Diaphorina citri psyllid: psy17751


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------42
MFRTLFNTHWASCQSQVPSSNEEYSCAFASNKYFALCGVGGLLACGSTHLLVTPLDIVKCRLQVDQEKYRNVMTGFRVTVAEEGLRFRVTVAEEGLRGLAKGWVPTLIGYSIQGYAKFGFYEVFKVISSISHRLCRSSGCSILSSLRCRSSSLLNSSGSSSTTLSSSNSTFGCNLVGLAKGWVPTLIGYSIQGYAKFGFYEVFKVKFASLVSEESAYKYRTSIYLVSAATAEFIGDVGLSAFEAIKVKIQTSPGFANTMMEAIPKMYQEEGLYSFFKALVPLALRQIPYTTVKFVCFERTIELLYKYVVPKPRDQCSKPEQLVVTFSAGYIAGIFCAVASHPPDVIVSQMNQQKDVPMATIIRRLGFSGMWSGLAPRIAMIGTIAALQWFIFDGFKVAMALPRPPPPEMPESMKRQLMS
ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccccccccccccccccccccHHHcccccccccccHHHHHHHHHccccHHHcHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEccccccccccHHHHHHHHcccccEEHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcc
***********************YSCAFASNKYFALCGVGGLLACGSTHLLVTPLDIVKCRLQVDQEKYRNVMTGFRVTVAEEGLRFRVTVAEEGLRGLAKGWVPTLIGYSIQGYAKFGFYEVFKVISSISHRLCRSSGCSILSSLRCRSSSLLNSSGSSSTTLSSSNSTFGCNLVGLAKGWVPTLIGYSIQGYAKFGFYEVFKVKFASLVSEESAYKYRTSIYLVSAATAEFIGDVGLSAFEAIKVKIQTSPGFANTMMEAIPKMYQEEGLYSFFKALVPLALRQIPYTTVKFVCFERTIELLYKYVVPKPRDQCSKPEQLVVTFSAGYIAGIFCAVASHPPDVIVSQMNQQKDVPMATIIRRLGFSGMWSGLAPRIAMIGTIAALQWFIFDGFKVAMA*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRTLFNTHWASCQSQVPSSNEEYSCAFASNKYFALCGVGGLLACGSTHLLVTPLDIVKCRLQVDQEKYRNVMTGFRVTVAEEGLRFRVTVAEEGLRGLAKGWVPTLIGYSIQGYAKFGFYEVFKVISSISHRLCRSSGCSILSSLRCRSSSLLNSSGSSSTTLSSSNSTFGCNLVGLAKGWVPTLIGYSIQGYAKFGFYEVFKVKFASLVSEESAYKYRTSIYLVSAATAEFIGDVGLSAFEAIKVKIQTSPGFANTMMEAIPKMYQEEGLYSFFKALVPLALRQIPYTTVKFVCFERTIELLYKYVVPKPRDQCSKPEQLVVTFSAGYIAGIFCAVASHPPDVIVSQMNQQKDVPMATIIRRLGFSGMWSGLAPRIAMIGTIAALQWFIFDGFKVAMALPRPPPPEMPESMKRQLMS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphate carrier protein, mitochondrial Transport of phosphate groups from the cytosol to the mitochondrial matrix. Phosphate is cotransported with H(+).confidentQ5R7W2
Phosphate carrier protein, mitochondrial Transport of phosphate groups from the cytosol to the mitochondrial matrix. Phosphate is cotransported with H(+).confidentP16036
Phosphate carrier protein, mitochondrial Transport of phosphate groups from the cytosol to the mitochondrial matrix. Phosphate is cotransported with H(+).confidentP12234

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0022857 [MF]transmembrane transporter activityprobableGO:0005215, GO:0003674
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006810 [BP]transportprobableGO:0051234, GO:0008150, GO:0051179
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 33-82,94-126,206-307,318-395
View the alignment between query and template
View the model in PyMOL
Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 2-82,94-127,207-306
View the alignment between query and template
View the model in PyMOL