Query         psy17760
Match_columns 105
No_of_seqs    18 out of 20
Neff          1.7 
Searched_HMMs 46136
Date          Fri Aug 16 22:10:44 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17760.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17760hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08826 DMPK_coil:  DMPK coile  56.4      13 0.00029   24.2   2.6   18   67-84     44-61  (61)
  2 PF04201 TPD52:  Tumour protein  55.1      15 0.00033   28.2   3.1   27   64-90     31-57  (162)
  3 PF09730 BicD:  Microtubule-ass  50.6      15 0.00032   33.5   2.8   30   58-87    622-651 (717)
  4 PF14689 SPOB_a:  Sensor_kinase  50.1      21 0.00046   22.2   2.7   26   63-88      1-26  (62)
  5 PF03763 Remorin_C:  Remorin, C  48.3      26 0.00056   24.7   3.2   29   60-88     35-63  (111)
  6 PF11559 ADIP:  Afadin- and alp  45.8      32  0.0007   23.8   3.4   28   59-86    123-150 (151)
  7 PF01920 Prefoldin_2:  Prefoldi  40.7      87  0.0019   19.7   4.5   44   42-86     43-86  (106)
  8 PF10260 SAYSvFN:  Uncharacteri  39.7      14  0.0003   24.9   0.7   26   47-72     41-71  (71)
  9 PF08581 Tup_N:  Tup N-terminal  39.7      23  0.0005   23.9   1.8   14   75-88     63-76  (79)
 10 KOG0999|consensus               36.8      34 0.00074   31.9   3.0   30   58-87    637-666 (772)
 11 PF04538 BEX:  Brain expressed   36.4      43 0.00093   23.5   2.8   22   63-86     66-87  (100)
 12 KOG3189|consensus               35.7      39 0.00085   27.9   2.9   25   30-57    104-128 (252)
 13 PF05582 Peptidase_U57:  YabG p  32.1      65  0.0014   26.8   3.6   67    9-86     15-81  (287)
 14 PF08172 CASP_C:  CASP C termin  31.1      67  0.0015   25.3   3.4   24   61-84     85-108 (248)
 15 PF05890 Ebp2:  Eukaryotic rRNA  27.7      41 0.00089   26.9   1.7   23   67-89    109-131 (271)
 16 COG5132 BUD31 Cell cycle contr  27.3      29 0.00063   26.7   0.8   22   58-79     14-38  (146)
 17 PF13348 Y_phosphatase3C:  Tyro  26.9      32 0.00069   20.8   0.8   34   53-86     35-68  (68)
 18 PF05308 Mito_fiss_reg:  Mitoch  26.5      69  0.0015   25.5   2.8   19   69-87    119-140 (253)
 19 smart00595 MADF subfamily of S  26.0      56  0.0012   20.1   1.8   22   57-78     45-66  (89)
 20 PF02096 60KD_IMP:  60Kd inner   25.7      93   0.002   22.1   3.1   27   58-84     37-63  (198)
 21 PF09340 NuA4:  Histone acetylt  25.1      45 0.00098   22.1   1.3   27   72-98     12-38  (80)
 22 KOG3866|consensus               23.9      64  0.0014   28.4   2.3   19   69-87    285-303 (442)
 23 cd08049 TAF8 TATA Binding Prot  23.8 1.1E+02  0.0023   18.8   2.7   29   55-83     24-52  (54)
 24 PF13801 Metal_resist:  Heavy-m  23.3 1.3E+02  0.0029   18.2   3.1   29   59-87     49-77  (125)
 25 PF10406 TAF8_C:  Transcription  22.8 1.1E+02  0.0023   18.8   2.6   27   55-81     24-50  (51)
 26 cd00890 Prefoldin Prefoldin is  22.7   2E+02  0.0044   18.6   4.1   26   43-69     68-94  (129)
 27 KOG0894|consensus               22.7      35 0.00076   28.1   0.5   22   16-37     83-106 (244)
 28 PF13864 Enkurin:  Calmodulin-b  22.3 1.1E+02  0.0024   20.3   2.8   22   62-83     74-95  (98)
 29 PF09551 Spore_II_R:  Stage II   22.1      27 0.00058   25.7  -0.2   15   26-40    114-128 (130)
 30 PF14988 DUF4515:  Domain of un  21.8   1E+02  0.0022   23.6   2.8   27   59-85     75-101 (206)
 31 COG2216 KdpB High-affinity K+   20.8      55  0.0012   30.3   1.4   17   57-74    446-462 (681)
 32 PRK05729 valS valyl-tRNA synth  20.4      93   0.002   27.8   2.7   28   60-87    809-836 (874)

No 1  
>PF08826 DMPK_coil:  DMPK coiled coil domain like;  InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure. It plays a role in dimerisation []. ; GO: 0004674 protein serine/threonine kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 1WT6_D.
Probab=56.44  E-value=13  Score=24.19  Aligned_cols=18  Identities=28%  Similarity=0.676  Sum_probs=14.1

Q ss_pred             HHHHHHhhHHHHHHHHHH
Q psy17760         67 FDAEMRKMEDEMTKFRSE   84 (105)
Q Consensus        67 FdaEMrkMEEEM~kFRse   84 (105)
                      +.+||++++++|..+|++
T Consensus        44 L~~ei~~L~~e~ee~r~~   61 (61)
T PF08826_consen   44 LEQEIERLKKEMEELRSR   61 (61)
T ss_dssp             HHHHHHHHHHHHHHHH--
T ss_pred             HHHHHHHHHHHHHHhhcC
Confidence            678999999999998874


No 2  
>PF04201 TPD52:  Tumour protein D52 family;  InterPro: IPR007327 The hD52 gene was originally identified through its elevated expression level in human breast carcinoma. Cloning of D52 homologues from other species has indicated that D52 may play roles in calcium-mediated signal transduction and cell proliferation. Two human homologues of hD52, hD53 and hD54, have also been identified, demonstrating the existence of a novel gene/protein family []. These proteins have an N-terminal coiled-coil that allows members to form homo- and heterodimers with each other [].
Probab=55.14  E-value=15  Score=28.20  Aligned_cols=27  Identities=33%  Similarity=0.602  Sum_probs=24.4

Q ss_pred             HHHHHHHHHhhHHHHHHHHHHhhcccc
Q psy17760         64 RERFDAEMRKMEDEMTKFRSELMNRES   90 (105)
Q Consensus        64 RERFdaEMrkMEEEM~kFRselmnrEs   90 (105)
                      ||...+|+.|+|||+.-+|.-|.-+|.
T Consensus        31 ~eeLr~EL~KvEeEI~TLrqvL~aKer   57 (162)
T PF04201_consen   31 REELRSELAKVEEEIQTLRQVLAAKER   57 (162)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            788889999999999999999988774


No 3  
>PF09730 BicD:  Microtubule-associated protein Bicaudal-D;  InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []. Glycogen synthase kinase-3beta (GSK-3beta) is required for the binding of BICD to dynein but not to dynactin, acting to maintain the anchoring of microtubules to the centromere []. It appears that amino-acid residues 437-617 of BicD and the kinase activity of GSK-3 are necessary for the formation of a complex between BicD and GSK-3beta in intact cells [].; GO: 0006810 transport, 0005794 Golgi apparatus
Probab=50.58  E-value=15  Score=33.51  Aligned_cols=30  Identities=23%  Similarity=0.521  Sum_probs=26.9

Q ss_pred             ccccchHHHHHHHHHhhHHHHHHHHHHhhc
Q psy17760         58 SEFSNIRERFDAEMRKMEDEMTKFRSELMN   87 (105)
Q Consensus        58 ~EFssiRERFdaEMrkMEEEM~kFRselmn   87 (105)
                      .+-+|+|.+|+.|=.=+.|.|.|+|+||--
T Consensus       622 vALanLKsKYE~EK~~v~etm~kLRnELK~  651 (717)
T PF09730_consen  622 VALANLKSKYENEKAMVSETMMKLRNELKA  651 (717)
T ss_pred             HHHHHHHHHHhhhhhhHHHHHHHHHHHHHH
Confidence            456899999999999999999999999943


No 4  
>PF14689 SPOB_a:  Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B.
Probab=50.12  E-value=21  Score=22.18  Aligned_cols=26  Identities=15%  Similarity=0.353  Sum_probs=19.0

Q ss_pred             hHHHHHHHHHhhHHHHHHHHHHhhcc
Q psy17760         63 IRERFDAEMRKMEDEMTKFRSELMNR   88 (105)
Q Consensus        63 iRERFdaEMrkMEEEM~kFRselmnr   88 (105)
                      |..+.-.+++.+-+.+.+.|.+++|+
T Consensus         1 ~~~~~~~~~~~~~~~lR~~RHD~~Nh   26 (62)
T PF14689_consen    1 MTKQQLEELEELIDSLRAQRHDFLNH   26 (62)
T ss_dssp             -----HHHHHHHHHHHHHHHHHHHHH
T ss_pred             CcchHHHHHHHHHHHHHHHhHHHHHH
Confidence            45667788899999999999999985


No 5  
>PF03763 Remorin_C:  Remorin, C-terminal region ;  InterPro: IPR005516 Remorin binds both simple and complex galaturonides. The N-terminal region of remorin is proline rich, while the C-terminal region has been predicted to form a coiled-coil, that is expected to interact with other macromolecules, most likely DNA. Functional similarities between the behavior of the proteins and viral proteins involved in intercellular communication have been noted [].
Probab=48.29  E-value=26  Score=24.70  Aligned_cols=29  Identities=28%  Similarity=0.471  Sum_probs=23.9

Q ss_pred             ccchHHHHHHHHHhhHHHHHHHHHHhhcc
Q psy17760         60 FSNIRERFDAEMRKMEDEMTKFRSELMNR   88 (105)
Q Consensus        60 FssiRERFdaEMrkMEEEM~kFRselmnr   88 (105)
                      =+.-+-..+++|+++|..+.+-|+..+++
T Consensus        35 En~qkaKaea~m~k~E~klEkkra~a~ek   63 (111)
T PF03763_consen   35 ENLQKAKAEAEMRKIEEKLEKKRAKALEK   63 (111)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34557788999999999999999887763


No 6  
>PF11559 ADIP:  Afadin- and alpha -actinin-Binding;  InterPro: IPR021622  This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch. pombe and other fungi where it anchors spindle-pole bodies to spindle microtubules []. It is a coiled-coil structure, and in pombe, it is required for anchoring the minus end of spindle microtubules to the centrosome equivalent, the spindle-pole body. The name ADIP derives from the family being composed of Afadin- and alpha -Actinin-Binding Proteins Localised at Cell-Cell Adherens Junctions. 
Probab=45.78  E-value=32  Score=23.81  Aligned_cols=28  Identities=25%  Similarity=0.546  Sum_probs=24.0

Q ss_pred             cccchHHHHHHHHHhhHHHHHHHHHHhh
Q psy17760         59 EFSNIRERFDAEMRKMEDEMTKFRSELM   86 (105)
Q Consensus        59 EFssiRERFdaEMrkMEEEM~kFRselm   86 (105)
                      -..+++-.+..||||-|-|+.++...|-
T Consensus       123 ~~~~~~tq~~~e~rkke~E~~kLk~rL~  150 (151)
T PF11559_consen  123 QLQQRKTQYEHELRKKEREIEKLKERLN  150 (151)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            3457788999999999999999998763


No 7  
>PF01920 Prefoldin_2:  Prefoldin subunit;  InterPro: IPR002777  Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea. Eukaryotic PFD is a multi-subunit complex containing six polypeptides in the molecular mass range of 14-23 kDa. In archaea, on the other hand, PFD is composed of two types of subunits, two alpha and four beta. The six subunits associate to form two back-to-back up-and-down eight-stranded barrels, from which hang six coiled coils. Each subunit contributes one (beta subunits) or two (alpha subunits) beta hairpin turns to the barrels. The coiled coils are formed by the N and C termini of an individual subunit. Overall, this unique arrangement resembles a jellyfish. The eukaryotic PFD hexamer is composed of six different subunits; however, these can be grouped into two alpha-like (PFD3 and -5) and four beta-like (PFD1, -2, -4, and -6) subunits based on amino acid sequence similarity with their archaeal counterparts. Eukaryotic PFD has a six-legged structure similar to that seen in the archaeal homologue [, ]. This family contains the archaeal beta subunit, eukaryotic prefoldin subunits 1, 2, 4 and 6.  Eukaryotic PFD has been shown to bind both actin and tubulin co-translationally. The chaperone then delivers the target protein to CCT, interacting with the chaperonin through the tips of the coiled coils. No authentic target proteins of any archaeal PFD have been identified, to date.; GO: 0051082 unfolded protein binding, 0006457 protein folding, 0016272 prefoldin complex; PDB: 2ZDI_B 3AEI_B 2ZQM_A 1FXK_A.
Probab=40.75  E-value=87  Score=19.65  Aligned_cols=44  Identities=20%  Similarity=0.377  Sum_probs=31.3

Q ss_pred             CccccccccCCceeecccccchHHHHHHHHHhhHHHHHHHHHHhh
Q psy17760         42 GKRNIPIKLGDFSVIDSEFSNIRERFDAEMRKMEDEMTKFRSELM   86 (105)
Q Consensus        42 ~kr~IPIklgd~SViD~EFssiRERFdaEMrkMEEEM~kFRselm   86 (105)
                      +.+.+...+|+.-|.- .-..+.+.-...+..+++++.++...+-
T Consensus        43 ~~~~~y~~vG~~fv~~-~~~~~~~~L~~~~~~~~~~i~~l~~~~~   86 (106)
T PF01920_consen   43 DDRKVYKSVGKMFVKQ-DKEEAIEELEERIEKLEKEIKKLEKQLK   86 (106)
T ss_dssp             TT-EEEEEETTEEEEE-EHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CcchhHHHHhHHHHHh-hHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3578999999987776 4567777777777777777777766553


No 8  
>PF10260 SAYSvFN:  Uncharacterized conserved domain (SAYSvFN);  InterPro: IPR019387  This domain of approximately 75 residues contains a highly conserved SATSv/iFN motif. The function is unknown but the domain is conserved from plants to humans. 
Probab=39.73  E-value=14  Score=24.92  Aligned_cols=26  Identities=35%  Similarity=0.638  Sum_probs=20.6

Q ss_pred             ccccCCceeecccccch-----HHHHHHHHH
Q psy17760         47 PIKLGDFSVIDSEFSNI-----RERFDAEMR   72 (105)
Q Consensus        47 PIklgd~SViD~EFssi-----RERFdaEMr   72 (105)
                      |=+++-|||+...|.+|     -|+||.|||
T Consensus        41 ~ge~SAYSVFN~~~~~i~Gtl~aE~~ereir   71 (71)
T PF10260_consen   41 PGELSAYSVFNKGCERIPGTLTAEQFEREIR   71 (71)
T ss_pred             CCCccchhhhCCCccccCCCCCHHHHHHhhC
Confidence            44588899999999887     478888775


No 9  
>PF08581 Tup_N:  Tup N-terminal;  InterPro: IPR013890  The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor []. ; PDB: 3VP9_B 3VP8_B.
Probab=39.72  E-value=23  Score=23.89  Aligned_cols=14  Identities=43%  Similarity=0.790  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHhhcc
Q psy17760         75 EDEMTKFRSELMNR   88 (105)
Q Consensus        75 EEEM~kFRselmnr   88 (105)
                      |||+.++|.+|.++
T Consensus        63 EeEI~rLr~eLe~r   76 (79)
T PF08581_consen   63 EEEIARLRRELEQR   76 (79)
T ss_dssp             HHHHHHHHHHHCHH
T ss_pred             HHHHHHHHHHHHhh
Confidence            77788888888664


No 10 
>KOG0999|consensus
Probab=36.84  E-value=34  Score=31.91  Aligned_cols=30  Identities=23%  Similarity=0.528  Sum_probs=27.2

Q ss_pred             ccccchHHHHHHHHHhhHHHHHHHHHHhhc
Q psy17760         58 SEFSNIRERFDAEMRKMEDEMTKFRSELMN   87 (105)
Q Consensus        58 ~EFssiRERFdaEMrkMEEEM~kFRselmn   87 (105)
                      ...+|||++++.|=.-|=|-|.|+|+||-.
T Consensus       637 valtnlksKYEnEK~mvtetm~KlRnELk~  666 (772)
T KOG0999|consen  637 VALTNLKSKYENEKAMVTETMDKLRNELKA  666 (772)
T ss_pred             HHHHHhHhhhhhHHHHHHHHHHHHHHHHHH
Confidence            356899999999999999999999999976


No 11 
>PF04538 BEX:  Brain expressed X-linked like family ;  InterPro: IPR021156 This entry includes the human p75NTR-associated cell death executor (Nerve growth factor receptor associated protein 1), which may be a signalling adaptor molecule involved in p75NTR-apoptosis induced by nerve growth factor. It may be important in neurogenetic diseases. The proteins are also annotated as Brain expressed X-linked like (BEX), which is a signalling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF, which plays an role in zinc-triggered neuronal death. 
Probab=36.36  E-value=43  Score=23.53  Aligned_cols=22  Identities=41%  Similarity=0.694  Sum_probs=17.5

Q ss_pred             hHHHHHHHHHhhHHHHHHHHHHhh
Q psy17760         63 IRERFDAEMRKMEDEMTKFRSELM   86 (105)
Q Consensus        63 iRERFdaEMrkMEEEM~kFRselm   86 (105)
                      ||+  ..+|.|+.|||.+.|..|.
T Consensus        66 ~r~--~ddmeR~~eE~R~~r~Kl~   87 (100)
T PF04538_consen   66 IRE--GDDMERFMEEMRKLRQKLR   87 (100)
T ss_pred             hHh--hhhHHHHHHHHHHHHHHhc
Confidence            676  5688888888888888775


No 12 
>KOG3189|consensus
Probab=35.71  E-value=39  Score=27.92  Aligned_cols=25  Identities=28%  Similarity=0.604  Sum_probs=19.1

Q ss_pred             hhhhhhhhhcccCccccccccCCceeec
Q psy17760         30 FPRLCLTSMADSGKRNIPIKLGDFSVID   57 (105)
Q Consensus        30 ~~~~~~~~Ma~~~kr~IPIklgd~SViD   57 (105)
                      +-..||.-||   ..++|||.|.|-=+-
T Consensus       104 liNF~LrYls---didlPiKRGtFiEFR  128 (252)
T KOG3189|consen  104 LINFCLRYLS---DIDLPIKRGTFIEFR  128 (252)
T ss_pred             HHHHHHHHHH---hcCCcccccceEEec
Confidence            3456899997   478999999986443


No 13 
>PF05582 Peptidase_U57:  YabG peptidase U57;  InterPro: IPR008764 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.   The peptidases families associated with clan U- have an unknown catalytic mechanism as the protein fold of the active site domain and the active site residues have not been reported. This is a group of peptidases belong to MEROPS peptidase family U57 (clan U-). The type example is the YabG protein of Bacillus subtilis. This is a protease involved in the synthesis and maturation of the spore coat proteins SpoIVA and YrbA of B. subtilis [].
Probab=32.08  E-value=65  Score=26.79  Aligned_cols=67  Identities=18%  Similarity=0.314  Sum_probs=42.0

Q ss_pred             eeeEEEEEEeecccccccccchhhhhhhhhcccCccccccccCCceeecccccchHHHHHHHHHhhHHHHHHHHHHhh
Q psy17760          9 KFYIKVVEVRECLSVSDFSSVFPRLCLTSMADSGKRNIPIKLGDFSVIDSEFSNIRERFDAEMRKMEDEMTKFRSELM   86 (105)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ma~~~kr~IPIklgd~SViD~EFssiRERFdaEMrkMEEEM~kFRselm   86 (105)
                      ..+.||+++.+.-.  .=.-+.--+.+--+||++       +.|+.++|.+-  ++++=..+++++++-|.+++.+-.
T Consensus        15 DI~FrIidI~~~~g--~~~aiLkG~d~RLiADAP-------~~DL~~v~~~e--~~~~~~~~~~~~~~~~~~~~~~r~   81 (287)
T PF05582_consen   15 DILFRIIDIKEENG--KKIAILKGLDMRLIADAP-------LDDLVKVDEEE--VREYEKRFNEKVNESLRRIRQDRK   81 (287)
T ss_pred             ceEEEEEEEEcCCC--ceEEEEeCCceEEEecCC-------HHHcccCCHHH--HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34667888877111  001112222333368877       77888888753  455555678899999999998876


No 14 
>PF08172 CASP_C:  CASP C terminal;  InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins. These are Golgi membrane proteins which are thought to have a role in vesicle transport [].; GO: 0006891 intra-Golgi vesicle-mediated transport, 0030173 integral to Golgi membrane
Probab=31.11  E-value=67  Score=25.32  Aligned_cols=24  Identities=25%  Similarity=0.493  Sum_probs=15.1

Q ss_pred             cchHHHHHHHHHhhHHHHHHHHHH
Q psy17760         61 SNIRERFDAEMRKMEDEMTKFRSE   84 (105)
Q Consensus        61 ssiRERFdaEMrkMEEEM~kFRse   84 (105)
                      ++=||||-+-...+|+|+.+...+
T Consensus        85 tsQRDRFR~Rn~ELE~elr~~~~~  108 (248)
T PF08172_consen   85 TSQRDRFRQRNAELEEELRKQQQT  108 (248)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            445999976666666665554443


No 15 
>PF05890 Ebp2:  Eukaryotic rRNA processing protein EBP2;  InterPro: IPR008610 This family consists of several eukaryotic rRNA processing protein EBP2 sequences. Ebp2p is required for the maturation of 25S rRNA and 60S subunit assembly. Ebp2p may be one of the target proteins of Rrs1p for executing the signal to regulate ribosome biogenesis [].
Probab=27.70  E-value=41  Score=26.88  Aligned_cols=23  Identities=35%  Similarity=0.577  Sum_probs=20.7

Q ss_pred             HHHHHHhhHHHHHHHHHHhhccc
Q psy17760         67 FDAEMRKMEDEMTKFRSELMNRE   89 (105)
Q Consensus        67 FdaEMrkMEEEM~kFRselmnrE   89 (105)
                      |-|||=|=++-|.|.|..|+..+
T Consensus       109 YfAEMvKSD~HM~KVr~kLl~~~  131 (271)
T PF05890_consen  109 YFAEMVKSDEHMEKVRQKLLKEQ  131 (271)
T ss_pred             chHHHhcCHHHHHHHHHHHHHHH
Confidence            56999999999999999999854


No 16 
>COG5132 BUD31 Cell cycle control protein, G10 family [Transcription / Cell division and chromosome partitioning]
Probab=27.34  E-value=29  Score=26.68  Aligned_cols=22  Identities=45%  Similarity=0.762  Sum_probs=17.5

Q ss_pred             ccccchH---HHHHHHHHhhHHHHH
Q psy17760         58 SEFSNIR---ERFDAEMRKMEDEMT   79 (105)
Q Consensus        58 ~EFssiR---ERFdaEMrkMEEEM~   79 (105)
                      ++|..||   +.|++|||..|..|.
T Consensus        14 dgFeki~ptL~~fe~~mRqaen~~~   38 (146)
T COG5132          14 DGFEKIRPTLEKFEAEMRQAENAPL   38 (146)
T ss_pred             cchhhhcchHHHHHHHHHHHhcCCC
Confidence            5676666   789999999998764


No 17 
>PF13348 Y_phosphatase3C:  Tyrosine phosphatase family C-terminal region; PDB: 1YWF_A 2OZ5_B.
Probab=26.90  E-value=32  Score=20.78  Aligned_cols=34  Identities=18%  Similarity=0.517  Sum_probs=25.4

Q ss_pred             ceeecccccchHHHHHHHHHhhHHHHHHHHHHhh
Q psy17760         53 FSVIDSEFSNIRERFDAEMRKMEDEMTKFRSELM   86 (105)
Q Consensus        53 ~SViD~EFssiRERFdaEMrkMEEEM~kFRselm   86 (105)
                      +..|+..|||+..=+.+++.==+++..++|..++
T Consensus        35 l~~i~~~yGs~e~Yl~~~lgl~~~~i~~Lr~~lL   68 (68)
T PF13348_consen   35 LDAIDERYGSVENYLREELGLSEEDIERLRERLL   68 (68)
T ss_dssp             HHHHHHHHSSHHHHHHHT-T--HHHHHHHHHHHC
T ss_pred             HHHHHHHcCCHHHHHHHcCCCCHHHHHHHHHHcC
Confidence            4567888999888888888888889999998764


No 18 
>PF05308 Mito_fiss_reg:  Mitochondrial fission regulator;  InterPro: IPR007972 This family consists of several uncharacterised eukaryotic proteins of unknown function.
Probab=26.53  E-value=69  Score=25.50  Aligned_cols=19  Identities=32%  Similarity=0.772  Sum_probs=15.1

Q ss_pred             HHHHh---hHHHHHHHHHHhhc
Q psy17760         69 AEMRK---MEDEMTKFRSELMN   87 (105)
Q Consensus        69 aEMrk---MEEEM~kFRselmn   87 (105)
                      +-++|   +|+|++++|+++-.
T Consensus       119 ~AlqKIsALEdELs~LRaQIA~  140 (253)
T PF05308_consen  119 AALQKISALEDELSRLRAQIAK  140 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            44566   89999999999743


No 19 
>smart00595 MADF subfamily of SANT domain.
Probab=25.96  E-value=56  Score=20.12  Aligned_cols=22  Identities=18%  Similarity=0.665  Sum_probs=18.0

Q ss_pred             cccccchHHHHHHHHHhhHHHH
Q psy17760         57 DSEFSNIRERFDAEMRKMEDEM   78 (105)
Q Consensus        57 D~EFssiRERFdaEMrkMEEEM   78 (105)
                      =.-+.+||.+|..|++++....
T Consensus        45 ~~kw~~LR~~y~~e~~r~~~~~   66 (89)
T smart00595       45 KKRWKNLRDRYRRELKRLQNGK   66 (89)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhh
Confidence            3568899999999999987654


No 20 
>PF02096 60KD_IMP:  60Kd inner membrane protein;  InterPro: IPR001708  This family of proteins is required for the insertion of integral membrane proteins into cellular membranes. Many of these integral membrane proteins are associated with respiratory chain complexes, for example a large number of members of this family play an essential role in the activity and assembly of cytochrome c oxidase.   Stage III sporulation protein J (SP3J) is a probable lipoprotein, rich in basic and hydrophobic amino acids. Mutations in the protein abolish the transcription of prespore-specific genes transcribed by the sigma G form of RNA polymerase []. SP3J could be involved in a signal transduction pathway coupling gene expression in the prespore to events in the mother cell, or it may be necessary for essential metabolic interactions between the two cells []. The protein shows a high degree of similarity to Bacillus subtilis YQJG, to yeast OXA1 and also to bacterial 60 kDa inner-membrane proteins [, , , ]. ; GO: 0051205 protein insertion into membrane, 0016021 integral to membrane
Probab=25.66  E-value=93  Score=22.09  Aligned_cols=27  Identities=30%  Similarity=0.621  Sum_probs=21.5

Q ss_pred             ccccchHHHHHHHHHhhHHHHHHHHHH
Q psy17760         58 SEFSNIRERFDAEMRKMEDEMTKFRSE   84 (105)
Q Consensus        58 ~EFssiRERFdaEMrkMEEEM~kFRse   84 (105)
                      .|-..|++|+.++++++-+|+.++..+
T Consensus        37 P~l~~i~~k~~~~~~~~~~~~~~l~k~   63 (198)
T PF02096_consen   37 PELKEIQEKYKEDQQKMQQEMQKLYKK   63 (198)
T ss_pred             HHHHHHHHhhhHHHHHHHHHHHHHHHH
Confidence            444588999988888888888888765


No 21 
>PF09340 NuA4:  Histone acetyltransferase subunit NuA4;  InterPro: IPR015418 The NuA4 histone acetyltransferase (HAT) multisubunit complex is responsible for acetylation of histone H4 and H2A N-terminal tails in yeast []. NuA4 complexes are highly conserved in eukaryotes and play primary roles in transcription, cellular response to DNA damage, and cell cycle control []. 
Probab=25.12  E-value=45  Score=22.15  Aligned_cols=27  Identities=11%  Similarity=0.576  Sum_probs=13.5

Q ss_pred             HhhHHHHHHHHHHhhcccccceeccCC
Q psy17760         72 RKMEDEMTKFRSELMNRESNFFKTSTR   98 (105)
Q Consensus        72 rkMEEEM~kFRselmnrEsnfF~~t~~   98 (105)
                      +++|++++..-.+.-+.|...+..++.
T Consensus        12 ~~Le~~L~~lE~qIy~~Et~YL~~~~~   38 (80)
T PF09340_consen   12 KKLEKDLAALEKQIYDKETSYLEDTSP   38 (80)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHccCc
Confidence            344555555555555555555553333


No 22 
>KOG3866|consensus
Probab=23.87  E-value=64  Score=28.41  Aligned_cols=19  Identities=32%  Similarity=0.672  Sum_probs=16.7

Q ss_pred             HHHHhhHHHHHHHHHHhhc
Q psy17760         69 AEMRKMEDEMTKFRSELMN   87 (105)
Q Consensus        69 aEMrkMEEEM~kFRselmn   87 (105)
                      ..|+.|||||-|.|.-.|+
T Consensus       285 DDM~EmeEErlRMREHVMk  303 (442)
T KOG3866|consen  285 DDMKEMEEERLRMREHVMK  303 (442)
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            4699999999999988886


No 23 
>cd08049 TAF8 TATA Binding Protein (TBP) Associated Factor 8. The TATA Binding Protein (TBP) Associated Factor 8 (TAF8) is one of several TAFs that bind TBP, and is involved in forming the Transcription Factor IID (TFIID) complex. TFIID is one of seven General Transcription Factors (GTF) (TFIIA, TFIIB, TFIID, TFIIE, TFIIF, and TFIID) that are involved in accurate initiation of transcription by RNA polymerase II in eukaryotes. TFIID plays an important role in the recognition of promoter DNA and the assembly of the preinitiation complex. The TFIID complex is composed of the TBP and at least 13 TAFs. TAFs from various species were originally named by their predicted molecular weight or their electrophoretic mobility in polyacrylamide gels. A new, unified nomenclature for the pol II TAFs has been suggested to show the relationship between TAF orthologs and paralogs. Several hypotheses are proposed for TAFs' functions, such as serving as activator-binding sites, involvement in the core-promo
Probab=23.76  E-value=1.1e+02  Score=18.76  Aligned_cols=29  Identities=14%  Similarity=0.322  Sum_probs=25.2

Q ss_pred             eecccccchHHHHHHHHHhhHHHHHHHHH
Q psy17760         55 VIDSEFSNIRERFDAEMRKMEDEMTKFRS   83 (105)
Q Consensus        55 ViD~EFssiRERFdaEMrkMEEEM~kFRs   83 (105)
                      ..+++...||++=.+|=|++|+.+.+|-.
T Consensus        24 ~~~~d~~~~r~~~~~~~r~~e~aL~~l~~   52 (54)
T cd08049          24 ERETDPKKLREELASQRRLAEKALLRLQQ   52 (54)
T ss_pred             CCccCHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            36778899999999999999999988743


No 24 
>PF13801 Metal_resist:  Heavy-metal resistance; PDB: 3EPV_C 2Y3D_A 2Y3H_D 2Y3G_B 2Y3B_A 2Y39_A 3LAY_H.
Probab=23.29  E-value=1.3e+02  Score=18.24  Aligned_cols=29  Identities=28%  Similarity=0.503  Sum_probs=21.7

Q ss_pred             cccchHHHHHHHHHhhHHHHHHHHHHhhc
Q psy17760         59 EFSNIRERFDAEMRKMEDEMTKFRSELMN   87 (105)
Q Consensus        59 EFssiRERFdaEMrkMEEEM~kFRselmn   87 (105)
                      ++..+.+.|-.+++.+..+|...|.++..
T Consensus        49 ~l~~~~~~~~~~~~~~r~~~~~~r~~l~~   77 (125)
T PF13801_consen   49 KLRALMDEFRQEMRALRQELRAARQELRA   77 (125)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35567777888888888888888877643


No 25 
>PF10406 TAF8_C:  Transcription factor TFIID complex subunit 8 C-term ;  InterPro: IPR019473  This entry represents the C-terminal region of subunit 8 (also known as TAF8) of the transcription factor TFIID []. The adjacent N-terminal region generally contains a histone fold domain (IPR006565 from INTERPRO). This subunit is one of the key subunits of TFIID, being one of several general cofactors which are typically involved in gene activation to bring about the communication between gene-specific transcription factors and components of the general transcription machinery []. 
Probab=22.82  E-value=1.1e+02  Score=18.76  Aligned_cols=27  Identities=22%  Similarity=0.325  Sum_probs=23.4

Q ss_pred             eecccccchHHHHHHHHHhhHHHHHHH
Q psy17760         55 VIDSEFSNIRERFDAEMRKMEDEMTKF   81 (105)
Q Consensus        55 ViD~EFssiRERFdaEMrkMEEEM~kF   81 (105)
                      .-+++...+|+|-.+|=|+.|+.+.+|
T Consensus        24 ~~~~d~~~~r~~~~~~~r~~e~aL~~l   50 (51)
T PF10406_consen   24 ERETDPKKIREKAAEQSRLAEKALRKL   50 (51)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHh
Confidence            446678899999999999999999876


No 26 
>cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly.  The complex contains two alpha and four beta subunits, the two subunits being evolutionarily related. In archaea, there is usually only one gene for each subunit while in eukaryotes there two or more paralogous genes encoding each subunit adding heterogeneity to the structure of the hexamer. The structure of the complex consists of a double beta barrel assembly with six protruding coiled-coils.
Probab=22.71  E-value=2e+02  Score=18.60  Aligned_cols=26  Identities=15%  Similarity=0.229  Sum_probs=15.7

Q ss_pred             ccccccccC-CceeecccccchHHHHHH
Q psy17760         43 KRNIPIKLG-DFSVIDSEFSNIRERFDA   69 (105)
Q Consensus        43 kr~IPIklg-d~SViD~EFssiRERFda   69 (105)
                      ..+|.|.+| ++.|- -....-.+.++.
T Consensus        68 ~~~v~v~iG~~~~ve-~~~~eA~~~l~~   94 (129)
T cd00890          68 DDKVLVDLGTGVYVE-KSLEEAIEFLKK   94 (129)
T ss_pred             CCEEEEEecCCEEEE-ecHHHHHHHHHH
Confidence            557999999 87775 333333344433


No 27 
>KOG0894|consensus
Probab=22.69  E-value=35  Score=28.12  Aligned_cols=22  Identities=41%  Similarity=0.676  Sum_probs=16.4

Q ss_pred             EEeecccccccc--cchhhhhhhh
Q psy17760         16 EVRECLSVSDFS--SVFPRLCLTS   37 (105)
Q Consensus        16 ~~~~~~~~~~~~--~~~~~~~~~~   37 (105)
                      .-|-|||.|||-  |.-|-.|..+
T Consensus        83 ntRLCLSiSDfHPdsWNP~WsVSt  106 (244)
T KOG0894|consen   83 NTRLCLSISDFHPDSWNPGWSVST  106 (244)
T ss_pred             CceEEEeccccCcCcCCCcccHHH
Confidence            458899999995  6677776543


No 28 
>PF13864 Enkurin:  Calmodulin-binding
Probab=22.31  E-value=1.1e+02  Score=20.25  Aligned_cols=22  Identities=18%  Similarity=0.554  Sum_probs=18.6

Q ss_pred             chHHHHHHHHHhhHHHHHHHHH
Q psy17760         62 NIRERFDAEMRKMEDEMTKFRS   83 (105)
Q Consensus        62 siRERFdaEMrkMEEEM~kFRs   83 (105)
                      +=|+..++||+.+|+.+..|..
T Consensus        74 ~rK~~lE~~L~qlE~dI~~lsr   95 (98)
T PF13864_consen   74 RRKEELEKELKQLEKDIKKLSR   95 (98)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcc
Confidence            4478899999999999998853


No 29 
>PF09551 Spore_II_R:  Stage II sporulation protein R (spore_II_R);  InterPro: IPR014202  This entry is designated stage II sporulation protein R. A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species. SpoIIR is a signalling protein that links the activation of sigma E to the transcriptional activity of sigma F during sporulation [, ].
Probab=22.06  E-value=27  Score=25.73  Aligned_cols=15  Identities=27%  Similarity=0.851  Sum_probs=11.7

Q ss_pred             cccchhhhhhhhhcc
Q psy17760         26 FSSVFPRLCLTSMAD   40 (105)
Q Consensus        26 ~~~~~~~~~~~~Ma~   40 (105)
                      +--+||.||.+.++.
T Consensus       114 WCVLfPpLCf~d~~~  128 (130)
T PF09551_consen  114 WCVLFPPLCFVDATN  128 (130)
T ss_pred             EEEecCCceeeeccc
Confidence            345899999998764


No 30 
>PF14988 DUF4515:  Domain of unknown function (DUF4515)
Probab=21.83  E-value=1e+02  Score=23.56  Aligned_cols=27  Identities=33%  Similarity=0.694  Sum_probs=23.5

Q ss_pred             cccchHHHHHHHHHhhHHHHHHHHHHh
Q psy17760         59 EFSNIRERFDAEMRKMEDEMTKFRSEL   85 (105)
Q Consensus        59 EFssiRERFdaEMrkMEEEM~kFRsel   85 (105)
                      +|..+|+.=+.||+.+++|+.+-+.+-
T Consensus        75 ~~~~~k~~qe~eI~~Le~e~~~~~~e~  101 (206)
T PF14988_consen   75 EFRRLKEQQEREIQTLEEELEKMRAEH  101 (206)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            688899999999999999999877653


No 31 
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism]
Probab=20.76  E-value=55  Score=30.34  Aligned_cols=17  Identities=59%  Similarity=0.814  Sum_probs=13.2

Q ss_pred             cccccchHHHHHHHHHhh
Q psy17760         57 DSEFSNIRERFDAEMRKM   74 (105)
Q Consensus        57 D~EFssiRERFdaEMrkM   74 (105)
                      |.==..||||| +|+|||
T Consensus       446 DivK~Gi~ERf-~elR~M  462 (681)
T COG2216         446 DIVKPGIKERF-AELRKM  462 (681)
T ss_pred             hhcchhHHHHH-HHHHhc
Confidence            44457899999 589988


No 32 
>PRK05729 valS valyl-tRNA synthetase; Reviewed
Probab=20.45  E-value=93  Score=27.83  Aligned_cols=28  Identities=25%  Similarity=0.440  Sum_probs=20.9

Q ss_pred             ccchHHHHHHHHHhhHHHHHHHHHHhhc
Q psy17760         60 FSNIRERFDAEMRKMEDEMTKFRSELMN   87 (105)
Q Consensus        60 FssiRERFdaEMrkMEEEM~kFRselmn   87 (105)
                      +..-++|...|+.++|.|+.+....|-|
T Consensus       809 ~~~e~~rL~K~l~kl~~ei~~~~~kL~n  836 (874)
T PRK05729        809 VEAELARLEKELAKLEKEIERVEKKLSN  836 (874)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhCC
Confidence            4566778888888888888887777765


Done!