Query         psy17732
Match_columns 186
No_of_seqs    21 out of 23
Neff          2.5 
Searched_HMMs 46136
Date          Fri Aug 16 21:33:46 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17732.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17732hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF13794 MiaE_2:  tRNA-(MS[2]IO  35.8      21 0.00046   30.4   1.5   19  121-139    85-103 (185)
  2 PF12112 DUF3579:  Protein of u  29.4      29 0.00062   26.9   1.1   15  118-132    18-32  (92)
  3 COG5373 Predicted membrane pro  29.2      55  0.0012   34.2   3.3   12   27-38     78-89  (931)
  4 PF08127 Propeptide_C1:  Peptid  26.2      41 0.00088   22.2   1.2   13  101-113     3-15  (41)
  5 PRK10811 rne ribonuclease E; R  24.8      73  0.0016   33.9   3.3   24   58-86   1020-1043(1068)
  6 PF06459 RR_TM4-6:  Ryanodine R  23.6      57  0.0012   29.1   2.0   27  158-184   158-184 (274)
  7 TIGR02220 phg_TIGR02220 phage   18.6      59  0.0013   24.1   0.9   13  100-112     1-13  (77)
  8 TIGR03224 benzo_boxA benzoyl-C  17.4      76  0.0016   28.9   1.6   29    2-30     65-93  (411)
  9 PF13625 Helicase_C_3:  Helicas  15.7 2.8E+02  0.0061   20.9   4.1   55  101-161    58-115 (129)
 10 PF14088 DUF4268:  Domain of un  13.7 1.2E+02  0.0027   23.1   1.6   30   96-126     3-32  (140)

No 1  
>PF13794 MiaE_2:  tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)-like; PDB: 3EZ0_C.
Probab=35.83  E-value=21  Score=30.44  Aligned_cols=19  Identities=32%  Similarity=0.660  Sum_probs=14.9

Q ss_pred             CcccHHHHHHhhhhcCCcc
Q psy17732        121 RPQTWAERALRTYTKDWPD  139 (186)
Q Consensus       121 rPQtWAERaLRTy~~~~~~  139 (186)
                      +|.+|.|+++++|--.+..
T Consensus        85 ~P~dW~E~LvKaYVg~gla  103 (185)
T PF13794_consen   85 RPSDWLESLVKAYVGDGLA  103 (185)
T ss_dssp             --SSHHHHHHHHHHHHHHH
T ss_pred             CCCChHHHHHHHHHHHhHH
Confidence            6789999999999877655


No 2  
>PF12112 DUF3579:  Protein of unknown function (DUF3579);  InterPro: IPR021969  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 98 to 126 amino acids in length. This protein has a conserved FRP sequence motif. ; PDB: 2L9D_A.
Probab=29.44  E-value=29  Score=26.94  Aligned_cols=15  Identities=40%  Similarity=0.663  Sum_probs=9.7

Q ss_pred             CCCCcccHHHHHHhh
Q psy17732        118 ELPRPQTWAERALRT  132 (186)
Q Consensus       118 eiPrPQtWAERaLRT  132 (186)
                      ..=||-.||||+--.
T Consensus        18 k~FRPSDWaERL~gv   32 (92)
T PF12112_consen   18 KTFRPSDWAERLCGV   32 (92)
T ss_dssp             -B-S-TTHHHHHHHT
T ss_pred             CCcCCccHHHHHHHH
Confidence            345899999998653


No 3  
>COG5373 Predicted membrane protein [Function unknown]
Probab=29.23  E-value=55  Score=34.22  Aligned_cols=12  Identities=17%  Similarity=0.171  Sum_probs=5.6

Q ss_pred             CCCCcccccccC
Q psy17732         27 SLPPKQLRVLAG   38 (186)
Q Consensus        27 ~~~~~~~~v~eg   38 (186)
                      ++|+.++++.|+
T Consensus        78 ~~p~~~~~~~e~   89 (931)
T COG5373          78 PPPVPPAPAQEG   89 (931)
T ss_pred             CCCCCCCCCCCC
Confidence            334444555554


No 4  
>PF08127 Propeptide_C1:  Peptidase family C1 propeptide;  InterPro: IPR012599 This domain is found at the N-terminal of cathepsin B and cathepsin B-like peptidases that belong to MEROPS peptidase subfamily C1A. Cathepsin B are lysosomal cysteine proteinases belonging to the papain superfamily and are unique in their ability to act as both an endo- and an exopeptidases. They are synthesized as inactive zymogens. Activation of the peptidases occurs with the removal of the propeptide [, ]. ; GO: 0004197 cysteine-type endopeptidase activity, 0050790 regulation of catalytic activity; PDB: 1MIR_A 1PBH_A 2PBH_A 3PBH_A.
Probab=26.16  E-value=41  Score=22.18  Aligned_cols=13  Identities=46%  Similarity=0.807  Sum_probs=10.0

Q ss_pred             hhHHHhhhhccCC
Q psy17732        101 DDVIHYLNSKSQG  113 (186)
Q Consensus       101 DDvIdYLDrR~kG  113 (186)
                      |++|+|+|+.+.+
T Consensus         3 de~I~~IN~~~~t   15 (41)
T PF08127_consen    3 DEFIDYINSKNTT   15 (41)
T ss_dssp             HHHHHHHHHCT-S
T ss_pred             HHHHHHHHcCCCc
Confidence            7899999997543


No 5  
>PRK10811 rne ribonuclease E; Reviewed
Probab=24.85  E-value=73  Score=33.87  Aligned_cols=24  Identities=21%  Similarity=0.441  Sum_probs=16.6

Q ss_pred             ccccccCCCCCccccccccccccccCCcc
Q psy17732         58 DSEIQALHFPKKRDIKKTREFHHWVRPTR   86 (186)
Q Consensus        58 ~~~i~p~~~~~~~~~~k~~v~kHWvRP~f   86 (186)
                      --+.++|.|     .....+..+|+||.|
T Consensus      1020 mtkapap~~-----~~~~~~~~~w~rP~~ 1043 (1068)
T PRK10811       1020 MTRAPAPEY-----VPEAPRHSDWQRPTF 1043 (1068)
T ss_pred             ccCCCCccc-----cccccccccccCccc
Confidence            345555555     455667899999987


No 6  
>PF06459 RR_TM4-6:  Ryanodine Receptor TM 4-6;  InterPro: IPR009460  The release of Ca2+ ions from intracellular stores is a key step in a wide variety of cellular functions. In striated muscle, the release of Ca2+ from the sarcoplasmic reticulum (SR) leads to muscle contraction. Ca2+ release occurs through large, high-conductance Ca2+ release channels, also known as ryanodine receptors (RyRs) because they bind the plant alkaloid ryanodine with high affinity and specificity []. This region covers TM regions 4-6 of the ryanodine receptor 1 family.; GO: 0005219 ryanodine-sensitive calcium-release channel activity, 0006874 cellular calcium ion homeostasis, 0016021 integral to membrane
Probab=23.58  E-value=57  Score=29.12  Aligned_cols=27  Identities=22%  Similarity=0.573  Sum_probs=22.7

Q ss_pred             hcccchhhhhHHHHHHHhHHHHHHhhh
Q psy17732        158 FSGKFYAQHSKEFYNRKYRDVLYAYIT  184 (186)
Q Consensus       158 ~~~k~y~~HtK~Y~~~KY~~iL~~~~~  184 (186)
                      ...++-||-.|+|||.||--+..|++.
T Consensus       158 y~~k~lnylARNFYNlr~lALflAFaI  184 (274)
T PF06459_consen  158 YRTKFLNYLARNFYNLRFLALFLAFAI  184 (274)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345788899999999999999888764


No 7  
>TIGR02220 phg_TIGR02220 phage conserved hypothetical protein, C-terminal domain. This model represents the conserved C-terminal domain of a family of proteins found exclusively in bacteriophage and in bacterial prophage regions. The functions of this domain and the proteins containing it are unknown.
Probab=18.57  E-value=59  Score=24.15  Aligned_cols=13  Identities=46%  Similarity=0.963  Sum_probs=10.7

Q ss_pred             hhhHHHhhhhccC
Q psy17732        100 YDDVIHYLNSKSQ  112 (186)
Q Consensus       100 YDDvIdYLDrR~k  112 (186)
                      |..+|||||+++-
T Consensus         1 ~~eii~yLN~ktg   13 (77)
T TIGR02220         1 YKEIIEYLNEKAG   13 (77)
T ss_pred             ChHHHHHHHHhcC
Confidence            5689999999873


No 8  
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein. Members of this protein family are BoxA, the A component of the BoxAB benzoyl-CoA oxygenase/reductase. This oxygen-requiring enzyme acts in an aerobic pathway of benzoate catabolism via coenzyme A ligation. BoxA is a homodimeric iron-sulphur-flavoprotein and acts as an NADPH-dependent reductase for BoxB.
Probab=17.42  E-value=76  Score=28.89  Aligned_cols=29  Identities=10%  Similarity=0.321  Sum_probs=20.6

Q ss_pred             ccccccCCCCCCcchhhcccccccCCCCC
Q psy17732          2 IRKWADDGGFSWDDVEAIEEPKAQRSLPP   30 (186)
Q Consensus         2 ~~~~~d~~~~~Wddv~~iEep~~~~~~~~   30 (186)
                      .+.|+-++.+.||.+-+..+|+.+...|+
T Consensus        65 ~~~~tv~e~~~~~~~~~~~~~~~~~~~~~   93 (411)
T TIGR03224        65 AKAYSLEEQLTWDELPEEVTLPEAAAEPA   93 (411)
T ss_pred             cccccHHheeccccCCCcCChhhhhhCCc
Confidence            35677788999998888777765554443


No 9  
>PF13625 Helicase_C_3:  Helicase conserved C-terminal domain
Probab=15.68  E-value=2.8e+02  Score=20.90  Aligned_cols=55  Identities=18%  Similarity=0.105  Sum_probs=34.7

Q ss_pred             hhHHHhhhhccCCCCCCCCCCcccHHHHHHhhhhcCCcccccc---ccchhhHHHHHHHhhccc
Q psy17732        101 DDVIHYLNSKSQGGHVTELPRPQTWAERALRTYTKDWPDTATY---EKTKADEELLQKLRFSGK  161 (186)
Q Consensus       101 DDvIdYLDrR~kG~~~~eiPrPQtWAERaLRTy~~~~~~~~~~---~~k~~D~kLl~~i~~~~k  161 (186)
                      +++|++|.+.+++-      .||+=..-+-....+-+......   +-...|.++|..|.....
T Consensus        58 e~i~~~L~~~S~~~------lP~~v~~~i~~w~~~~g~v~l~~~~~~l~~~d~~~l~~l~~~~~  115 (129)
T PF13625_consen   58 EEIIEFLERYSKNP------LPQNVEQSIEDWARRYGRVRLYKGAYLLECDDPELLDELLADPE  115 (129)
T ss_pred             HHHHHHHHHHcCCC------CCHHHHHHHHHHHHhcCCEEEecCeEEEEECCHHHHHHHHhChh
Confidence            78999999999664      46665544444444333333322   226889999988865543


No 10 
>PF14088 DUF4268:  Domain of unknown function (DUF4268)
Probab=13.71  E-value=1.2e+02  Score=23.12  Aligned_cols=30  Identities=20%  Similarity=0.523  Sum_probs=26.2

Q ss_pred             cccchhhHHHhhhhccCCCCCCCCCCcccHH
Q psy17732         96 AHNYYDDVIHYLNSKSQGGHVTELPRPQTWA  126 (186)
Q Consensus        96 r~NYYDDvIdYLDrR~kG~~~~eiPrPQtWA  126 (186)
                      |..|.-.+.+|+..+..++ ..--|+|+.|-
T Consensus         3 r~~FWt~f~~~~~~~~~~~-~~~~p~~~~W~   32 (140)
T PF14088_consen    3 RLEFWTEFLEYLKEKPPLF-SNRKPSPDHWI   32 (140)
T ss_pred             HHHHHHHHHHHHHhccccc-ccCCCCCCcce
Confidence            5678889999999999777 89999999994


Done!