BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy17737
         (493 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q1LTT4|TPIS_BAUCH Triosephosphate isomerase OS=Baumannia cicadellinicola subsp.
           Homalodisca coagulata GN=tpiA PE=3 SV=1
          Length = 256

 Score = 32.3 bits (72), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 435 GNHISKIIVN-DIHTSGYHTGDKESKKLSNVARGYYLDGNHLERRV 479
           G+HI+    N D+H SG  TG+  +K L ++   Y + G H+ERR+
Sbjct: 57  GSHIALGAQNVDLHVSGAFTGEISAKMLKDIGAKYIIIG-HIERRL 101


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.320    0.136    0.416 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 189,038,488
Number of Sequences: 539616
Number of extensions: 8043230
Number of successful extensions: 17735
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 17735
Number of HSP's gapped (non-prelim): 1
length of query: 493
length of database: 191,569,459
effective HSP length: 122
effective length of query: 371
effective length of database: 125,736,307
effective search space: 46648169897
effective search space used: 46648169897
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)