Query         psy17767
Match_columns 64
No_of_seqs    110 out of 325
Neff          5.5 
Searched_HMMs 46136
Date          Fri Aug 16 22:19:04 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17767.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17767hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0938|consensus               99.7 5.9E-17 1.3E-21  119.1   6.4   56    1-56    371-428 (446)
  2 KOG0937|consensus               99.5 4.5E-14 9.7E-19  105.0   6.5   60    1-60    347-409 (424)
  3 PF00928 Adap_comp_sub:  Adapto  98.7 2.3E-08   5E-13   67.8   5.7   51    2-52    187-239 (262)
  4 KOG2740|consensus               93.0    0.13 2.9E-06   38.8   3.6   47    4-51    349-396 (418)
  5 KOG2677|consensus               78.2     3.5 7.6E-05   33.7   3.9   48    4-51    823-871 (922)
  6 PF10291 muHD:  Muniscin C-term  68.7      14  0.0003   25.9   4.7   37    7-47    189-227 (257)
  7 PF11604 CusF_Ec:  Copper bindi  54.1      18 0.00038   20.5   2.6   30   13-43     13-44  (70)
  8 PF07795 DUF1635:  Protein of u  52.1     5.3 0.00011   28.0   0.2   21   20-40    155-177 (214)
  9 PF00942 CBM_3:  Cellulose bind  43.8      28 0.00061   20.1   2.4   19   29-47     15-39  (86)
 10 COG4834 Uncharacterized protei  29.5      21 0.00045   26.4   0.3   18   31-48    307-326 (334)
 11 PF12991 DUF3875:  Domain of un  24.3      76  0.0016   17.8   1.9   17   25-41     26-46  (54)
 12 cd08342 HPPD_N_like N-terminal  23.7      77  0.0017   18.9   2.1   23   39-64    113-136 (136)
 13 PRK09838 periplasmic copper-bi  22.6      53  0.0012   20.6   1.2   23   21-43     66-90  (115)
 14 PF14400 Transglut_i_TM:  Inact  21.6 2.6E+02  0.0056   18.6   4.6   18   27-44     32-49  (165)
 15 COG3700 AphA Acid phosphatase   20.8      66  0.0014   22.7   1.5   19   25-43     60-82  (237)

No 1  
>KOG0938|consensus
Probab=99.68  E-value=5.9e-17  Score=119.09  Aligned_cols=56  Identities=46%  Similarity=0.718  Sum_probs=50.5

Q ss_pred             CCCCcEEEEEEEEEecccc-ccccCCCCCeEEEEEee-cccccceEeEEEEeeecccC
Q psy17767          1 MAGMKETQLSAEIELLETD-TKKKWTRPPISMNFEVP-FAPSGFKVSHLSEILILLLS   56 (64)
Q Consensus         1 ~~G~~E~~L~a~v~L~s~~-~~~~~~~pPI~l~FeIP-~t~SGLqVryLkV~e~~~~~   56 (64)
                      |.|.+|.+|+|+++|.++. +.+.|.+|||+|+|||| |+.|||.||||||.|+..-+
T Consensus       371 f~G~tE~tlsAevels~Tt~nkq~WtrPPIsleFeV~MFt~SGL~VrylkV~e~~Sk~  428 (446)
T KOG0938|consen  371 FNGLTESTLSAEVELSDTTQNKQQWTRPPISLEFEVPMFTNSGLVVRYLKVSEKDSKH  428 (446)
T ss_pred             cCCcccceeEEEEEeccCccccccccCCCceeEEeeeeecCCceEEEEEEEecccCCC
Confidence            6899999999999997765 78899999999999999 99999999999999954433


No 2  
>KOG0937|consensus
Probab=99.50  E-value=4.5e-14  Score=104.95  Aligned_cols=60  Identities=30%  Similarity=0.369  Sum_probs=53.0

Q ss_pred             CCCCcEEEEEEEEEeccccccc-cC-CCCCeEEEEEee-cccccceEeEEEEeeecccCCCCC
Q psy17767          1 MAGMKETQLSAEIELLETDTKK-KW-TRPPISMNFEVP-FAPSGFKVSHLSEILILLLSPEGP   60 (64)
Q Consensus         1 ~~G~~E~~L~a~v~L~s~~~~~-~~-~~pPI~l~FeIP-~t~SGLqVryLkV~e~~~~~~~~~   60 (64)
                      |+||.|+.++|++.+++....+ .| +.+||+|+|+|| ||+||+||||||+.|+.+.+.++|
T Consensus       347 ~~gg~e~~~r~~~~lp~~~~e~~~~~~~~pi~v~FeIp~~T~SgiqVrylki~ep~~~y~s~~  409 (424)
T KOG0937|consen  347 FVGGKEYSLRARMDLPSEEHEEQCTEGLGPIKVKFEIPYFTVSGIQVRYLKIIEPKSQYQSLP  409 (424)
T ss_pred             ccCCceEEEEEeecCCccccCCCCcccCCceEEEEEecccccCCeEEEEEEecccccCCCccc
Confidence            5799999999999998865555 35 699999999999 999999999999999888887776


No 3  
>PF00928 Adap_comp_sub:  Adaptor complexes medium subunit family;  InterPro: IPR008968 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. These vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transport []. Clathrin coats contain both clathrin (acts as a scaffold) and adaptor complexes that link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. The two major types of clathrin adaptor complexes are the heterotetrameric adaptor protein (AP) complexes, and the monomeric GGA (Golgi-localising, Gamma-adaptin ear domain homology, ARF-binding proteins) adaptors [, ]. AP (adaptor protein) complexes are found in coated vesicles and clathrin-coated pits. AP complexes connect cargo proteins and lipids to clathrin at vesicle budding sites, as well as binding accessory proteins that regulate coat assembly and disassembly (such as AP180, epsins and auxilin). There are different AP complexes in mammals. AP1 is responsible for the transport of lysosomal hydrolases between the TGN and endosomes []. AP2 associates with the plasma membrane and is responsible for endocytosis []. AP3 is responsible for protein trafficking to lysosomes and other related organelles []. AP4 is less well characterised. AP complexes are heterotetramers composed of two large subunits (adaptins), a medium subunit (mu) and a small subunit (sigma). For example, in AP1 these subunits are gamma-1-adaptin, beta-1-adaptin, mu-1 and sigma-1, while in AP2 they are alpha-adaptin, beta-2-adaptin, mu-2 and sigma-2. Each subunit has a specific function. Adaptins recognise and bind to clathrin through their hinge region (clathrin box), and recruit accessory proteins that modulate AP function through their C-terminal ear (appendage) domains. Mu recognises tyrosine-based sorting signals within the cytoplasmic domains of transmembrane cargo proteins []. One function of clathrin and AP2 complex-mediated endocytosis is to regulate the number of GABA(A) receptors available at the cell surface [].  This entry represents the C-terminal domain of the mu subunit from various clathrin adaptors (AP1, AP2 and AP3) []. The C-teminal domain has an immunoglobulin-like beta-sandwich fold consisting of 9 strands in 2 sheets with a Greek key topology, similar to that found in cytochrome f and certain transcription factors []. The mu subunit regulates the coupling of clathrin lattices with particular membrane proteins by self-phosphorylation via a mechanism that is still unclear []. The mu subunit possesses a highly conserved N-terminal domain of around 230 amino acids, which may be the region of interaction with other AP proteins; a linker region of between 10 and 42 amino acids; and a less well-conserved C-terminal domain of around 190 amino acids, which may be the site of specific interaction with the protein being transported in the vesicle []. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030131 clathrin adaptor complex; PDB: 1H6E_A 3L81_A 1W63_V 4EMZ_A 4EN2_A 2VGL_M 3ML6_F 2PR9_A 2JKT_M 1I31_A ....
Probab=98.74  E-value=2.3e-08  Score=67.84  Aligned_cols=51  Identities=31%  Similarity=0.561  Sum_probs=36.6

Q ss_pred             CCCcEEEEEEEEEecccccc-ccCCCCCeEEEEEee-cccccceEeEEEEeee
Q psy17767          2 AGMKETQLSAEIELLETDTK-KKWTRPPISMNFEVP-FAPSGFKVSHLSEILI   52 (64)
Q Consensus         2 ~G~~E~~L~a~v~L~s~~~~-~~~~~pPI~l~FeIP-~t~SGLqVryLkV~e~   52 (64)
                      .|++++.|++.+++...... ..|..+||+|+|++| +++|||+|++|+|.+.
T Consensus       187 ~~~~~~~l~~~l~~~~~~~~~~~~~~~pi~v~F~~~~~~~Sgl~V~~l~v~~~  239 (262)
T PF00928_consen  187 PGGSESTLSGTLEFSSPSSVPSDWSFFPISVEFTIPGYTLSGLKVRSLDVVNE  239 (262)
T ss_dssp             ETSEEEEEEEEEEEEEECCSS-S-----EEEEEEESTSETTT-EEEEEEEE-S
T ss_pred             cCcccccEEEEEEecCCCcccccccceeEEEEEEeCCcccCCCEEEEEEeEec
Confidence            57889999999999653332 245799999999999 9999999999999873


No 4  
>KOG2740|consensus
Probab=93.01  E-value=0.13  Score=38.78  Aligned_cols=47  Identities=30%  Similarity=0.311  Sum_probs=36.0

Q ss_pred             CcEEEEEEEEEeccccccccCCCCCeEEEEEee-cccccceEeEEEEee
Q psy17767          4 MKETQLSAEIELLETDTKKKWTRPPISMNFEVP-FAPSGFKVSHLSEIL   51 (64)
Q Consensus         4 ~~E~~L~a~v~L~s~~~~~~~~~pPI~l~FeIP-~t~SGLqVryLkV~e   51 (64)
                      |+-..|++.+.+.. ...+..+.|-++++|+|. -++|||.|..|++..
T Consensus       349 g~lp~Lkg~~~~e~-~~sk~~~l~t~~Lqykiqg~alsglkVe~Ldm~~  396 (418)
T KOG2740|consen  349 GKLPVLKGTINLEP-GFSKKVDLPTLSLQYKIQGQALSGLKVERLDMYG  396 (418)
T ss_pred             CcccccccccccCC-CCCccccCcccceeeeeeeeeccceEEEeeeecC
Confidence            44455666666653 334555799999999999 999999999999854


No 5  
>KOG2677|consensus
Probab=78.25  E-value=3.5  Score=33.72  Aligned_cols=48  Identities=19%  Similarity=0.156  Sum_probs=37.0

Q ss_pred             CcEEEEEEEEEeccccccccCCCCCeEEEEEee-cccccceEeEEEEee
Q psy17767          4 MKETQLSAEIELLETDTKKKWTRPPISMNFEVP-FAPSGFKVSHLSEIL   51 (64)
Q Consensus         4 ~~E~~L~a~v~L~s~~~~~~~~~pPI~l~FeIP-~t~SGLqVryLkV~e   51 (64)
                      +.-|-|.+.++|.+-..-...=.|=.+++|.+| -++|.-.||.+-|..
T Consensus       823 ~hpHcl~c~lELgSd~evPs~f~p~~~V~FsmP~t~aS~t~VRSisVE~  871 (922)
T KOG2677|consen  823 GHPHCLFCHLELGSDREVPSRFAPHVNVEFSMPTTSASKTSVRSISVED  871 (922)
T ss_pred             CCCeeEEEEEeccccccCchhhccccceeeeccccccccceeeeeeccc
Confidence            445679999999763222222367889999999 999999999999865


No 6  
>PF10291 muHD:  Muniscin C-terminal mu homology domain;  InterPro: IPR018808 The muniscins are a family of endocytic adaptors that is conserved from yeast to humans.This C-terminal domain is structurally similar to mu homology domains, and is the region of the muniscin proteins involved in the interactions with the endocytic adaptor-scaffold proteins Ede1-eps15. This interaction influences muniscin localisation. The muniscins provide a combined adaptor-membrane-tubulation activity that is important for regulating endocytosis.; PDB: 3G9H_A.
Probab=68.75  E-value=14  Score=25.87  Aligned_cols=37  Identities=19%  Similarity=0.226  Sum_probs=22.3

Q ss_pred             EEEEEEEEeccccccccCCCCCeEEEEEee--cccccceEeEE
Q psy17767          7 TQLSAEIELLETDTKKKWTRPPISMNFEVP--FAPSGFKVSHL   47 (64)
Q Consensus         7 ~~L~a~v~L~s~~~~~~~~~pPI~l~FeIP--~t~SGLqVryL   47 (64)
                      ..|.|+|.+.....    ..++|.++|++-  -+.||+.|.-.
T Consensus       189 ~kL~ARf~~~~~~~----~p~~v~vkF~~~~~~~~sg~~i~~~  227 (257)
T PF10291_consen  189 GKLIARFMTSGGPS----RPGGVEVKFEIEGGSTLSGLGISLV  227 (257)
T ss_dssp             EEEEEEEEESS--------SS-EEEEEEE---S-SS----EEE
T ss_pred             ceEEEEEECCCCCC----CCceEEEEEEEcCCCcccCcEEEEe
Confidence            68999999865211    578999999998  77999888766


No 7  
>PF11604 CusF_Ec:  Copper binding periplasmic protein CusF;  InterPro: IPR021647  CusF is a periplasmic protein involved in copper and silver resistance in Escherichia coil. CusF forms a five-stranded beta-barrel OB fold. Cu(I) binds to H36, M47 and M49 which are conserved residues in the protein []. ; PDB: 2L55_A 2VB3_X 1ZEQ_X 2QCP_X 3E6Z_X 2VB2_X.
Probab=54.14  E-value=18  Score=20.51  Aligned_cols=30  Identities=23%  Similarity=0.467  Sum_probs=17.0

Q ss_pred             EEeccccccccCCCCCeEEEEEee--cccccce
Q psy17767         13 IELLETDTKKKWTRPPISMNFEVP--FAPSGFK   43 (64)
Q Consensus        13 v~L~s~~~~~~~~~pPI~l~FeIP--~t~SGLq   43 (64)
                      +++.. ..-..|..|+..|+|.+.  -..+||+
T Consensus        13 iti~H-~pIp~l~wpaMTM~F~v~~~~~l~~l~   44 (70)
T PF11604_consen   13 ITISH-EPIPELGWPAMTMDFPVADPVDLAGLK   44 (70)
T ss_dssp             EEEEE---BCCCTB-SEEEEEE--TTSEESS-S
T ss_pred             EEEec-CccccCCCCCeEEEEEcCChhhhhcCC
Confidence            44433 334568899999999997  6667664


No 8  
>PF07795 DUF1635:  Protein of unknown function (DUF1635);  InterPro: IPR012862 The members of this family include sequences that are parts of hypothetical proteins expressed by plant species. The region in question is about 170 amino acids long. 
Probab=52.09  E-value=5.3  Score=27.99  Aligned_cols=21  Identities=29%  Similarity=0.789  Sum_probs=15.2

Q ss_pred             ccccCCCCCeEE-EEEee-cccc
Q psy17767         20 TKKKWTRPPISM-NFEVP-FAPS   40 (64)
Q Consensus        20 ~~~~~~~pPI~l-~FeIP-~t~S   40 (64)
                      ....|..||-.+ .|+|| ++++
T Consensus       155 PLP~WRnPPP~l~s~~IPpv~i~  177 (214)
T PF07795_consen  155 PLPQWRNPPPQLQSFEIPPVSIK  177 (214)
T ss_pred             CCccccCCCCccccccCCCcccc
Confidence            346799887765 59999 7754


No 9  
>PF00942 CBM_3:  Cellulose binding domain;  InterPro: IPR001956 This domain is involved in cellulose binding [] and is found associated with a wide range of bacterial glycosyl hydrolases. The structure for this domain is known []; it forms a beta sandwich.; GO: 0030246 carbohydrate binding, 0005975 carbohydrate metabolic process; PDB: 2L8A_A 4TF4_B 3TF4_B 1JS4_A 1TF4_B 1NBC_A 2YLK_A 3ZQX_A 2XFG_B 2XBT_A ....
Probab=43.81  E-value=28  Score=20.08  Aligned_cols=19  Identities=26%  Similarity=0.494  Sum_probs=11.6

Q ss_pred             eEEEEEe-----e-cccccceEeEE
Q psy17767         29 ISMNFEV-----P-FAPSGFKVSHL   47 (64)
Q Consensus        29 I~l~FeI-----P-~t~SGLqVryL   47 (64)
                      |++.|+|     | ...|.|.|||-
T Consensus        15 i~~~~~i~Ntg~~~i~Ls~l~iRYy   39 (86)
T PF00942_consen   15 IEPKFKIKNTGWPAIDLSDLKIRYY   39 (86)
T ss_dssp             EEEEEEEEETSSS-EEGGGEEEEEE
T ss_pred             EEEEEEEEECCCCCEEcCCEEEEEE
Confidence            4555555     3 56677777764


No 10 
>COG4834 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.53  E-value=21  Score=26.44  Aligned_cols=18  Identities=28%  Similarity=0.571  Sum_probs=16.5

Q ss_pred             EEEEee--cccccceEeEEE
Q psy17767         31 MNFEVP--FAPSGFKVSHLS   48 (64)
Q Consensus        31 l~FeIP--~t~SGLqVryLk   48 (64)
                      +.|.||  |-.||..|||=|
T Consensus       307 ~rfdVPge~r~~GV~~R~Pk  326 (334)
T COG4834         307 LRFDVPGEYRYSGVEFRYPK  326 (334)
T ss_pred             ccccCCceeeeccEEEecch
Confidence            899999  999999999865


No 11 
>PF12991 DUF3875:  Domain of unknown function, B. Theta Gene description (DUF3875);  InterPro: IPR024451 This domain of unknown function is found in proteins from Bacteroidetes, including the conjugation system ATPase, TraG. 
Probab=24.29  E-value=76  Score=17.81  Aligned_cols=17  Identities=35%  Similarity=0.589  Sum_probs=13.9

Q ss_pred             CCCCeEEEEEe--e--ccccc
Q psy17767         25 TRPPISMNFEV--P--FAPSG   41 (64)
Q Consensus        25 ~~pPI~l~FeI--P--~t~SG   41 (64)
                      +.+-|.+-|++  |  ||+|+
T Consensus        26 k~gDiTv~f~v~LPEiFtls~   46 (54)
T PF12991_consen   26 KNGDITVAFRVELPEIFTLSE   46 (54)
T ss_pred             cCCCEEEEEEecCCeeEEech
Confidence            46788999988  7  99886


No 12 
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS). HppD and HmaS are non-heme iron-dependent dioxygenases, which modify a common substrate, 4-hydroxyphenylpyruvate (HPP), but yield different products. HPPD catalyzes the second reaction in tyrosine catabolism, the conversion of HPP to homogentisate (2,5-dihydroxyphenylacetic acid, HG). HmaS converts HPP to 4-hydroxymandelate, a committed step in the formation of hydroxyphenylglycerine, a structural component of nonproteinogenic macrocyclic peptide antibiotics, such as vancomycin. If the emphasis is on catalytic chemistry, HPPD and HmaS are classified as members of a large family of alpha-keto acid dependent mononuclear non-heme iron oxygenases most of which require Fe(II), molecular oxygen, and an alpha-keto acid (typically alpha-ketoglutarate) to either oxygenate or oxidize a third substrate. Both enzymes are exceptions in that they require two, instead of three, su
Probab=23.65  E-value=77  Score=18.91  Aligned_cols=23  Identities=26%  Similarity=0.228  Sum_probs=12.5

Q ss_pred             cccceEeEEEEeeeccc-CCCCCCCCC
Q psy17767         39 PSGFKVSHLSEILILLL-SPEGPGFEP   64 (64)
Q Consensus        39 ~SGLqVryLkV~e~~~~-~~~~~~~~~   64 (64)
                      ..|..|..++   +.-+ -|-+|||||
T Consensus       113 p~G~~ie~~~---~~~~~~~~~~~~~~  136 (136)
T cd08342         113 YGDSLHTLVD---RKGYKGPFLPGFEP  136 (136)
T ss_pred             cCCcEEEEEe---cCCCCCccCCCCCC
Confidence            4555554443   3333 355699987


No 13 
>PRK09838 periplasmic copper-binding protein; Provisional
Probab=22.64  E-value=53  Score=20.61  Aligned_cols=23  Identities=22%  Similarity=0.286  Sum_probs=17.6

Q ss_pred             cccCCCCCeEEEEEee--cccccce
Q psy17767         21 KKKWTRPPISMNFEVP--FAPSGFK   43 (64)
Q Consensus        21 ~~~~~~pPI~l~FeIP--~t~SGLq   43 (64)
                      -..|..|+..|+|.++  --+.+|+
T Consensus        66 Ip~l~wPaMTM~F~v~~~~~l~~lk   90 (115)
T PRK09838         66 IPAVNWPEMTMRFTITPQTKMSEIK   90 (115)
T ss_pred             cccCCCCCccccccCCChhhhccCC
Confidence            4568899999999997  5455554


No 14 
>PF14400 Transglut_i_TM:  Inactive transglutaminase fused to 7 transmembrane helices
Probab=21.58  E-value=2.6e+02  Score=18.65  Aligned_cols=18  Identities=22%  Similarity=0.671  Sum_probs=13.5

Q ss_pred             CCeEEEEEeecccccceE
Q psy17767         27 PPISMNFEVPFAPSGFKV   44 (64)
Q Consensus        27 pPI~l~FeIP~t~SGLqV   44 (64)
                      .|+.++|-+|.+..|+.|
T Consensus        32 ~pvkvsl~lP~~~pgf~i   49 (165)
T PF14400_consen   32 GPVKVSLALPDTQPGFTI   49 (165)
T ss_pred             CCEEEEEcCCCCCCCeEE
Confidence            389999999866666654


No 15 
>COG3700 AphA Acid phosphatase (class B) [General function prediction only]
Probab=20.77  E-value=66  Score=22.74  Aligned_cols=19  Identities=42%  Similarity=1.008  Sum_probs=15.6

Q ss_pred             CCCCeEEEEEee----cccccce
Q psy17767         25 TRPPISMNFEVP----FAPSGFK   43 (64)
Q Consensus        25 ~~pPI~l~FeIP----~t~SGLq   43 (64)
                      .+|||.+.|.|.    |+.-|++
T Consensus        60 G~~Pi~VsFDIDDTvLFsSp~F~   82 (237)
T COG3700          60 GRPPIAVSFDIDDTVLFSSPGFW   82 (237)
T ss_pred             CCCCeeEeeccCCeeEecccccc
Confidence            599999999996    7766654


Done!