll~~~r~   38 (143)
T PF13931_consen   12 PQRKEYQYPRTLPRTEPHERLLRRLRE   38 (143)
T ss_pred             CCcccccCCCccCCCCcHHHHHHHHHh
Confidence            899999999999999999999988763


No 45 
>COG4187 RocB Arginine degradation protein (predicted deacylase) [Amino acid transport and metabolism]
Probab=31.15  E-value=9.5  Score=33.64  Aligned_cols=40  Identities=35%  Similarity=0.586  Sum_probs=28.2

Q ss_pred             CchhHHHHH----------------HHHhhcCcccccccccccchhhhhcCccchhcc
Q psy17730         17 KPESCLRQR----------------LFNMLTHPMEISASSVHDKDMQECKQPRATAID   58 (101)
Q Consensus        17 kpesclrqr----------------lfnmlthpmeisassvhdkdmqeckqprataid   58 (101)
                      -|-+||+|+                .||.|+|-+  +|+.+||+=..+-++--..+|+
T Consensus       276 ~PPs~L~qkDlKe~Y~VqTp~~a~~~fN~l~h~~--ta~~~~d~l~~~a~~A~~e~i~  331 (553)
T COG4187         276 PPPSCLEQKDLKESYNVQTPERAWLYFNWLYHSR--TAKELFDRLKEEAETAAEEAIE  331 (553)
T ss_pred             CCcHhhhhhhhhhhccccCcchhhhhheehhhcC--CHHHHHHHHHHHHHHHHHHHHH
Confidence            478999997                699999865  6778888766555544434443


No 46 
>PF09016 Pas_Saposin:  Pas factor saposin fold;  InterPro: IPR015106 Members of this entry adopt a compact structure comprising five alpha helices. Charged and polar residues are exposed mostly on the surface, while most of the hydrophobic residues are buried inside the hydrophobic core of the helical bundle. The precise function of this domain is unknown, but it is has been shown to induce secretion of periplasmic proteins, especially collagenase []. ; PDB: 2B8I_A.
Probab=28.93  E-value=33  Score=23.62  Aligned_cols=23  Identities=35%  Similarity=0.733  Sum_probs=15.9

Q ss_pred             ccccCchhH--HHHHHHHhhcCccc
Q psy17730         13 LSEAKPESC--LRQRLFNMLTHPME   35 (101)
Q Consensus        13 lseakpesc--lrqrlfnmlthpme   35 (101)
                      |..+.||.|  .||+||+-|.-|.+
T Consensus        12 LA~~ePeqhA~IRQ~LYeqLdLpFd   36 (76)
T PF09016_consen   12 LANQEPEQHAQIRQNLYEQLDLPFD   36 (76)
T ss_dssp             HHHS-GGGHHHHHHHHHHHH---HH
T ss_pred             HHccChHHHHHHHHHHHHHcCCcHH
Confidence            567889988  69999999988875


No 47 
>PF02945 Endonuclease_7:  Recombination endonuclease VII;  InterPro: IPR004211 This family of proteins which includes Bacteriophage T4 endonuclease VII, Mycobacteriophage D29 gene 59, and other as yet uncharacterised proteins. The T4 endonuclease VII (Endo VII) recognises a broad spectrum of DNA substrates ranging from branched DNAs to single base mismatches. The structure of this enzyme has been resolved and it was found that the monomers form an elongated, intertwined molecular dimer that exibits extreme domain swapping. Two pairs of antiparallel helices which form a novel 'four-helix cross' motif are the major dimerisation elements [].; PDB: 3GOX_A 3FC3_A 1EN7_B 1E7L_B 2QNF_A 2QNC_A 1E7D_A.
Probab=28.72  E-value=24  Score=23.10  Aligned_cols=15  Identities=47%  Similarity=0.944  Sum_probs=12.0

Q ss_pred             hhhhhcccchhhhhH
Q psy17730         79 CNSVRGLACTSCAAE   93 (101)
Q Consensus        79 cnsvrglactscaae   93 (101)
                      +-.|||+.|.+|-.-
T Consensus        47 tG~vRGlLC~~CN~~   61 (81)
T PF02945_consen   47 TGRVRGLLCRSCNTA   61 (81)
T ss_dssp             TTBEEEEEEHHHHHH
T ss_pred             CCCchhhhhhHHhhh
Confidence            445999999999763


No 48 
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism]
Probab=28.61  E-value=25  Score=21.30  Aligned_cols=15  Identities=27%  Similarity=0.756  Sum_probs=12.2

Q ss_pred             hhhhcccchhhhhHH
Q psy17730         80 NSVRGLACTSCAAEL   94 (101)
Q Consensus        80 nsvrglactscaael   94 (101)
                      ..+.|+.|..|+...
T Consensus         6 l~v~~MtC~~C~~~V   20 (71)
T COG2608           6 LKVEGMTCGHCVKTV   20 (71)
T ss_pred             EEECCcCcHHHHHHH
Confidence            357899999999864


No 49 
>PF14049 Dppa2_A:  Dppa2/4 conserved region in higher vertebrates
Probab=25.05  E-value=23  Score=24.72  Aligned_cols=24  Identities=46%  Similarity=0.699  Sum_probs=18.8

Q ss_pred             CCCCcccccccCchhHHHHHHHHhhc
Q psy17730          6 NPDIPRTLSEAKPESCLRQRLFNMLT   31 (101)
Q Consensus         6 npdiprtlseakpesclrqrlfnmlt   31 (101)
                      +-|||.|..|||-.+|.|.  -.|.+
T Consensus         2 ~~~iP~T~kEAkl~~csrK--~K~~~   25 (86)
T PF14049_consen    2 QQDIPETPKEAKLQSCSRK--LKAVT   25 (86)
T ss_pred             CCcCCCCcHHHHhhhcccc--hhhhc
Confidence            4589999999999999765  34444


No 50 
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=23.11  E-value=96  Score=25.22  Aligned_cols=53  Identities=40%  Similarity=0.644  Sum_probs=34.8

Q ss_pred             CCCCCCCcccccccCchhHHHHHH---HHhhcCcccccccccccchhhhhcCccchhcccceeeeccCceEE-EeehHHH
Q psy17730          3 QKKNPDIPRTLSEAKPESCLRQRL---FNMLTHPMEISASSVHDKDMQECKQPRATAIDNRLHVMSRPSITI-IYVQKQL   78 (101)
Q Consensus         3 qkknpdiprtlseakpesclrqrl---fnmlthpmeisassvhdkdmqeckqprataidnrlhvmsrpsiti-iyvqkql   78 (101)
                      ...--|.|||+|-.     .+|||   -|..|||                          ||-.|..|.=-. +-||..|
T Consensus       142 ~~RiDD~PrtFSGG-----MqQRLQiARnLVt~P--------------------------rLvfMDEPTGGLDVSVQARL  190 (258)
T COG4107         142 LDRIDDLPRTFSGG-----MQQRLQIARNLVTRP--------------------------RLVFMDEPTGGLDVSVQARL  190 (258)
T ss_pred             cccccCcccccchH-----HHHHHHHHHHhccCC--------------------------ceEEecCCCCCcchhhHHHH
Confidence            34456788888854     67777   3777776                          455666664332 4578888


Q ss_pred             hhhhhccc
Q psy17730         79 CNSVRGLA   86 (101)
Q Consensus        79 cnsvrgla   86 (101)
                      -.-+|||.
T Consensus       191 LDllrgLv  198 (258)
T COG4107         191 LDLLRGLV  198 (258)
T ss_pred             HHHHHHHH
Confidence            88777764


Done!