Diaphorina citri psyllid: psy17761


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MSFDGTFNDAHGLRTPVSGPPSVVWRVEVESSVFAGLIYEETRGVLKVVLENVIRDAVTYPRHAKRQTGHQRMDSRLRAKTSRPHPCTVLAG
ccccccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcEEcccccccccCCcccccEEcccccccccEEEEcc
***DGTFNDAHGLRTPVSGPPSVVWRVEVESSVFAGLIYEETRGVLKVVLENVIRDAVTYPRHAKRQTGHQRMDSRLRAKTSRPHPCTVLA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFDGTFNDAHGLRTPVSGPPSVVWRVEVESSVFAGLIYEETRGVLKVVLENVIRDAVTYPRHAKRQTGHQRMDSRLRAKTSRPHPCTVLAG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045653 [BP]negative regulation of megakaryocyte differentiationprobableGO:0051093, GO:0050793, GO:0045652, GO:0045595, GO:0050794, GO:0050789, GO:0045596, GO:0045638, GO:0065007, GO:0002682, GO:0008150, GO:0051239, GO:0048519, GO:2000026, GO:0045637, GO:0048523
GO:0000786 [CC]nucleosomeprobableGO:0005575, GO:0032991, GO:0043232, GO:0032993, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006334 [BP]nucleosome assemblyprobableGO:0034728, GO:0071103, GO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0016043, GO:0031497, GO:0034622, GO:0044699, GO:0071824, GO:0006139, GO:0044260, GO:0006325, GO:1901360, GO:0006323, GO:0065003, GO:0071704, GO:0071840, GO:0065004, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0046483, GO:0006996, GO:0044238, GO:0051276, GO:0006333, GO:0044237, GO:0043170, GO:0044085, GO:0006259, GO:0008150
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HUE, chain C
Confidence level:very confident
Coverage over the Query: 20-84
View the alignment between query and template
View the model in PyMOL