Query psy17730
Match_columns 101
No_of_seqs 1 out of 3
Neff 1.0
Searched_HMMs 46136
Date Fri Aug 16 21:31:18 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy17730.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17730hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 COG0165 ArgH Argininosuccinate 95.2 0.0078 1.7E-07 50.4 1.0 55 1-59 281-335 (459)
2 PRK06389 argininosuccinate lya 94.1 0.0095 2.1E-07 48.7 -1.0 55 1-59 273-327 (434)
3 KOG1316|consensus 90.5 0.081 1.8E-06 45.3 0.1 57 1-63 284-342 (464)
4 PRK00485 fumC fumarate hydrata 87.4 0.18 3.8E-06 40.5 0.0 14 1-14 321-334 (464)
5 PLN02646 argininosuccinate lya 86.9 0.2 4.4E-06 40.6 0.1 48 1-57 294-346 (474)
6 cd01595 Adenylsuccinate_lyase_ 86.7 0.2 4.4E-06 38.5 0.0 13 1-13 263-275 (381)
7 TIGR02426 protocat_pcaB 3-carb 86.6 0.22 4.7E-06 38.2 0.1 13 1-13 269-281 (338)
8 PRK06390 adenylosuccinate lyas 86.4 0.19 4.1E-06 40.0 -0.3 43 1-50 277-319 (451)
9 PRK12425 fumarate hydratase; P 85.8 0.26 5.5E-06 40.0 0.2 13 1-13 319-331 (464)
10 cd01334 Lyase_I Lyase class I 84.6 0.34 7.5E-06 36.2 0.4 13 1-13 253-265 (325)
11 cd01360 Adenylsuccinate_lyase_ 84.3 0.34 7.4E-06 37.7 0.2 13 1-13 262-274 (387)
12 cd01597 pCLME prokaryotic 3-ca 84.1 0.31 6.8E-06 38.2 -0.1 13 1-13 272-284 (437)
13 PRK08540 adenylosuccinate lyas 83.9 0.33 7.2E-06 38.4 0.0 13 1-13 277-289 (449)
14 PRK06705 argininosuccinate lya 83.7 0.29 6.2E-06 40.0 -0.4 14 1-14 287-300 (502)
15 PRK08937 adenylosuccinate lyas 82.7 0.35 7.5E-06 33.6 -0.3 13 1-13 62-74 (216)
16 TIGR00928 purB adenylosuccinat 82.6 0.36 7.9E-06 37.9 -0.2 13 1-13 271-283 (435)
17 PRK04833 argininosuccinate lya 82.4 0.44 9.6E-06 38.2 0.2 13 1-13 280-292 (455)
18 TIGR00838 argH argininosuccina 82.3 0.38 8.2E-06 38.1 -0.2 13 1-13 278-290 (455)
19 PRK12308 bifunctional arginino 82.2 0.41 8.8E-06 39.2 -0.1 13 1-13 280-292 (614)
20 PLN00134 fumarate hydratase; P 81.6 0.49 1.1E-05 38.2 0.2 13 1-13 313-325 (458)
21 PRK02186 argininosuccinate lya 81.4 0.56 1.2E-05 39.9 0.5 13 1-13 687-699 (887)
22 PRK12273 aspA aspartate ammoni 80.6 0.46 9.9E-06 38.4 -0.3 13 1-13 323-335 (472)
23 cd01596 Aspartase_like asparta 80.5 0.54 1.2E-05 37.9 0.1 13 1-13 316-328 (450)
24 PRK13353 aspartate ammonia-lya 80.0 0.5 1.1E-05 38.2 -0.3 13 1-13 321-333 (473)
25 PRK14515 aspartate ammonia-lya 79.7 0.58 1.3E-05 38.4 0.0 13 1-13 327-339 (479)
26 TIGR00979 fumC_II fumarate hyd 79.4 0.5 1.1E-05 38.2 -0.4 13 1-13 318-330 (458)
27 cd01362 Fumarase_classII Class 79.3 0.61 1.3E-05 37.6 0.0 13 1-13 317-329 (455)
28 cd01357 Aspartase Aspartase. T 78.3 0.65 1.4E-05 37.3 -0.1 13 1-13 316-328 (450)
29 PRK00855 argininosuccinate lya 77.8 0.77 1.7E-05 36.5 0.2 13 1-13 282-294 (459)
30 cd03302 Adenylsuccinate_lyase_ 77.0 0.78 1.7E-05 36.5 0.0 13 1-13 276-288 (436)
31 cd01359 Argininosuccinate_lyas 76.7 0.98 2.1E-05 35.3 0.5 13 1-13 258-270 (435)
32 PRK09053 3-carboxy-cis,cis-muc 75.5 0.86 1.9E-05 36.2 -0.1 13 1-13 281-293 (452)
33 TIGR00839 aspA aspartate ammon 75.2 0.7 1.5E-05 37.6 -0.7 13 1-13 319-331 (468)
34 PRK07492 adenylosuccinate lyas 73.9 1.2 2.6E-05 35.7 0.4 13 1-13 268-280 (435)
35 PRK08470 adenylosuccinate lyas 73.5 1.3 2.9E-05 35.3 0.5 13 1-13 265-277 (442)
36 PRK05975 3-carboxy-cis,cis-muc 73.3 1.1 2.4E-05 34.8 0.0 13 1-13 276-288 (351)
37 PRK07380 adenylosuccinate lyas 72.8 1.3 2.8E-05 35.5 0.3 12 1-12 265-276 (431)
38 PLN02848 adenylosuccinate lyas 63.7 2.6 5.5E-05 34.4 0.3 12 1-12 301-312 (458)
39 cd01598 PurB PurB_like adenylo 62.3 3.2 7E-05 33.5 0.6 12 1-12 276-287 (425)
40 PRK09285 adenylosuccinate lyas 61.2 3.6 7.7E-05 33.4 0.7 11 1-11 298-308 (456)
41 cd01594 Lyase_I_like Lyase cla 57.5 2.5 5.4E-05 28.6 -0.7 15 1-15 168-182 (231)
42 PF00403 HMA: Heavy-metal-asso 48.9 7.9 0.00017 21.7 0.6 13 82-94 4-16 (62)
43 TIGR00003 copper ion binding p 32.9 22 0.00047 16.5 0.7 14 81-94 7-20 (68)
44 PF13931 Microtub_bind: Kinesi 32.8 42 0.00092 24.5 2.4 27 2-28 12-38 (143)
45 COG4187 RocB Arginine degradat 31.1 9.5 0.00021 33.6 -1.4 40 17-58 276-331 (553)
46 PF09016 Pas_Saposin: Pas fact 28.9 33 0.00072 23.6 1.2 23 13-35 12-36 (76)
47 PF02945 Endonuclease_7: Recom 28.7 24 0.00052 23.1 0.5 15 79-93 47-61 (81)
48 COG2608 CopZ Copper chaperone 28.6 25 0.00055 21.3 0.6 15 80-94 6-20 (71)
49 PF14049 Dppa2_A: Dppa2/4 cons 25.1 23 0.0005 24.7 -0.1 24 6-31 2-25 (86)
50 COG4107 PhnK ABC-type phosphon 23.1 96 0.0021 25.2 3.1 53 3-86 142-198 (258)
No 1
>COG0165 ArgH Argininosuccinate lyase [Amino acid transport and metabolism]
Probab=95.18 E-value=0.0078 Score=50.43 Aligned_cols=55 Identities=33% Similarity=0.443 Sum_probs=32.1
Q ss_pred CCCCCCCCCcccccccCchhHHHHHHHHhhcCcccccccccccchhhhhcCccchhccc
Q psy17730 1 MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEISASSVHDKDMQECKQPRATAIDN 59 (101)
Q Consensus 1 mpqkknpdiprtlseakpesclrqrlfnmlthpmeisassvhdkdmqeckqprataidn 59 (101)
||||||||...-+. +|--. .--.|.-|||=.+- .-.-..|||||=|.|--.+++.
T Consensus 281 MPQKKNPD~~ELiR-gk~gr-v~G~l~~ll~~~k~--lPlaYnrDlQedke~lfds~~t 335 (459)
T COG0165 281 MPQKKNPDVLELIR-GKAGR-VIGALTGLLTIMKG--LPLAYNRDLQEDKEPLFDSVDT 335 (459)
T ss_pred CCCCCCCcHHHHHH-Hhhhh-hHHHHHHHHHHHhc--CcccccHHHHhhhHHHHHHHHH
Confidence 99999999875432 22111 11123334433222 1234679999999987766653
No 2
>PRK06389 argininosuccinate lyase; Provisional
Probab=94.06 E-value=0.0095 Score=48.73 Aligned_cols=55 Identities=25% Similarity=0.323 Sum_probs=31.8
Q ss_pred CCCCCCCCCcccccccCchhHHHHHHHHhhcCcccccccccccchhhhhcCccchhccc
Q psy17730 1 MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEISASSVHDKDMQECKQPRATAIDN 59 (101)
Q Consensus 1 mpqkknpdiprtlseakpesclrqrlfnmlthpmeisassvhdkdmqeckqprataidn 59 (101)
||||+||+++..+.-.--. +...+..+++ ++....+-+.+|+||-|.+-..++|.
T Consensus 273 MPqKrNP~~~E~ir~~a~~--v~g~~~~~~~--~~~n~~~~y~~D~q~~~~~~~~~~~~ 327 (434)
T PRK06389 273 MPNKRNPDYLELFQGIAAE--SISVLSFIAQ--SELNKTTGYHRDFQIVKDSTISFINN 327 (434)
T ss_pred CCCCcCcHHHHHHHHHHHH--HHHHHHHHHH--HHcCCcchhhHHHHHHHHHHHHHHHH
Confidence 9999999998654321100 1122222221 12233356788999999887777665
No 3
>KOG1316|consensus
Probab=90.53 E-value=0.081 Score=45.29 Aligned_cols=57 Identities=39% Similarity=0.461 Sum_probs=33.9
Q ss_pred CCCCCCCCCcccccccCchhHHHHHHHHhhc-Cccccc-ccccccchhhhhcCccchhcccceee
Q psy17730 1 MPQKKNPDIPRTLSEAKPESCLRQRLFNMLT-HPMEIS-ASSVHDKDMQECKQPRATAIDNRLHV 63 (101)
Q Consensus 1 mpqkknpdiprtlseakpesclrqrlfnmlt-hpmeis-assvhdkdmqeckqprataidnrlhv 63 (101)
||||||||--.-+ ..|. -|.|.-|+ --|.+- -.|-.+||+||=|+|--...+.-.++
T Consensus 284 MPQKKNpDslELl-Rgks-----grV~gdl~g~lmt~KG~PstYnkDlQeDKep~Fds~~tv~~~ 342 (464)
T KOG1316|consen 284 MPQKKNPDSLELL-RGKS-----GRVFGDLTGLLMTLKGLPSTYNKDLQEDKEPLFDSSKTVSDS 342 (464)
T ss_pred CCCCCCCCHHHHh-cccc-----ceehhhhHHHHHHhcCCccccccchhhhhhHHHhhHHHHHHH
Confidence 9999999943322 1222 24453333 223222 34678999999999976665544443
No 4
>PRK00485 fumC fumarate hydratase; Reviewed
Probab=87.38 E-value=0.18 Score=40.51 Aligned_cols=14 Identities=43% Similarity=0.603 Sum_probs=11.8
Q ss_pred CCCCCCCCCccccc
Q psy17730 1 MPQKKNPDIPRTLS 14 (101)
Q Consensus 1 mpqkknpdiprtls 14 (101)
||||+||+++..+.
T Consensus 321 MPqKrNP~~~E~ir 334 (464)
T PRK00485 321 MPGKVNPTQCEALT 334 (464)
T ss_pred CCCCCCcHHHHHHH
Confidence 99999999986653
No 5
>PLN02646 argininosuccinate lyase
Probab=86.87 E-value=0.2 Score=40.55 Aligned_cols=48 Identities=29% Similarity=0.456 Sum_probs=26.5
Q ss_pred CCCCCCCCCcccccccCchhHHHHHHHHhhcCccccc-----ccccccchhhhhcCccchhc
Q psy17730 1 MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEIS-----ASSVHDKDMQECKQPRATAI 57 (101)
Q Consensus 1 mpqkknpdiprtlseakpesclrqrlfnmlthpmeis-----assvhdkdmqeckqpratai 57 (101)
||||+||+++..+ |..-.-...+.+.+. ...-|.+|+|+-+.+-..++
T Consensus 294 MPqKrNP~~~E~i---------r~~a~~v~G~~~~~~~~~~~~p~~~~rD~q~~~~~l~~~~ 346 (474)
T PLN02646 294 MPQKKNPDPMELV---------RGKSARVIGDLVTVLALCKGLPTAYNRDLQEDKEPLFDSV 346 (474)
T ss_pred CCCCCCCHHHHHH---------HHHHHHHHhhhHHHHHHhcCCchHhhcchhhHHHHHHHHH
Confidence 9999999987544 222111111111111 12358899998877644443
No 6
>cd01595 Adenylsuccinate_lyase_like Adenylsuccinate lyase (ASL)_like. This group contains ASL, prokaryotic-type 3-carboxy-cis,cis-muconate cycloisomerase (pCMLE), and related proteins. These proteins are members of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two steps in the de novo purine biosynthesis: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and; the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP). pCMLE catalyzes the cyclization of 3-carboxy-cis,cis-muconate (3CM) to 4-carboxy-muconolactone, in the beta-ketoadipate pathway. ASL deficiency has been linked t
Probab=86.68 E-value=0.2 Score=38.53 Aligned_cols=13 Identities=38% Similarity=0.690 Sum_probs=11.1
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+++..+
T Consensus 263 MPqK~NP~~~E~i 275 (381)
T cd01595 263 MPHKRNPIDSENI 275 (381)
T ss_pred CCCcCCcHHHHHH
Confidence 9999999987654
No 7
>TIGR02426 protocat_pcaB 3-carboxy-cis,cis-muconate cycloisomerase. Members of this family are 3-carboxy-cis,cis-muconate cycloisomerase, the enzyme the catalyzes the second step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate.
Probab=86.56 E-value=0.22 Score=38.23 Aligned_cols=13 Identities=46% Similarity=0.652 Sum_probs=11.1
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+.+..+
T Consensus 269 MPqK~NP~~~E~i 281 (338)
T TIGR02426 269 MPHKRNPVGAALL 281 (338)
T ss_pred CCCCCCcHHHHHH
Confidence 9999999987654
No 8
>PRK06390 adenylosuccinate lyase; Provisional
Probab=86.37 E-value=0.19 Score=39.97 Aligned_cols=43 Identities=23% Similarity=0.361 Sum_probs=26.2
Q ss_pred CCCCCCCCCcccccccCchhHHHHHHHHhhcCcccccccccccchhhhhc
Q psy17730 1 MPQKKNPDIPRTLSEAKPESCLRQRLFNMLTHPMEISASSVHDKDMQECK 50 (101)
Q Consensus 1 mpqkknpdiprtlseakpesclrqrlfnmlthpmeisassvhdkdmqeck 50 (101)
||||+||+++..+.. . -++...+....-..+.+.|..|+++-+
T Consensus 277 MP~KrNPv~~E~i~~-----~--a~~~~~l~~~~~~~~~~~~erd~~~~~ 319 (451)
T PRK06390 277 MPSKVNPINSENVVS-----L--SRFIRSLIIPEYEAGVTWHERDLTNSA 319 (451)
T ss_pred CCCCCCcHHHHHHHH-----H--HHHHHHhHHHHHHhhhHhhccCCcchH
Confidence 999999998875531 1 133333332444455556888888765
No 9
>PRK12425 fumarate hydratase; Provisional
Probab=85.77 E-value=0.26 Score=40.00 Aligned_cols=13 Identities=46% Similarity=0.611 Sum_probs=10.9
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+++..+
T Consensus 319 MPqK~NP~~~E~i 331 (464)
T PRK12425 319 MPGKVNPTQCEAL 331 (464)
T ss_pred CCCCcCCHHHHHH
Confidence 9999999997543
No 10
>cd01334 Lyase_I Lyase class I family; a group of proteins which catalyze similar beta-elimination reactions. The Lyase class I family contains class II fumarase, aspartase, adenylosuccinate lyase (ASL), argininosuccinate lyase (ASAL), prokaryotic-type 3-carboxy-cis,cis-muconate cycloisomerase (pCMLE), and related proteins. It belongs to the Lyase_I superfamily. Proteins of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits.
Probab=84.63 E-value=0.34 Score=36.18 Aligned_cols=13 Identities=54% Similarity=0.698 Sum_probs=10.7
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+...-+
T Consensus 253 MP~KrNP~~~E~i 265 (325)
T cd01334 253 MPQKVNPVILELV 265 (325)
T ss_pred CCCCCCCHHHHHH
Confidence 9999999986544
No 11
>cd01360 Adenylsuccinate_lyase_1 Adenylsuccinate lyase (ASL)_subgroup 1. This subgroup contains bacterial and archeal proteins similar to ASL, a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two steps in the de novo purine biosynthesis: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and, the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP).
Probab=84.28 E-value=0.34 Score=37.70 Aligned_cols=13 Identities=38% Similarity=0.859 Sum_probs=11.3
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+.+..+
T Consensus 262 MPqKrNP~~~E~i 274 (387)
T cd01360 262 MPHKRNPILSENI 274 (387)
T ss_pred CCCCCCCHHHHHH
Confidence 9999999987655
No 12
>cd01597 pCLME prokaryotic 3-carboxy-cis,cis-muconate cycloisomerase (CMLE)_like. This subgroup contains pCLME and related proteins, and belongs to the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. CMLE catalyzes the cyclization of 3-carboxy-cis,cis-muconate (3CM) to 4-carboxy-muconolactone in the beta-ketoadipate pathway. This pathway is responsible for the catabolism of a variety of aromatic compounds into intermediates of the citric cycle in prokaryotic and eukaryotic micro-organisms.
Probab=84.07 E-value=0.31 Score=38.16 Aligned_cols=13 Identities=38% Similarity=0.559 Sum_probs=10.8
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+.+..+
T Consensus 272 MPqK~NP~~~E~i 284 (437)
T cd01597 272 MPHKRNPVGCELI 284 (437)
T ss_pred CCCCcCcHHHHHH
Confidence 9999999986544
No 13
>PRK08540 adenylosuccinate lyase; Reviewed
Probab=83.94 E-value=0.33 Score=38.38 Aligned_cols=13 Identities=38% Similarity=0.759 Sum_probs=11.3
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+++..+
T Consensus 277 MP~K~NP~~~E~i 289 (449)
T PRK08540 277 MPHKRNPITSEQI 289 (449)
T ss_pred CCCCcCcHHHHHH
Confidence 9999999988654
No 14
>PRK06705 argininosuccinate lyase; Provisional
Probab=83.68 E-value=0.29 Score=40.00 Aligned_cols=14 Identities=43% Similarity=0.555 Sum_probs=11.6
Q ss_pred CCCCCCCCCccccc
Q psy17730 1 MPQKKNPDIPRTLS 14 (101)
Q Consensus 1 mpqkknpdiprtls 14 (101)
||||+||+.+..+.
T Consensus 287 MPqKrNP~~~E~ir 300 (502)
T PRK06705 287 MPQKRNPVSIEHAR 300 (502)
T ss_pred CCCCcCCHHHHHHH
Confidence 99999999876553
No 15
>PRK08937 adenylosuccinate lyase; Provisional
Probab=82.73 E-value=0.35 Score=33.59 Aligned_cols=13 Identities=38% Similarity=0.654 Sum_probs=10.8
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+.+..+
T Consensus 62 MP~K~NP~~~E~i 74 (216)
T PRK08937 62 MPHKRNPIGSERI 74 (216)
T ss_pred CCCccCcHHHHHH
Confidence 9999999987444
No 16
>TIGR00928 purB adenylosuccinate lyase. This family consists of adenylosuccinate lyase, the enzyme that catalyzes step 8 in the purine biosynthesis pathway for de novo synthesis of IMP and also the final reaction in the two-step sequence from IMP to AMP.
Probab=82.64 E-value=0.36 Score=37.88 Aligned_cols=13 Identities=38% Similarity=0.557 Sum_probs=11.1
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+++..+
T Consensus 271 MP~K~NP~~~E~i 283 (435)
T TIGR00928 271 MPHKRNPIDFENV 283 (435)
T ss_pred CCcCcCcHHHHHH
Confidence 9999999987654
No 17
>PRK04833 argininosuccinate lyase; Provisional
Probab=82.42 E-value=0.44 Score=38.15 Aligned_cols=13 Identities=62% Similarity=0.920 Sum_probs=10.7
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+....+
T Consensus 280 MPqKrNP~~~E~i 292 (455)
T PRK04833 280 MPQKKNPDALELI 292 (455)
T ss_pred CCCCCCChHHHHH
Confidence 9999999986543
No 18
>TIGR00838 argH argininosuccinate lyase. This model describes argininosuccinate lyase, but may include examples of avian delta crystallins, in which argininosuccinate lyase activity may or may not be present and the biological role is to provide the optically clear cellular protein of the eye lens.
Probab=82.35 E-value=0.38 Score=38.11 Aligned_cols=13 Identities=62% Similarity=1.086 Sum_probs=10.9
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+++..+
T Consensus 278 MP~K~NP~~~E~i 290 (455)
T TIGR00838 278 MPQKKNPDVAELI 290 (455)
T ss_pred CCCCcCChHHHHH
Confidence 9999999987543
No 19
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional
Probab=82.25 E-value=0.41 Score=39.23 Aligned_cols=13 Identities=62% Similarity=0.920 Sum_probs=11.1
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+++..+
T Consensus 280 MPqK~NP~~~E~i 292 (614)
T PRK12308 280 MPQKKNPDALELI 292 (614)
T ss_pred CcCccCCcHHHHH
Confidence 9999999987654
No 20
>PLN00134 fumarate hydratase; Provisional
Probab=81.58 E-value=0.49 Score=38.25 Aligned_cols=13 Identities=46% Similarity=0.611 Sum_probs=11.4
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+++..+
T Consensus 313 MP~KrNPv~~E~i 325 (458)
T PLN00134 313 MPGKVNPTQCEAL 325 (458)
T ss_pred CCCCcCCHHHHHH
Confidence 9999999998665
No 21
>PRK02186 argininosuccinate lyase; Provisional
Probab=81.37 E-value=0.56 Score=39.88 Aligned_cols=13 Identities=46% Similarity=0.690 Sum_probs=11.2
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+++..+
T Consensus 687 MPqKrNP~~~E~i 699 (887)
T PRK02186 687 LPQKKNPFLLEFV 699 (887)
T ss_pred CCCCCCCcHHHHH
Confidence 9999999987654
No 22
>PRK12273 aspA aspartate ammonia-lyase; Provisional
Probab=80.59 E-value=0.46 Score=38.44 Aligned_cols=13 Identities=54% Similarity=0.889 Sum_probs=11.0
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+....+
T Consensus 323 MPqKrNP~~~E~i 335 (472)
T PRK12273 323 MPGKVNPVIPEVV 335 (472)
T ss_pred CCcccCcHHHHHH
Confidence 9999999987554
No 23
>cd01596 Aspartase_like aspartase (L-aspartate ammonia-lyase) and fumarase class II enzymes. This group contains aspartase (L-aspartate ammonia-lyase), fumarase class II enzymes, and related proteins. It is a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. Aspartase catalyzes the reversible deamination of aspartic acid. Fumarase catalyzes the reversible hydration/dehydration of fumarate to L-malate during the Krebs cycle.
Probab=80.55 E-value=0.54 Score=37.89 Aligned_cols=13 Identities=54% Similarity=0.905 Sum_probs=10.9
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+.+..+
T Consensus 316 MPqKrNP~~~E~i 328 (450)
T cd01596 316 MPGKVNPVIPEAV 328 (450)
T ss_pred CCCCCCCHHHHHH
Confidence 9999999987554
No 24
>PRK13353 aspartate ammonia-lyase; Provisional
Probab=80.05 E-value=0.5 Score=38.24 Aligned_cols=13 Identities=46% Similarity=0.851 Sum_probs=10.9
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+++..+
T Consensus 321 MPqKrNP~~~E~i 333 (473)
T PRK13353 321 MPGKVNPVMPEVV 333 (473)
T ss_pred CCCCcCChHHHHH
Confidence 9999999987544
No 25
>PRK14515 aspartate ammonia-lyase; Provisional
Probab=79.70 E-value=0.58 Score=38.38 Aligned_cols=13 Identities=46% Similarity=0.876 Sum_probs=11.1
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+++..+
T Consensus 327 MP~KrNP~~~E~i 339 (479)
T PRK14515 327 MPGKVNPVMPEVI 339 (479)
T ss_pred CCcccCchHHHHH
Confidence 9999999988644
No 26
>TIGR00979 fumC_II fumarate hydratase, class II. Putative fumarases from several species (Mycobacterium tuberculosis, Streptomyces coelicolor, Pseudomonas aeruginosa) branch deeply, although within the same branch of a phylogenetic tree rooted by aspartate ammonia-lyase sequences, and score between the trusted and noise cutoffs.
Probab=79.37 E-value=0.5 Score=38.18 Aligned_cols=13 Identities=46% Similarity=0.611 Sum_probs=11.2
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+++..+
T Consensus 318 MP~K~NP~~~E~i 330 (458)
T TIGR00979 318 MPGKVNPTQCEAL 330 (458)
T ss_pred CCCCcCCHHHHHH
Confidence 9999999988654
No 27
>cd01362 Fumarase_classII Class II fumarases. This subgroup contains Escherichia coli fumarase C, human mitochondrial fumarase, and related proteins. It is a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. Fumarase catalyzes the reversible hydration/dehydration of fumarate to L-malate during the Krebs cycle.
Probab=79.29 E-value=0.61 Score=37.56 Aligned_cols=13 Identities=46% Similarity=0.611 Sum_probs=11.1
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+.+..+
T Consensus 317 MPqKrNP~~~E~i 329 (455)
T cd01362 317 MPGKVNPTQCEAL 329 (455)
T ss_pred CCCCCCcHHHHHH
Confidence 9999999987654
No 28
>cd01357 Aspartase Aspartase. This subgroup contains Escherichia coli aspartase (L-aspartate ammonia-lyase), Bacillus aspartase and related proteins. It is a member of the Lyase class I family, which includes both aspartase (L-aspartate ammonia-lyase) and fumarase class II enzymes. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. Aspartase catalyzes the reversible deamination of aspartic acid.
Probab=78.29 E-value=0.65 Score=37.26 Aligned_cols=13 Identities=54% Similarity=0.889 Sum_probs=10.9
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+....+
T Consensus 316 MPqKrNP~~~E~i 328 (450)
T cd01357 316 MPGKVNPVIPEVV 328 (450)
T ss_pred CCCCcCcHHHHHH
Confidence 9999999987554
No 29
>PRK00855 argininosuccinate lyase; Provisional
Probab=77.82 E-value=0.77 Score=36.52 Aligned_cols=13 Identities=62% Similarity=1.086 Sum_probs=10.7
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||++...+
T Consensus 282 MPqK~NP~~~E~i 294 (459)
T PRK00855 282 MPQKKNPDVAELI 294 (459)
T ss_pred CCCCCCCHHHHHH
Confidence 9999999987543
No 30
>cd03302 Adenylsuccinate_lyase_2 Adenylsuccinate lyase (ASL)_subgroup 2. This subgroup contains mainly eukaryotic proteins similar to ASL, a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two steps in the de novo purine biosynthesis: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and, the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP). ASL deficiency has been linked to several pathologies including psychomotor retardation with autistic features, epilepsy and muscle wasting.
Probab=76.98 E-value=0.78 Score=36.48 Aligned_cols=13 Identities=38% Similarity=0.544 Sum_probs=11.2
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+.+..+
T Consensus 276 MPhKrNPv~~E~i 288 (436)
T cd03302 276 MPYKRNPMRSERC 288 (436)
T ss_pred CCCccCcHHHHHH
Confidence 9999999987655
No 31
>cd01359 Argininosuccinate_lyase Argininosuccinate lyase (argininosuccinase, ASAL). This group contains ASAL and related proteins. It is a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASAL is a cytosolic enzyme which catalyzes the reversible breakdown of argininosuccinate to arginine and fumarate during arginine biosynthesis. In ureotelic species ASAL also catalyzes a reaction involved in the production of urea. Included in this group are the major soluble avian eye lens proteins from duck, delta 1 and delta 2 crystallin. Of these two isoforms only delta 2 has retained ASAL activity. These crystallins may have evolved by, gene recruitment of ASAL followed by gene duplication.
Probab=76.72 E-value=0.98 Score=35.30 Aligned_cols=13 Identities=62% Similarity=1.020 Sum_probs=10.9
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||..+..+
T Consensus 258 MP~KrNP~~~E~i 270 (435)
T cd01359 258 MPQKKNPDVLELI 270 (435)
T ss_pred CCCCCCCcHHHHH
Confidence 9999999987544
No 32
>PRK09053 3-carboxy-cis,cis-muconate cycloisomerase; Provisional
Probab=75.51 E-value=0.86 Score=36.19 Aligned_cols=13 Identities=38% Similarity=0.557 Sum_probs=11.0
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||.++..+
T Consensus 281 MP~KrNPv~~E~i 293 (452)
T PRK09053 281 MPHKRNPVGCAAV 293 (452)
T ss_pred CCCCCCchHHHHH
Confidence 9999999987554
No 33
>TIGR00839 aspA aspartate ammonia-lyase. Fumarate hydratase scores as high as 570 bits against this model.
Probab=75.22 E-value=0.7 Score=37.64 Aligned_cols=13 Identities=46% Similarity=0.887 Sum_probs=11.1
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+.+..+
T Consensus 319 MPqKrNP~~~E~i 331 (468)
T TIGR00839 319 MPAKVNPVVPEVV 331 (468)
T ss_pred CCCCcCcHHHHHH
Confidence 9999999987654
No 34
>PRK07492 adenylosuccinate lyase; Provisional
Probab=73.90 E-value=1.2 Score=35.68 Aligned_cols=13 Identities=46% Similarity=0.904 Sum_probs=10.8
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+....+
T Consensus 268 MPhKrNP~~~E~i 280 (435)
T PRK07492 268 MPHKRNPVLTENL 280 (435)
T ss_pred CCCCCCcHHHHHH
Confidence 9999999987544
No 35
>PRK08470 adenylosuccinate lyase; Provisional
Probab=73.47 E-value=1.3 Score=35.32 Aligned_cols=13 Identities=38% Similarity=0.882 Sum_probs=10.7
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||+....+
T Consensus 265 MPhKrNPv~~E~i 277 (442)
T PRK08470 265 MPHKRNPVLSENI 277 (442)
T ss_pred CCCCcCcHHHHHH
Confidence 9999999976544
No 36
>PRK05975 3-carboxy-cis,cis-muconate cycloisomerase; Provisional
Probab=73.26 E-value=1.1 Score=34.80 Aligned_cols=13 Identities=54% Similarity=0.838 Sum_probs=11.1
Q ss_pred CCCCCCCCCcccc
Q psy17730 1 MPQKKNPDIPRTL 13 (101)
Q Consensus 1 mpqkknpdiprtl 13 (101)
||||+||..+..+
T Consensus 276 MPhKrNPv~~E~i 288 (351)
T PRK05975 276 MPHKQNPVAAETL 288 (351)
T ss_pred CCCCcCcHHHHHH
Confidence 9999999987655
No 37
>PRK07380 adenylosuccinate lyase; Provisional
Probab=72.84 E-value=1.3 Score=35.48 Aligned_cols=12 Identities=42% Similarity=0.689 Sum_probs=10.3
Q ss_pred CCCCCCCCCccc
Q psy17730 1 MPQKKNPDIPRT 12 (101)
Q Consensus 1 mpqkknpdiprt 12 (101)
||||+||+....
T Consensus 265 MPhKrNP~~~E~ 276 (431)
T PRK07380 265 MPHKRNPIRSER 276 (431)
T ss_pred CCCCCCCHHHHH
Confidence 999999998654
No 38
>PLN02848 adenylosuccinate lyase
Probab=63.66 E-value=2.6 Score=34.41 Aligned_cols=12 Identities=42% Similarity=0.432 Sum_probs=9.9
Q ss_pred CCCCCCCCCccc
Q psy17730 1 MPQKKNPDIPRT 12 (101)
Q Consensus 1 mpqkknpdiprt 12 (101)
||||+||++...
T Consensus 301 MP~KrNPv~~E~ 312 (458)
T PLN02848 301 MPHKVNPIDFEN 312 (458)
T ss_pred CCCCcCcHHHHH
Confidence 999999987543
No 39
>cd01598 PurB PurB_like adenylosuccinases (adenylsuccinate lyase, ASL). This subgroup contains EcASL, the product of the purB gene in Escherichia coli, and related proteins. It is a member of the Lyase class I family of the Lyase_I superfamily. Members of the Lyase class I family function as homotetramers to catalyze similar beta-elimination reactions in which a Calpha-N or Calpha-O bond is cleaved with the subsequent release of fumarate as one of the products. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two non-sequential steps in the de novo purine biosynthesis pathway: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and; the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP).
Probab=62.28 E-value=3.2 Score=33.53 Aligned_cols=12 Identities=42% Similarity=0.432 Sum_probs=9.8
Q ss_pred CCCCCCCCCccc
Q psy17730 1 MPQKKNPDIPRT 12 (101)
Q Consensus 1 mpqkknpdiprt 12 (101)
||||+||+....
T Consensus 276 MPhKrNPv~~E~ 287 (425)
T cd01598 276 MPHKVNPIDFEN 287 (425)
T ss_pred CCCCcCchHHHH
Confidence 999999987543
No 40
>PRK09285 adenylosuccinate lyase; Provisional
Probab=61.17 E-value=3.6 Score=33.41 Aligned_cols=11 Identities=45% Similarity=0.456 Sum_probs=9.3
Q ss_pred CCCCCCCCCcc
Q psy17730 1 MPQKKNPDIPR 11 (101)
Q Consensus 1 mpqkknpdipr 11 (101)
||||+||....
T Consensus 298 MPhKrNPv~~E 308 (456)
T PRK09285 298 MPHKVNPIDFE 308 (456)
T ss_pred CCCCcCchHHH
Confidence 99999998743
No 41
>cd01594 Lyase_I_like Lyase class I_like superfamily: contains the lyase class I family, histidine ammonia-lyase and phenylalanine ammonia-lyase, which catalyze similar beta-elimination reactions. Lyase class I_like superfamily of enzymes that catalyze beta-elimination reactions and are active as homotetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. This superfamily contains the lyase class I family, histidine ammonia-lyase and phenylalanine ammonia-lyase. The lyase class I family comprises proteins similar to class II fumarase, aspartase, adenylosuccinate lyase, argininosuccinate lyase, and 3-carboxy-cis, cis-muconate lactonizing enzyme which, for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. Histidine or phenylalanine ammonia-lyase catalyze a beta-elimination of ammonia from histidine and phenylalanine, respective
Probab=57.50 E-value=2.5 Score=28.64 Aligned_cols=15 Identities=40% Similarity=0.534 Sum_probs=12.2
Q ss_pred CCCCCCCCCcccccc
Q psy17730 1 MPQKKNPDIPRTLSE 15 (101)
Q Consensus 1 mpqkknpdiprtlse 15 (101)
||||+||.....+.+
T Consensus 168 mp~k~Np~~~e~~~~ 182 (231)
T cd01594 168 MPQKVNPVAAELVRG 182 (231)
T ss_pred CCCCCCCHHHHHHHH
Confidence 899999998766654
No 42
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures. These proteins provide an important focus for research, some being involved in bacterial resistance to toxic metals, such as lead and cadmium, while others are involved in inherited human syndromes, such as Wilson's and Menke's diseases []. A conserved domain has been found in a number of these heavy metal transport or detoxification proteins []. The domain, which has been termed Heavy-Metal-Associated (HMA), contains two conserved cysteines that are probably involved in metal binding. Structure solution of the fourth HMA domain of the Menke's copper transporting ATPase shows a well-defined structure comprising a four-stranded antiparallel beta-sheet and two alpha helices packed in an alpha-beta sandwich fold []. This fold is common to other domains and is classified as "ferredoxin-like".; GO: 0046872 metal ion binding, 0030001 metal ion transport; PDB: 2VOY_A 1P6T_A 1KQK_A 2RML_A 1JWW_A 3K7R_F 1FES_A 1CC8_A 1FD8_A 2GGP_A ....
Probab=48.87 E-value=7.9 Score=21.67 Aligned_cols=13 Identities=38% Similarity=1.045 Sum_probs=10.8
Q ss_pred hhcccchhhhhHH
Q psy17730 82 VRGLACTSCAAEL 94 (101)
Q Consensus 82 vrglactscaael 94 (101)
|.|+.|.+|+..+
T Consensus 4 v~~m~C~~C~~~v 16 (62)
T PF00403_consen 4 VPGMTCEGCAKKV 16 (62)
T ss_dssp EESTTSHHHHHHH
T ss_pred ECCcccHHHHHHH
Confidence 6799999999754
No 43
>TIGR00003 copper ion binding protein. This model describes an apparently copper-specific subfamily of the metal-binding domain HMA (Pfam family pfam00403). Closely related sequences outside this model include mercury resistance proteins and repeated domains of eukaryotic eukaryotic copper transport proteins. Members of this family are strictly prokaryotic. The model identifies both small proteins consisting of just this domain and N-terminal regions of cation (probably copper) transporting ATPases.
Probab=32.91 E-value=22 Score=16.53 Aligned_cols=14 Identities=21% Similarity=0.769 Sum_probs=10.5
Q ss_pred hhhcccchhhhhHH
Q psy17730 81 SVRGLACTSCAAEL 94 (101)
Q Consensus 81 svrglactscaael 94 (101)
.+.|+.|.+|+..+
T Consensus 7 ~v~~~~~~~c~~~~ 20 (68)
T TIGR00003 7 QVMSMTCQHCVDKI 20 (68)
T ss_pred EECCeEcHHHHHHH
Confidence 36788999997654
No 44
>PF13931 Microtub_bind: Kinesin-associated microtubule-binding
Probab=32.81 E-value=42 Score=24.53 Aligned_cols=27 Identities=41% Similarity=0.634 Sum_probs=24.7
Q ss_pred CCCCCCCCcccccccCchhHHHHHHHH
Q psy17730 2 PQKKNPDIPRTLSEAKPESCLRQRLFN 28 (101)
Q Consensus 2 pqkknpdiprtlseakpesclrqrlfn 28 (101)
||++.-..|++|..-.|...|.+||-.
T Consensus 12 P~rk~y~YP~~L~~T~ph~~ll~~~r~ 38 (143)
T PF13931_consen 12 PQRKEYQYPRTLPRTEPHERLLRRLRE 38 (143)
T ss_pred CCcccccCCCccCCCCcHHHHHHHHHh
Confidence 899999999999999999999988763
No 45
>COG4187 RocB Arginine degradation protein (predicted deacylase) [Amino acid transport and metabolism]
Probab=31.15 E-value=9.5 Score=33.64 Aligned_cols=40 Identities=35% Similarity=0.586 Sum_probs=28.2
Q ss_pred CchhHHHHH----------------HHHhhcCcccccccccccchhhhhcCccchhcc
Q psy17730 17 KPESCLRQR----------------LFNMLTHPMEISASSVHDKDMQECKQPRATAID 58 (101)
Q Consensus 17 kpesclrqr----------------lfnmlthpmeisassvhdkdmqeckqprataid 58 (101)
-|-+||+|+ .||.|+|-+ +|+.+||+=..+-++--..+|+
T Consensus 276 ~PPs~L~qkDlKe~Y~VqTp~~a~~~fN~l~h~~--ta~~~~d~l~~~a~~A~~e~i~ 331 (553)
T COG4187 276 PPPSCLEQKDLKESYNVQTPERAWLYFNWLYHSR--TAKELFDRLKEEAETAAEEAIE 331 (553)
T ss_pred CCcHhhhhhhhhhhccccCcchhhhhheehhhcC--CHHHHHHHHHHHHHHHHHHHHH
Confidence 478999997 699999865 6778888766555544434443
No 46
>PF09016 Pas_Saposin: Pas factor saposin fold; InterPro: IPR015106 Members of this entry adopt a compact structure comprising five alpha helices. Charged and polar residues are exposed mostly on the surface, while most of the hydrophobic residues are buried inside the hydrophobic core of the helical bundle. The precise function of this domain is unknown, but it is has been shown to induce secretion of periplasmic proteins, especially collagenase []. ; PDB: 2B8I_A.
Probab=28.93 E-value=33 Score=23.62 Aligned_cols=23 Identities=35% Similarity=0.733 Sum_probs=15.9
Q ss_pred ccccCchhH--HHHHHHHhhcCccc
Q psy17730 13 LSEAKPESC--LRQRLFNMLTHPME 35 (101)
Q Consensus 13 lseakpesc--lrqrlfnmlthpme 35 (101)
|..+.||.| .||+||+-|.-|.+
T Consensus 12 LA~~ePeqhA~IRQ~LYeqLdLpFd 36 (76)
T PF09016_consen 12 LANQEPEQHAQIRQNLYEQLDLPFD 36 (76)
T ss_dssp HHHS-GGGHHHHHHHHHHHH---HH
T ss_pred HHccChHHHHHHHHHHHHHcCCcHH
Confidence 567889988 69999999988875
No 47
>PF02945 Endonuclease_7: Recombination endonuclease VII; InterPro: IPR004211 This family of proteins which includes Bacteriophage T4 endonuclease VII, Mycobacteriophage D29 gene 59, and other as yet uncharacterised proteins. The T4 endonuclease VII (Endo VII) recognises a broad spectrum of DNA substrates ranging from branched DNAs to single base mismatches. The structure of this enzyme has been resolved and it was found that the monomers form an elongated, intertwined molecular dimer that exibits extreme domain swapping. Two pairs of antiparallel helices which form a novel 'four-helix cross' motif are the major dimerisation elements [].; PDB: 3GOX_A 3FC3_A 1EN7_B 1E7L_B 2QNF_A 2QNC_A 1E7D_A.
Probab=28.72 E-value=24 Score=23.10 Aligned_cols=15 Identities=47% Similarity=0.944 Sum_probs=12.0
Q ss_pred hhhhhcccchhhhhH
Q psy17730 79 CNSVRGLACTSCAAE 93 (101)
Q Consensus 79 cnsvrglactscaae 93 (101)
+-.|||+.|.+|-.-
T Consensus 47 tG~vRGlLC~~CN~~ 61 (81)
T PF02945_consen 47 TGRVRGLLCRSCNTA 61 (81)
T ss_dssp TTBEEEEEEHHHHHH
T ss_pred CCCchhhhhhHHhhh
Confidence 445999999999763
No 48
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism]
Probab=28.61 E-value=25 Score=21.30 Aligned_cols=15 Identities=27% Similarity=0.756 Sum_probs=12.2
Q ss_pred hhhhcccchhhhhHH
Q psy17730 80 NSVRGLACTSCAAEL 94 (101)
Q Consensus 80 nsvrglactscaael 94 (101)
..+.|+.|..|+...
T Consensus 6 l~v~~MtC~~C~~~V 20 (71)
T COG2608 6 LKVEGMTCGHCVKTV 20 (71)
T ss_pred EEECCcCcHHHHHHH
Confidence 357899999999864
No 49
>PF14049 Dppa2_A: Dppa2/4 conserved region in higher vertebrates
Probab=25.05 E-value=23 Score=24.72 Aligned_cols=24 Identities=46% Similarity=0.699 Sum_probs=18.8
Q ss_pred CCCCcccccccCchhHHHHHHHHhhc
Q psy17730 6 NPDIPRTLSEAKPESCLRQRLFNMLT 31 (101)
Q Consensus 6 npdiprtlseakpesclrqrlfnmlt 31 (101)
+-|||.|..|||-.+|.|. -.|.+
T Consensus 2 ~~~iP~T~kEAkl~~csrK--~K~~~ 25 (86)
T PF14049_consen 2 QQDIPETPKEAKLQSCSRK--LKAVT 25 (86)
T ss_pred CCcCCCCcHHHHhhhcccc--hhhhc
Confidence 4589999999999999765 34444
No 50
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=23.11 E-value=96 Score=25.22 Aligned_cols=53 Identities=40% Similarity=0.644 Sum_probs=34.8
Q ss_pred CCCCCCCcccccccCchhHHHHHH---HHhhcCcccccccccccchhhhhcCccchhcccceeeeccCceEE-EeehHHH
Q psy17730 3 QKKNPDIPRTLSEAKPESCLRQRL---FNMLTHPMEISASSVHDKDMQECKQPRATAIDNRLHVMSRPSITI-IYVQKQL 78 (101)
Q Consensus 3 qkknpdiprtlseakpesclrqrl---fnmlthpmeisassvhdkdmqeckqprataidnrlhvmsrpsiti-iyvqkql 78 (101)
...--|.|||+|-. .+||| -|..||| ||-.|..|.=-. +-||..|
T Consensus 142 ~~RiDD~PrtFSGG-----MqQRLQiARnLVt~P--------------------------rLvfMDEPTGGLDVSVQARL 190 (258)
T COG4107 142 LDRIDDLPRTFSGG-----MQQRLQIARNLVTRP--------------------------RLVFMDEPTGGLDVSVQARL 190 (258)
T ss_pred cccccCcccccchH-----HHHHHHHHHHhccCC--------------------------ceEEecCCCCCcchhhHHHH
Confidence 34456788888854 67777 3777776 455666664332 4578888
Q ss_pred hhhhhccc
Q psy17730 79 CNSVRGLA 86 (101)
Q Consensus 79 cnsvrgla 86 (101)
-.-+|||.
T Consensus 191 LDllrgLv 198 (258)
T COG4107 191 LDLLRGLV 198 (258)
T ss_pred HHHHHHHH
Confidence 88777764
Done!