RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy17767
         (64 letters)



>gnl|CDD|211362 cd09251, AP-2_Mu2_Cterm, C-terminal domain of medium Mu2 subunit in
           ubiquitously expressed clathrin-associated adaptor
           protein (AP) complex AP-2.  AP complexes participate in
           the formation of intracellular coated transport vesicles
           and select cargo molecules for incorporation into the
           coated vesicles in the late secretory and endocytic
           pathways. There are four AP complexes, AP-1, -2, -3, and
           -4, described in various eukaryotic organisms. Each AP
           complex consists of four subunits: two large chains (one
           each of gamma/alpha/delta/epsilon and beta1-4,
           respectively), a medium mu chain (mu1-4), and a small
           sigma chain (sigma1-4). Each of the four subunits from
           the different AP complexes exhibits similarity with each
           other. This family corresponds to the C-terminal domain
           of heterotetrameric clathrin-associated adaptor protein
           complex 2 (AP-2) medium mu2 subunit. Mu2 is ubiquitously
           expressed in mammals. In higher eukaryotes, AP-2 plays a
           critical role in clathrin-mediated endocytosis from the
           plasma membrane in different cells. The
           membrane-anchored cargo molecules can be linked to the
           outer lattice of CCVs by AP-2. Those cargo molecules
           interact with adaptors through short sorting signals in
           their cytosolic segments. Tyrosine-based endocytotic
           signals are one of the most important sorting signals.
           They are of the form Y-X-X-Phi, where Y is tyrosine, X
           is any amino acid and Phi is a bulky hydrophobic residue
           that can be Leu, Ile, Met, Phe, or Val. These kinds of
           sorting signals can be recognized by the C-terminal
           domain of AP-2 mu2 subunit, also known as Y-X-X-Phi
           signal-binding domain that contains two hydrophobic
           pockets, one for the tyrosine-binding and one for the
           bulky hydrophobic residue-binding. Since the Y-X-X-Phi
           binding site is buried in the core structure of AP-2, a
           phosphorylation induced conformational change is
           required when the cargo molecules binds to AP-2. In
           addition, the C-terminal domain of mu2 subunit has been
           shown to bind other molecules. For instance, it can bind
           phosphoinositides, in particular PI[4,5]P2, which might
           be involved in the recognition process of the
           tyrosine-based signals. It can also interact with
           synaptotagmins, a family of important modulators of
           calcium-dependent neurosecretion within the synaptic
           vesicle (SV) membrane. Since many of the other endocytic
           adaptors responsible for biogenesis of synaptic vesicles
           exist, in the absence of AP-2, clathrin-mediated
           endocytosis can still occur. However, the cells may not
           survive in the complete absence of clathrin as well as
           AP-2.
          Length = 263

 Score = 72.2 bits (178), Expect = 2e-17
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 2/49 (4%)

Query: 1   MAGMKETQLSAEIELLETDT-KKKWTRPPISMNFEVP-FAPSGFKVSHL 47
             GM E+ LSAE+ELL T +  KKW+RPPISM+FEVP F  SG +V +L
Sbjct: 189 FPGMTESTLSAEVELLSTTSELKKWSRPPISMDFEVPMFTASGLRVRYL 237


>gnl|CDD|211360 cd07954, AP_MHD_Cterm, C-terminal domain of adaptor protein (AP)
           complexes medium mu subunits and its homologs (MHD).
           This family corresponds to the C-terminal domain of
           heterotetrameric AP complexes medium mu subunits and its
           homologs existing in monomeric stonins, delta-subunit of
           the heteroheptameric coat protein I (delta-COPI), a
           protein encoded by a pro-death gene referred as MuD
           (also known as MUDENG, mu-2 related death-inducing
           gene), an endocytic adaptor syp1, the mammalian FCH
           domain only proteins (FCHo1/2), SH3-containing GRB2-like
           protein 3-interacting protein 1 (SGIP1), and related
           proteins. AP complexes participate in the formation of
           intracellular coated transport vesicles and select cargo
           molecules for incorporation into the coated vesicles in
           the late secretory and endocytic pathways. Stonins have
           been characterized as clathrin-dependent AP-2 mu chain
           related factors and may act as cargo-specific sorting
           adaptors in endocytosis. Coat protein complex I
           (COPI)-coated vesicles function in the early secretory
           pathway. They mediate the retrograde transport from the
           Golgi to the ER, and intra-Golgi transport. MuD is
           distantly related to the C-terminal domain of mu2
           subunit of AP-2. It is able to induce cell death by
           itself and plays an important role in cell death in
           various tissues. Syp1 represents a novel type of
           endocytic adaptor protein that participates in
           endocytosis, promotes vesicle tabulation, and
           contributes to cell polarity and stress responses. It
           shares the same domain architecture with its two
           ubiquitously expressed mammalian counterparts, FCHo1/2,
           which represent key initial proteins ultimately
           controlling cellular nutrient uptake, receptor
           regulation, and synaptic vesicle retrieval. They bind
           specifically to the plasma membrane and recruit the
           scaffold proteins eps15 and intersectin, which
           subsequently engage the adaptor complex AP2 and
           clathrin, leading to coated vesicle formation. Another
           mammalian neuronal-specific protein SGIP1 does have a
           C-terminal MHD and has been classified into this family
           as well. It is an endophilin-interacting protein that
           plays an obligatory role in the regulation of energy
           homeostasis. It is also involved in clathrin-mediated
           endocytosis by interacting with phospholipids and eps15.
          Length = 239

 Score = 42.8 bits (101), Expect = 1e-06
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 2   AGMKETQLSAEIELLETDTKKKWTRPPISMNFEVP-FAPSGFKVSHLSEI 50
            G KE  LSA  EL     +     PP+S++FE+P    SG +V  L   
Sbjct: 171 VGGKEQSLSATFELGGLAHECPEEAPPVSLSFEIPETTGSGIQVRSLQVF 220


>gnl|CDD|216199 pfam00928, Adap_comp_sub, Adaptor complexes medium subunit family. 
           This family also contains members which are coatomer
           subunits.
          Length = 228

 Score = 41.3 bits (97), Expect = 4e-06
 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 1   MAGMKETQLSAEIELLET--DTKKKWTRPPISMNFEVP-FAPSGFKV 44
           + G KE  LS E+EL  T     K W+ PPIS+ F +P F  SG KV
Sbjct: 151 IPGGKEPTLSGELELSSTSESPSKDWSFPPISVEFSIPGFTASGLKV 197


>gnl|CDD|211361 cd09250, AP-1_Mu1_Cterm, C-terminal domain of medium Mu1 subunit in
           clathrin-associated adaptor protein (AP) complex AP-1.
           AP complexes participate in the formation of
           intracellular coated transport vesicles and select cargo
           molecules for incorporation into the coated vesicles in
           the late secretory and endocytic pathways. There are
           four AP complexes, AP-1, AP-2, AP-3, and AP-4, described
           in various eukaryotic organisms. Each AP complex
           consists of four subunits: two large chains (one each of
           gamma/alpha/delta/epsilon and beta1-4, respectively), a
           medium mu chain (mu1-4), and a small sigma chain
           (sigma1-4). Each of the four subunits from the different
           AP complexes exhibits similarity with each other. This
           family corresponds to the C-terminal domain of
           heterotetrameric clathrin-associated adaptor protein
           complex 1 (AP-1) medium mu1 subunit, which includes two
           closely related homologs, mu1A (encoded by ap1m1) and
           mu1B (encoded by ap1m2). Mu1A is ubiquitously expressed,
           but mu1B is expressed exclusively in polarized
           epithelial cells. AP-1 has been implicated in
           bi-directional transport between the trans-Golgi network
           (TGN) and endosomes. It plays an essential role in the
           formation of clathrin-coated vesicles (CCVs) from the
           trans-Golgi network (TGN). Epithelial cell-specific AP-1
           is also involved in sorting to the basolateral surface
           of polarized epithelial cells. Recruitment of AP-1 to
           the TGN membrane is regulated by a small GTPase,
           ADP-ribosylation factor 1 (ARF1).
           Phosphorylation/dephosphorylation events can also
           regulate the function of AP-1. The membrane-anchored
           cargo molecules can be linked to the outer lattice of
           CCVs by AP-1. Those cargo molecules interact with
           adaptors through short sorting signals in their
           cytosolic segments. Tyrosine-based endocytotic signals
           are one of the most important sorting signals. They are
           of the form Y-X-X-Phi, where Y is tyrosine, X is any
           amino acid and Phi is a bulky hydrophobic residue that
           can be Leu, Ile, Met, Phe, or Val. These kinds of
           sorting signals can be recognized by the C-terminal
           domain of AP-1 mu1 subunit, also known as Y-X-X-Phi
           signal-binding domain that contains two hydrophobic
           pockets, one for the tyrosine-binding and one for the
           bulky hydrophobic residue-binding.
          Length = 268

 Score = 38.7 bits (91), Expect = 3e-05
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 4/51 (7%)

Query: 1   MAGMKETQLSAEIEL---LETDTKKKWTRPPISMNFEVP-FAPSGFKVSHL 47
             G KE  + AE  L      + +    + PI + FE+P F  SG +V +L
Sbjct: 196 FPGGKEFSMRAEFGLPSIESEEEQGTEKKAPIQVKFEIPYFTVSGLQVRYL 246


>gnl|CDD|211369 cd09258, AP-1_Mu1A_Cterm, C-terminal domain of medium Mu1A subunit
           in ubiquitously expressed clathrin-associated adaptor
           protein (AP) complex AP-1.  AP complexes participate in
           the formation of intracellular coated transport vesicles
           and select cargo molecules for incorporation into the
           coated vesicles in the late secretory and endocytic
           pathways. There are four AP complexes, AP-1, AP-2, AP-3,
           and AP-4, described in various eukaryotic organisms.
           Each AP complex consists of four subunits: two large
           chains (one each of gamma/alpha/delta/epsilon and
           beta1-4, respectively), a medium mu chain (mu1-4), and a
           small sigma chain (sigma1-4). Each of the four subunits
           from the different AP complexes exhibits similarity with
           each other. This subfamily corresponds to the C-terminal
           domain of heterotetrameric clathrin-associated adaptor
           protein complex 1 (AP-1) medium mu1A subunit encoded by
           ap1m1 gene, which is ubiquitously expressed in all
           mammalian tissues and cells. AP-1 has been implicated in
           bidirectional transport between the trans-Golgi network
           (TGN) and endosomes. It is involved in the formation of
           clathrin-coated vesicles (CCVs) from the trans-Golgi
           network (TGN). The ubiquitous AP-1 is recruited to the
           TGN membrane, as well as to immature secretory granules.
           Recruitment of AP-1 to the TGN membrane is regulated by
           a small GTPase, ADP-ribosylation factor 1 (ARF1).
           Phosphorylation/dephosphorylation events can also
           regulate the function of AP-1. The membrane-anchored
           cargo molecules can be linked to the outer lattice of
           CCVs by AP-1. Those cargo molecules interact with
           adaptors through short sorting signals in their
           cytosolic segments. Tyrosine-based endocytotic signals
           are one of the most important sorting signals. They are
           of the form Y-X-X-Phi, where Y is tyrosine, X is any
           amino acid and Phi is a bulky hydrophobic residue that
           can be Leu, Ile, Met, Phe, or Val. These kinds of
           sorting signals can be recognized by the C-terminal
           domain of AP-1 mu1A subunit, also known as Y-X-X-Phi
           signal-binding domain that contains two hydrophobic
           pockets, one for the tyrosine-binding and one for the
           bulky hydrophobic residue-binding.
          Length = 270

 Score = 33.7 bits (77), Expect = 0.002
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 3   GMKETQLSAEIELLETDTKKKWTRPPISMNFEVP-FAPSGFKVSHLSEI 50
           G KE  + A   L   ++++K  RPPIS+ FE+P F  SG +V +L  I
Sbjct: 198 GGKEYLMRAHFGLPSVESEEKEGRPPISVKFEIPYFTTSGIQVRYLKII 246


>gnl|CDD|211370 cd09259, AP-1_Mu1B_Cterm, C-terminal domain of medium Mu1B subunit
           in epithelial cell-specific clathrin-associated adaptor
           protein (AP) complex AP-1.  AP complexes participate in
           the formation of intracellular coated transport vesicles
           and select cargo molecules for incorporation into the
           coated vesicles in the late secretory and endocytic
           pathways. There are four AP complexes, AP-1, AP-2, AP-3,
           and AP-4, described in various eukaryotic organisms.
           Each AP complex consists of four subunits: two large
           chains (one each of gamma/alpha/delta/epsilon and
           beta1-4, respectively), a medium mu chain (mu1-4), and a
           small sigma chain (sigma1-4). Each of the four subunits
           from different AP complexes exhibits similarity with
           each other. This subfamily corresponds to the C-terminal
           domain of heterotetrameric clathrin-associated adaptor
           protein complex 1 (AP-1) medium mu1B subunit encoded by
           ap1m2 gene exclusively expressed in polarized epithelial
           cells. Epithelial cell-specific AP-1 is used to sort
           proteins to the basolateral plasma membrane, which
           involves the formation of clathrin-coated vesicles
           (CCVs) from the trans-Golgi network (TGN). Recruitment
           of AP-1 to the TGN membrane is regulated by a small
           GTPase, ADP-ribosylation factor 1 (ARF1). The
           phosphorylation/dephosphorylation events can also
           regulate the function of AP-1. The membrane-anchored
           cargo molecules can be linked to the outer lattice of
           CCVs by AP-1. Those cargo molecules interact with
           adaptors through short sorting signals in their
           cytosolic segments. Tyrosine-based endocytotic signals
           are one of the most important sorting signals. They are
           of the form Y-X-X-Phi, where Y is tyrosine, X is any
           amino acid and Phi is a bulky hydrophobic residue that
           can be Leu, Ile, Met, Phe, or Val. These kinds of
           sorting signals can be recognized by the C-terminal
           domain of AP-1 mu1B subunit, also known as Y-X-X-Phi
           signal-binding domain that contains two hydrophobic
           pockets, one for the tyrosine-binding and one for the
           bulky hydrophobic reside-binding. Besides, AP-1 mu1B
           subunit mediates the basolateral recycling of
           low-density lipoprotein receptor (LDLR) and transferrin
           receptor (TfR) from the sorting endosomes, where the
           basolateral sorting signal does not belong to the
           tyrosine-based signals. Thus, the binding site in mu1B
           subunit of AP-1 for the signals of LDLR and TfR might be
           distinct from that for YXXPhi signals.
          Length = 264

 Score = 30.4 bits (68), Expect = 0.031
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 3   GMKETQLSAEIELLETDTKKKWTRPPISMNFEVPFAP-SGFKVSHLSEI 50
           G KE  + A   L   ++++   +PPI++ FE+P+   SG +V ++  I
Sbjct: 197 GGKEYLMRAHFGLPSVESEELEGKPPITVKFEIPYFTVSGIQVRYMKII 245


>gnl|CDD|211363 cd09252, AP-3_Mu3_Cterm, C-terminal domain of medium Mu3 subunit in
           adaptor protein (AP) complex AP-3.  AP complexes
           participate in the formation of intracellular coated
           transport vesicles and select cargo molecules for
           incorporation into the coated vesicles in the late
           secretory and endocytic pathways. There are four AP
           complexes, AP-1, AP-2, AP-3, and AP-4, described in
           various eukaryotic organisms. Each AP complex consists
           of four subunits: two large chains (one each of
           gamma/alpha/delta/epsilon and beta1-4, respectively), a
           medium mu chain (mu1-4), and a small sigma chain
           (sigma1-4). Each of the four subunits from the different
           AP complexes exhibits similarity with each other. This
           family corresponds to the C-terminal domain of
           heterotetrameric adaptor protein complex 3 (AP-3) medium
           mu3 subunit, which includes two closely related
           homologs, mu3A (P47A, encoded by ap3m1) and mu1B (P47B,
           encoded by ap3m2). Mu3A is ubiquitously expressed, but
           mu3B is specifically expressed in neurons and
           neuroendocrine cells. AP-3 is particularly important for
           targeting integral membrane proteins to lysosomes and
           lysome-related organelles at trans-Golgi network (TGN)
           and/or endosomes, such as the yeast vacuole, fly pigment
           granules and mammalian melanosomes, platelet dense
           bodies and the secretory lysosomes of cytotoxic T
           lymphocytes. Unlike AP-1 and AP-2, which function in
           conjunction with clathrin which is a scaffolding protein
           participating in the formation of coated vesicles, the
           nature of the outer shell of AP-3 containing coats
           remains to be elucidated. Membrane-anchored cargo
           molecules interact with adaptors through short sorting
           signals in their cytosolic segments. Tyrosine-based
           endocytotic signals are one of the most important
           sorting signals. They are of the form Y-X-X-Phi, where Y
           is tyrosine, X is any amino acid and Phi is a bulky
           hydrophobic residue that can be Leu, Ile, Met, Phe, or
           Val. These kinds of sorting signals can be recognized by
           the C-terminal domain of AP-3 mu3 subunit, also known as
           Y-X-X-Phi signal-binding domain that contains two
           hydrophobic pockets, one for the tyrosine-binding and
           one for the bulky hydrophobic residue-binding.
          Length = 248

 Score = 28.3 bits (64), Expect = 0.20
 Identities = 11/22 (50%), Positives = 16/22 (72%), Gaps = 1/22 (4%)

Query: 27  PPISMNFEVP-FAPSGFKVSHL 47
           P IS++F++P + PSG KV  L
Sbjct: 205 PSISVSFKIPGYLPSGLKVDSL 226


>gnl|CDD|211364 cd09253, AP-4_Mu4_Cterm, C-terminal domain of medium Mu4 subunit in
           adaptor protein (AP) complex AP-4.  AP complexes
           participate in the formation of intracellular coated
           transport vesicles and select cargo molecules for
           incorporation into the coated vesicles in the late
           secretory and endocytic pathways. There are four AP
           complexes, AP-1, AP-2, AP-3, and AP-4, described in
           various eukaryotic organisms. Each AP complex consists
           of four subunits: two large chains (one each of
           gamma/alpha/delta/epsilon and beta1-4, respectively), a
           medium mu chain (mu1-4), and a small sigma chain
           (sigma1-4). Each of the four subunits from the different
           AP complexes exhibits similarity with each other. This
           family corresponds to the C-terminal domain of
           heterotetrameric adaptor protein complex 4 (AP-4) medium
           mu4 subunit. AP-4 plays a role in signal-mediated
           trafficking of integral membrane proteins in mammalian
           cells. Unlike other AP complexes, AP-4 is found only in
           mammals and plants. It is believed to be part of a
           nonclathrin coat, since it might function independently
           of clathrin, a scaffolding protein participating in the
           formation of coated vesicles. Recruitment of AP-4 to the
           trans-Golgi network (TGN) membrane is regulated by a
           small GTPase, ADP-ribosylation factor 1 (ARF1) or a
           related protein. Membrane-anchored cargo molecules
           interact with adaptors through short sorting signals in
           their cytosolic segments. One of the most important
           sorting signals binding to mu subunits of AP complexes
           are tyrosine-based endocytotic signals, which are of the
           form Y-X-X-Phi, where Y is tyrosine, X is any amino acid
           and Phi is a bulky hydrophobic residue that can be Leu,
           Ile, Met, Phe, or Val. However, AP-4 does not bind most
           canonical tyrosine-based signals except for two
           naturally occurring ones from the lysosomal membrane
           proteins CD63 and LAMP-2a. It binds YX [FYL][FL]E motif,
           where X can be any residue, from the cytosolic tails of
           amyloid precursor protein (APP) family members in a
           distinct way.
          Length = 271

 Score = 27.9 bits (63), Expect = 0.22
 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%)

Query: 28  PISMNFEVP-FAPSGFKVSHL 47
           PIS+ FE+P +  SG +V +L
Sbjct: 223 PISLTFEIPMYNVSGLQVKYL 243


>gnl|CDD|130391 TIGR01324, cysta_beta_ly_B, cystathionine beta-lyase, bacterial.
           This model represents cystathionine beta-lyase
           (alternate name: beta-cystathionase), one of several
           pyridoxal-dependent enzymes of cysteine, methionine, and
           homocysteine metabolism. This enzyme is involved in the
           biosynthesis of Met from Cys [Amino acid biosynthesis,
           Aspartate family].
          Length = 377

 Score = 27.5 bits (61), Expect = 0.33
 Identities = 11/40 (27%), Positives = 22/40 (55%)

Query: 15  LLETDTKKKWTRPPISMNFEVPFAPSGFKVSHLSEILILL 54
           L++ +TK  +   P S+ FE+   P+  K +    I+I++
Sbjct: 131 LIQPNTKVLFLEAPSSITFEIQDIPAIAKAARNPGIVIMI 170


>gnl|CDD|237042 PRK12291, PRK12291, apolipoprotein N-acyltransferase; Reviewed.
          Length = 418

 Score = 25.3 bits (56), Expect = 2.1
 Identities = 12/24 (50%), Positives = 14/24 (58%)

Query: 31  MNFEVPFAPSGFKVSHLSEILILL 54
           +N E+ F  S F VS LS  LI L
Sbjct: 134 LNPEIFFVYSYFDVSKLSLALIFL 157


>gnl|CDD|223150 COG0072, PheT, Phenylalanyl-tRNA synthetase beta subunit
           [Translation, ribosomal structure and biogenesis].
          Length = 650

 Score = 24.5 bits (54), Expect = 4.0
 Identities = 8/21 (38%), Positives = 10/21 (47%)

Query: 11  AEIELLETDTKKKWTRPPISM 31
            EI+L     +KK    PIS 
Sbjct: 539 FEIDLDALLKRKKPAYKPISK 559


>gnl|CDD|232989 TIGR00471, pheT_arch, phenylalanyl-tRNA synthetase, beta subunit.
           Every known example of the phenylalanyl-tRNA synthetase,
           except the monomeric form of mitochondrial, is an alpha
           2 beta 2 heterotetramer. The beta subunits break into
           two subfamilies that are considerably different in
           sequence, length, and pattern of gaps. This model
           represents the subfamily that includes the beta subunit
           from eukaryotic cytosol, the Archaea, and spirochetes
           [Protein synthesis, tRNA aminoacylation].
          Length = 551

 Score = 24.3 bits (53), Expect = 5.3
 Identities = 8/18 (44%), Positives = 11/18 (61%)

Query: 27  PPISMNFEVPFAPSGFKV 44
           P +  NFE+ F  S F+V
Sbjct: 528 PEVLTNFELEFPVSAFEV 545


>gnl|CDD|184977 PRK15016, PRK15016, isochorismate synthase EntC; Provisional.
          Length = 391

 Score = 23.7 bits (51), Expect = 8.8
 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 3/35 (8%)

Query: 28  PISMNFEVPFAPSGFKVSHLSEILILLLSPEGPGF 62
           P+S NF VP A  G  +    E   LLL  +G  F
Sbjct: 176 PVSYNFHVPLADGGVLLGASPE---LLLRKDGERF 207


>gnl|CDD|177688 PLN00057, PLN00057, proliferating cell nuclear antigen;
           Provisional.
          Length = 263

 Score = 23.5 bits (51), Expect = 8.9
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 28  PISMNFEVPFAPSGFKVSHLSEILILLLSPEGP 60
           P+S+ F + +  S  K + LS+ + L LS E P
Sbjct: 202 PVSLTFALRYLNSFTKATPLSDTVTLSLSKELP 234


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.314    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0665    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,235,361
Number of extensions: 220381
Number of successful extensions: 119
Number of sequences better than 10.0: 1
Number of HSP's gapped: 118
Number of HSP's successfully gapped: 15
Length of query: 64
Length of database: 10,937,602
Length adjustment: 35
Effective length of query: 29
Effective length of database: 9,385,212
Effective search space: 272171148
Effective search space used: 272171148
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 53 (24.3 bits)