RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy17773
         (165 letters)



>gnl|CDD|216485 pfam01412, ArfGap, Putative GTPase activating protein for Arf.
           Putative zinc fingers with GTPase activating proteins
           (GAPs) towards the small GTPase, Arf. The GAP of ARD1
           stimulates GTPase hydrolysis for ARD1 but not ARFs.
          Length = 117

 Score =  100 bits (252), Expect = 3e-28
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 1/62 (1%)

Query: 65  LQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWP 124
           L+ +R ++PGN  CADC    PTWASLNLG+ +CI+C GVHR LG H+S+VRSL LD+W 
Sbjct: 4   LRELR-KLPGNKVCADCGAPNPTWASLNLGIFICIRCSGVHRSLGVHISKVRSLTLDKWT 62

Query: 125 ES 126
             
Sbjct: 63  PE 64


>gnl|CDD|214518 smart00105, ArfGap, Putative GTP-ase activating proteins for the
           small GTPase, ARF.  Putative zinc fingers with GTPase
           activating proteins (GAPs) towards the small GTPase,
           Arf. The GAP of ARD1 stimulates GTPase hydrolysis for
           ARD1 but not ARFs.
          Length = 119

 Score = 91.2 bits (227), Expect = 2e-24
 Identities = 36/61 (59%), Positives = 45/61 (73%), Gaps = 1/61 (1%)

Query: 65  LQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWP 124
           L+ +RS +PGN  C DC    PTWAS+NLG+ LCI+C G+HR LG H+S+VRSL LD W 
Sbjct: 1   LKLLRS-IPGNKKCFDCGAPNPTWASVNLGVFLCIECSGIHRSLGVHISKVRSLTLDTWT 59

Query: 125 E 125
           E
Sbjct: 60  E 60


>gnl|CDD|133303 cd04103, Centaurin_gamma, Centaurin gamma (CENTG) GTPase.  The
           centaurins (alpha, beta, gamma, and delta) are large,
           multi-domain proteins that all contain an ArfGAP domain
           and ankyrin repeats, and in some cases, numerous
           additional domains. Centaurin gamma contains an
           additional GTPase domain near its N-terminus. The
           specific function of this GTPase domain has not been
           well characterized, but centaurin gamma 2 (CENTG2) may
           play a role in the development of autism. Centaurin
           gamma 1 is also called PIKE (phosphatidyl inositol (PI)
           3-kinase enhancer) and centaurin gamma 2 is also known
           as AGAP (ArfGAP protein with a GTPase-like domain,
           ankyrin repeats and a Pleckstrin homology domain) or
           GGAP. Three isoforms of PIKE have been identified.
           PIKE-S (short) and PIKE-L (long) are brain-specific
           isoforms, with PIKE-S restricted to the nucleus and
           PIKE-L found in multiple cellular compartments. A third
           isoform, PIKE-A was identified in human glioblastoma
           brain cancers and has been found in various tissues.
           GGAP has been shown to have high GTPase activity due to
           a direct intramolecular interaction between the
           N-terminal GTPase domain and the C-terminal ArfGAP
           domain. In human tissue, AGAP mRNA was detected in
           skeletal muscle, kidney, placenta, brain, heart, colon,
           and lung. Reduced expression levels were also observed
           in the spleen, liver, and small intestine.
          Length = 158

 Score = 89.9 bits (223), Expect = 2e-23
 Identities = 33/45 (73%), Positives = 40/45 (88%)

Query: 121 DEWPESNPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQD 165
           D    SNPR+ID+ARAR+L +D+KRCSYYETCATYGLNV+RVFQ+
Sbjct: 109 DAISASNPRVIDDARARQLCADMKRCSYYETCATYGLNVERVFQE 153



 Score = 39.4 bits (92), Expect = 2e-04
 Identities = 15/22 (68%), Positives = 19/22 (86%)

Query: 1   MSHYRNAAEIPIILVGTQDSDS 22
           +S YRN +EIP+ILVGTQD+ S
Sbjct: 91  LSSYRNISEIPLILVGTQDAIS 112


>gnl|CDD|227651 COG5347, COG5347, GTPase-activating protein that regulates ARFs
           (ADP-ribosylation factors), involved in ARF-mediated
           vesicular transport [Intracellular trafficking and
           secretion].
          Length = 319

 Score = 86.8 bits (215), Expect = 6e-21
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 1/63 (1%)

Query: 65  LQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWP 124
           L+ ++     N  CADC    PTWAS+NLG+ LCI C GVHR LG H+S+V+SL LD W 
Sbjct: 11  LKLLK-SDSSNKKCADCGAPNPTWASVNLGVFLCIDCAGVHRSLGVHISKVKSLTLDNWT 69

Query: 125 ESN 127
           E  
Sbjct: 70  EEE 72


>gnl|CDD|241281 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat and PH
           domain-containing protein Pleckstrin homology (PH)
           domain.  AGAP (also called centaurin gamma;
           PIKE/Phosphatidylinositol-3-kinase enhancer) reside
           mainly in the nucleus and are known to activate
           phosphoinositide 3-kinase, a key regulator of cell
           proliferation, motility and vesicular trafficking. There
           are 3 isoforms of AGAP (PIKE-A, PIKE-L, and PIKE-S) the
           longest of which PIKE-L consists of N-terminal proline
           rich domains (PRDs), followed by a GTPase domain, a
           split PH domain (PHN and PHC), an ArfGAP domain and two
           ankyrin repeats. PIKE-S terminates after the PHN domain
           and PIKE-A is missing the PRD region. Centaurin binds
           phosphatidlyinositol (3,4,5)P3. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 114

 Score = 75.0 bits (185), Expect = 3e-18
 Identities = 29/40 (72%), Positives = 36/40 (90%)

Query: 22  SFELLIVSLDNKQWQFEAANSEERDDWIAAIQQQILSSLQ 61
           +FE +IVSLD KQW FEAA+SEERD+W+ AI+QQIL+SLQ
Sbjct: 75  AFEFIIVSLDGKQWHFEAASSEERDEWVQAIEQQILASLQ 114


>gnl|CDD|178661 PLN03114, PLN03114, ADP-ribosylation factor GTPase-activating
           protein AGD10; Provisional.
          Length = 395

 Score = 66.4 bits (161), Expect = 2e-13
 Identities = 27/49 (55%), Positives = 30/49 (61%)

Query: 75  NLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEW 123
           N  C DC    PTWAS+  G+ LCI C  VHR LG H+S VRS  LD W
Sbjct: 22  NKICFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSW 70


>gnl|CDD|215766 pfam00169, PH, PH domain.  PH stands for pleckstrin homology.
          Length = 101

 Score = 37.4 bits (87), Expect = 5e-04
 Identities = 10/36 (27%), Positives = 18/36 (50%)

Query: 21  DSFELLIVSLDNKQWQFEAANSEERDDWIAAIQQQI 56
                 I + D + +  +A + EER +W+ AI+  I
Sbjct: 65  RKNCFEIRTGDRETFLLQAESEEERKEWVKAIRSAI 100


>gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase.  RSR1/Bud1p is a member of
           the Rap subfamily of the Ras family that is found in
           fungi. In budding yeasts, RSR1 is involved in selecting
           a site for bud growth on the cell cortex, which directs
           the establishment of cell polarization. The Rho family
           GTPase cdc42 and its GEF, cdc24, then establish an axis
           of polarized growth by organizing the actin cytoskeleton
           and secretory apparatus at the bud site. It is believed
           that cdc42 interacts directly with RSR1 in vivo. In
           filamentous fungi, polar growth occurs at the tips of
           hypha and at novel growth sites along the extending
           hypha. In Ashbya gossypii, RSR1 is a key regulator of
           hyphal growth, localizing at the tip region and
           regulating in apical polarization of the actin
           cytoskeleton. Most Ras proteins contain a lipid
           modification site at the C-terminus, with a typical
           sequence motif CaaX, where a = an aliphatic amino acid
           and X = any amino acid. Lipid binding is essential for
           membrane attachment, a key feature of most Ras proteins.
          Length = 168

 Score = 37.1 bits (86), Expect = 0.001
 Identities = 12/39 (30%), Positives = 16/39 (41%)

Query: 127 NPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQD 165
           + R +       L+       +YET A    NVD VF D
Sbjct: 120 DDRQVSREDGVSLSQQWGNVPFYETSARKRTNVDEVFID 158


>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain.  Domain commonly found
           in eukaryotic signalling proteins. The domain family
           possesses multiple functions including the abilities to
           bind inositol phosphates, and various proteins. PH
           domains have been found to possess inserted domains
           (such as in PLC gamma, syntrophins) and to be inserted
           within other domains. Mutations in Brutons tyrosine
           kinase (Btk) within its PH domain cause X-linked
           agammaglobulinaemia (XLA) in patients. Point mutations
           cluster into the positively charged end of the molecule
           around the predicted binding site for
           phosphatidylinositol lipids.
          Length = 102

 Score = 35.6 bits (82), Expect = 0.002
 Identities = 10/30 (33%), Positives = 18/30 (60%)

Query: 27  IVSLDNKQWQFEAANSEERDDWIAAIQQQI 56
           I + D K    +A + EER+ W+ A+++ I
Sbjct: 72  IKTSDRKTLLLQAESEEEREKWVEALRKAI 101


>gnl|CDD|178677 PLN03131, PLN03131, hypothetical protein; Provisional.
          Length = 705

 Score = 36.3 bits (83), Expect = 0.004
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 71  RVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEW 123
           ++P N  C +C   GP +   N    +C+ C G+HR       RV+S+ + ++
Sbjct: 19  KLPPNRRCINCNSLGPQFVCTNFWTFICMTCSGIHR---EFTHRVKSVSMSKF 68


>gnl|CDD|241426 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bisphosphate
           4-phosphatase and Type II inositol 3,4-bisphosphate
           4-phosphatase Pleckstrin homology (PH) domain.  INPP4A
           (also called Inositol polyphosphate 4-phosphatase type
           I) and INPP4B (also called Inositol polyphosphate
           4-phosphatase type II) both catalyze the hydrolysis of
           the 4-position phosphate of phosphatidylinositol
           3,4-bisphosphate and inositol 1,3,4-trisphosphate. They
           differ in that INPP4A additionally catalyzes the
           hydrolysis of the 4-position phosphate of inositol
           3,4-bisphosphate, while INPP4B catalyzes the hydrolysis
           of the 4-position phosphate of inositol
           1,4-bisphosphate. They both have a single PH domain
           followed by a C2 domain. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 116

 Score = 34.5 bits (80), Expect = 0.006
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 8/46 (17%)

Query: 27  IVSLDNKQWQFEAANSEERDDWIAAIQQQILSSLQTASLQSIRSRV 72
           +V  D K+++F   + EERD+WI AI+Q        AS + +RS++
Sbjct: 64  LVFKDEKKYRFSCRSEEERDEWIEAIKQ--------ASYEYLRSQL 101


>gnl|CDD|178666 PLN03119, PLN03119, putative ADP-ribosylation factor
           GTPase-activating protein AGD14; Provisional.
          Length = 648

 Score = 35.6 bits (81), Expect = 0.008
 Identities = 17/72 (23%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query: 71  RVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPESNPRI 130
           ++P N  C +C   GP +        +C+ C G+HR       RV+S+ + ++      +
Sbjct: 19  KLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHR---EFTHRVKSVSMSKFTSKEVEV 75

Query: 131 IDEA---RARRL 139
           +      RAR +
Sbjct: 76  LQNGGNQRAREI 87


>gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1.
            The Rap subfamily consists of the Rap1, Rap2, and RSR1.
           Rap subfamily proteins perform different cellular
           functions, depending on the isoform and its subcellular
           localization. For example, in rat salivary gland,
           neutrophils, and platelets, Rap1 localizes to secretory
           granules and is believed to regulate exocytosis or the
           formation of secretory granules. Rap1 has also been
           shown to localize in the Golgi of rat fibroblasts,
           zymogen granules, plasma membrane, and microsomal
           membrane of the pancreatic acini, as well as in the
           endocytic compartment of skeletal muscle cells and
           fibroblasts. Rap1 localizes in the nucleus of human
           oropharyngeal squamous cell carcinomas (SCCs) and cell
           lines. Rap1 plays a role in phagocytosis by controlling
           the binding of adhesion receptors (typically integrins)
           to their ligands. In yeast, Rap1 has been implicated in
           multiple functions, including activation and silencing
           of transcription and maintenance of telomeres. Rap2 is
           involved in multiple functions, including activation of
           c-Jun N-terminal kinase (JNK) to regulate the actin
           cytoskeleton and activation of the Wnt/beta-catenin
           signaling pathway in embryonic Xenopus. A number of
           effector proteins for Rap2 have been identified,
           including isoform 3 of the human mitogen-activated
           protein kinase kinase kinase kinase 4 (MAP4K4) and
           Traf2- and Nck-interacting kinase (TNIK), and the
           RalGEFs RalGDS, RGL, and Rlf, which also interact with
           Rap1 and Ras. RSR1 is the fungal homolog of Rap1 and
           Rap2. In budding yeasts, it is involved in selecting a
           site for bud growth, which directs the establishment of
           cell polarization. The Rho family GTPase Cdc42 and its
           GEF, Cdc24, then establish an axis of polarized growth.
           It is believed that Cdc42 interacts directly with RSR1
           in vivo. In filamentous fungi such as Ashbya gossypii,
           RSR1 is a key regulator of polar growth in the hypha.
           Most Ras proteins contain a lipid modification site at
           the C-terminus, with a typical sequence motif CaaX,
           where a = an aliphatic amino acid and X = any amino
           acid. Lipid binding is essential for membrane
           attachment, a key feature of most Ras proteins. Due to
           the presence of truncated sequences in this CD, the
           lipid modification site is not available for annotation.
          Length = 164

 Score = 34.5 bits (79), Expect = 0.011
 Identities = 12/39 (30%), Positives = 20/39 (51%)

Query: 127 NPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQD 165
           + R++ +   + LA     C + ET A   +NVD +F D
Sbjct: 120 DERVVSKEEGQNLARQWGNCPFLETSAKSKINVDEIFYD 158


>gnl|CDD|241444 cd13290, PH_ORP9, Human Oxysterol binding protein related protein
          9 Pleckstrin homology (PH) domain.  Human ORP9 is
          proposed to function in regulation of Akt
          phosphorylation. ORP9 has 2 forms, a long (ORP9L) and a
          short (ORP9S). ORP9L contains an N-terminal PH domain,
          a FFAT motif (two phenylalanines in an acidic tract),
          and a C-terminal OSBP-related domain. ORP1S is
          truncated and contains a FFAT motif and an OSBP-related
          domain. Oxysterol binding proteins are a multigene
          family that is conserved in yeast, flies, worms,
          mammals and plants. In general OSBPs and ORPs have been
          found to be involved in the transport and metabolism of
          cholesterol and related lipids in eukaryotes. They all
          contain a C-terminal oxysterol binding domain, and most
          contain an N-terminal PH domain. OSBP PH domains bind
          to membrane phosphoinositides and thus likely play an
          important role in intracellular targeting. They are
          members of the oxysterol binding protein (OSBP) family
          which includes OSBP, OSBP-related proteins (ORP),
          Goodpasture antigen binding protein (GPBP), and Four
          phosphate adaptor protein 1 (FAPP1). They have a wide
          range of purported functions including sterol
          transport, cell cycle control, pollen development and
          vessicle transport from Golgi recognize both PI lipids
          and ARF proteins. PH domains have diverse functions,
          but in general are involved in targeting proteins to
          the appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 102

 Score = 33.2 bits (76), Expect = 0.017
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 14 LVGTQDSDSFELLIVSLDNKQWQFEAANSEERDDWIAAIQQQILSSLQ 61
          ++G  D D      +++D K + F+A ++EER+ WI A++  IL   Q
Sbjct: 53 VIGIDDEDD-STFTITVDQKTFHFQARDAEERERWIRALEDTILRHSQ 99


>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1
           (AtPH1) PH domain.  AtPH1 is expressed in all plant
           tissue and is proposed to be the plant homolog of human
           pleckstrin. Pleckstrin consists of two PH domains
           separated by a linker region, while AtPH has a single PH
           domain with a short N-terminal extension. AtPH1 binds
           PtdIns3P specifically and is thought to be an adaptor
           molecule since it has no obvious catalytic functions. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 117

 Score = 32.7 bits (75), Expect = 0.031
 Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 3/35 (8%)

Query: 22  SFELLIVSLDNKQWQFEAANSEERDDWIAAIQQQI 56
           +FE   VS   + +   A + +E+++WI+AI + I
Sbjct: 71  AFE---VSTPERTFYLIADSEKEKEEWISAIGRAI 102


>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like).  RJLs are found
           in many protists and as chimeras with C-terminal DNAJ
           domains in deuterostome metazoa. They are not found in
           plants, fungi, and protostome metazoa, suggesting a
           horizontal gene transfer between protists and
           deuterostome metazoa. RJLs lack any known membrane
           targeting signal and contain a degenerate
           phosphate/magnesium-binding 3 (PM3) motif, suggesting an
           impaired ability to hydrolyze GTP. GTPase activating
           proteins (GAPs) interact with GTP-bound Rab and
           accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization.
          Length = 168

 Score = 33.1 bits (76), Expect = 0.034
 Identities = 12/41 (29%), Positives = 17/41 (41%), Gaps = 1/41 (2%)

Query: 125 ESNPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQD 165
            +  R + E   R  A       Y+ET A  G  V+ +FQ 
Sbjct: 122 LTKHRAVSEDEGRLWAESKG-FKYFETSACTGEGVNEMFQT 161


>gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases.  Similar in
           fold and function to the bacterial EF-Tu GTPase. p21Ras
           couples receptor Tyr kinases and G protein receptors to
           protein kinase cascades.
          Length = 164

 Score = 32.9 bits (76), Expect = 0.035
 Identities = 12/39 (30%), Positives = 18/39 (46%), Gaps = 1/39 (2%)

Query: 127 NPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQD 165
           + R++     + LA     C + ET A   +NVD  F D
Sbjct: 119 SERVVSTEEGKELARQWG-CPFLETSAKERVNVDEAFYD 156


>gnl|CDD|241456 cd13302, PH2_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH)
           domain, repeat 2.  Pleckstrin is a protein found in
           platelets. This name is derived from platelet and
           leukocyte C kinase substrate and the KSTR string of
           amino acids. Pleckstrin 2 contains two PH domains and a
           DEP (dishvelled, egl-10, and pleckstrin) domain. Unlike
           pleckstrin 1, pleckstrin 2 does not contain obvious
           sites of PKC phosphorylation. Pleckstrin 2 plays a role
           in actin rearrangement, large lamellipodia and
           peripheral ruffle formation, and may help orchestrate
           cytoskeletal arrangement. The PH domains of pleckstrin 2
           are thought to contribute to lamellipodia formation.
           This cd contains the second PH domain repeat. PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 109

 Score = 31.3 bits (71), Expect = 0.068
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 16  GTQDSDSFELLIVSLDNKQWQFEAANSEERDDWIAAIQ 53
           G+ + + FE  I++ D   +  +AA   ER +WI AIQ
Sbjct: 71  GSVEGNLFE--IITADEVHYYLQAATPAERTEWIKAIQ 106


>gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily;
           ill-defined subfamily.  SMART predicts Ras-like small
           GTPases of the ARF, RAB, RAN, RAS, and SAR subfamilies.
           Others that could not be classified in this way are
           predicted to be members of the small GTPase superfamily
           without predictions of the subfamily.
          Length = 166

 Score = 31.8 bits (73), Expect = 0.081
 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%)

Query: 127 NPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQD 165
           N R++     + LA     C + ET A   +NVD  F D
Sbjct: 121 NERVVSTEEGKELARQWG-CPFLETSAKERINVDEAFYD 158


>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine
           triphosphatases (GTPases).  Rab GTPases form the largest
           family within the Ras superfamily. There are at least 60
           Rab genes in the human genome, and a number of Rab
           GTPases are conserved from yeast to humans. Rab GTPases
           are small, monomeric proteins that function as molecular
           switches to regulate vesicle trafficking pathways. The
           different Rab GTPases are localized to the cytosolic
           face of specific intracellular membranes, where they
           regulate distinct steps in membrane traffic pathways. In
           the GTP-bound form, Rab GTPases recruit specific sets of
           effector proteins onto membranes. Through their
           effectors, Rab GTPases regulate vesicle formation,
           actin- and tubulin-dependent vesicle movement, and
           membrane fusion. GTPase activating proteins (GAPs)
           interact with GTP-bound Rab and accelerate the
           hydrolysis of GTP to GDP. Guanine nucleotide exchange
           factors (GEFs) interact with GDP-bound Rabs to promote
           the formation of the GTP-bound state. Rabs are further
           regulated by guanine nucleotide dissociation inhibitors
           (GDIs), which mask C-terminal lipid binding and promote
           cytosolic localization. While most unicellular organisms
           possess 5-20 Rab members, several have been found to
           possess 60 or more Rabs; for many of these Rab isoforms,
           homologous proteins are not found in other organisms.
           Most Rab GTPases contain a lipid modification site at
           the C-terminus, with sequence motifs CC, CXC, or CCX.
           Lipid binding is essential for membrane attachment, a
           key feature of most Rab proteins. Since crystal
           structures often lack C-terminal residues, the lipid
           modification site is not available for annotation in
           many of the CDs in the hierarchy, but is included where
           possible.
          Length = 159

 Score = 31.3 bits (72), Expect = 0.14
 Identities = 11/38 (28%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 127 NPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQ 164
           + R +    A++ A +     ++ET A  G NVD  F+
Sbjct: 119 DERQVSTEEAQQFAKENG-LLFFETSAKTGENVDEAFE 155


>gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and
          PH domain Pleckstrin homology (PH) domain, repeat 1.
          ARAP proteins (also called centaurin delta) are
          phosphatidylinositol 3,4,5-trisphosphate-dependent
          GTPase-activating proteins that modulate actin
          cytoskeleton remodeling by regulating ARF and RHO
          family members. They bind phosphatidylinositol
          3,4,5-trisphosphate (PtdIns(3,4,5)P3) and
          phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4,5)P2)
          binding. There are 3 mammalian ARAP proteins: ARAP1,
          ARAP2, and ARAP3. All ARAP proteins contain a
          N-terminal SAM (sterile alpha motif) domain, 5 PH
          domains, an ArfGAP domain, 2 ankyrin domain, A RhoGap
          domain, and a Ras-associating domain. This hierarchy
          contains the first PH domain in ARAP. PH domains have
          diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 93

 Score = 30.3 bits (69), Expect = 0.16
 Identities = 11/48 (22%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 12 IILVGTQDSDSFELLIVSLDNKQWQFEAANSEERDDWIAAIQQQILSS 59
          I  V +   + FE++     N+ + F A + +ER+ W++ +   I   
Sbjct: 49 IKTVRSVGDNKFEVVT---GNRTFVFRAESEDERNLWVSTLMAAISEY 93


>gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and
          OSBP-related protein 4 Pleckstrin homology (PH) domain.
           Human OSBP is proposed to function is sterol-dependent
          regulation of ERK dephosphorylation and sphingomyelin
          synthesis as well as modulation of insulin signaling
          and hepatic lipogenesis. It contains a N-terminal PH
          domain, a FFAT motif (two phenylalanines in an acidic
          tract), and a C-terminal OSBP-related domain. OSBPs and
          Osh1p PH domains specifically localize to the Golgi
          apparatus in a PtdIns4P-dependent manner. ORP4 is
          proposed to function in Vimentin-dependent sterol
          transport and/or signaling. Human ORP4 has 2 forms, a
          long (ORP4L) and a short (ORP4S). ORP4L contains a
          N-terminal PH domain, a FFAT motif (two phenylalanines
          in an acidic tract), and a C-terminal OSBP-related
          domain. ORP4S is truncated and contains only an
          OSBP-related domain. Oxysterol binding proteins are a
          multigene family that is conserved in yeast, flies,
          worms, mammals and plants. They all contain a
          C-terminal oxysterol binding domain, and most contain
          an N-terminal PH domain. OSBP PH domains bind to
          membrane phosphoinositides and thus likely play an
          important role in intracellular targeting. They are
          members of the oxysterol binding protein (OSBP) family
          which includes OSBP, OSBP-related proteins (ORP),
          Goodpasture antigen binding protein (GPBP), and Four
          phosphate adaptor protein 1 (FAPP1). They have a wide
          range of purported functions including sterol
          transport, cell cycle control, pollen development and
          vessicle transport from Golgi recognize both PI lipids
          and ARF proteins. PH domains have diverse functions,
          but in general are involved in targeting proteins to
          the appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 99

 Score = 30.0 bits (68), Expect = 0.19
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query: 1  MSHYRNAAEI------PIILVG----TQDSDSFELLIVSLDNKQWQFEAANSEERDDWIA 50
          +S+YRN AE+       I L G    T+DS +F   I +   + +  +A++  ER  W+ 
Sbjct: 27 LSYYRNQAEMAHTCRGTINLAGALIHTEDSCNFV--ISNGGTQTFHLKASSEVERQRWVT 84

Query: 51 AIQ 53
          A++
Sbjct: 85 ALE 87


>gnl|CDD|133345 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3.  The
           M-Ras/R-Ras-like subfamily contains R-Ras2/TC21,
           M-Ras/R-Ras3, and related members of the Ras family.
           M-Ras is expressed in lympho-hematopoetic cells. It
           interacts with some of the known Ras effectors, but
           appears to also have its own effectors. Expression of
           mutated M-Ras leads to transformation of several types
           of cell lines, including hematopoietic cells, mammary
           epithelial cells, and fibroblasts. Overexpression of
           M-Ras is observed in carcinomas from breast, uterus,
           thyroid, stomach, colon, kidney, lung, and rectum. In
           addition, expression of a constitutively active M-Ras
           mutant in murine bone marrow induces a malignant mast
           cell leukemia that is distinct from the monocytic
           leukemia induced by H-Ras. TC21, along with H-Ras, has
           been shown to regulate the branching morphogenesis of
           ureteric bud cell branching in mice. Most Ras proteins
           contain a lipid modification site at the C-terminus,
           with a typical sequence motif CaaX, where a = an
           aliphatic amino acid and X = any amino acid. Lipid
           binding is essential for membrane attachment, a key
           feature of most Ras proteins. Due to the presence of
           truncated sequences in this CD, the lipid modification
           site is not available for annotation.
          Length = 164

 Score = 30.8 bits (70), Expect = 0.19
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 127 NPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQD 165
           + R +     + LA  LK   Y ET A   +NVD+ F D
Sbjct: 121 HQRQVSREEGQELARQLK-IPYIETSAKDRVNVDKAFHD 158


>gnl|CDD|241540 cd13389, PH1_FGD5_FGD6, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia proteins 5 and 6
           Pleckstrin Homology (PH) domain.  FGD5 regulates
           promotes angiogenesis of vascular endothelial growth
           factor (VEGF) in vascular endothelial cells, including
           network formation, permeability, directional movement,
           and proliferation. The specific function of FGD6 is
           unknown. In general, FGDs have a RhoGEF (DH) domain,
           followed by a PH domain, a FYVE domain and a C-terminal
           PH domain. All FGDs are guanine nucleotide exchange
           factors that activate the Rho GTPase Cdc42, an important
           regulator of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the PH
           domain is involved in intracellular targeting of the DH
           domain. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 125

 Score = 30.3 bits (69), Expect = 0.22
 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 17  TQDSDSFELLIVSLDNKQWQFEAANSEERDDWIAAIQQQI 56
             +  S E  I S   + +   A+++EERD+W+ A+ + I
Sbjct: 70  EDEEYSNEFQIES-TKRSFTLSASSAEERDEWVKALSRAI 108


>gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for
           Phosphoinositides-1-like Pleckstrin homology (PH)
           domain.  GRP1/cytohesin3 and the related proteins ARNO
           (ARF nucleotide-binding site opener)/cytohesin-2 and
           cytohesin-1 are ARF exchange factors that contain a
           pleckstrin homology (PH) domain thought to target these
           proteins to cell membranes through binding
           polyphosphoinositides. The PH domains of all three
           proteins exhibit relatively high affinity for
           PtdIns(3,4,5)P3. Within the Grp1 family, diglycine (2G)
           and triglycine (3G) splice variants, differing only in
           the number of glycine residues in the PH domain,
           strongly influence the affinity and specificity for
           phosphoinositides. The 2G variants selectively bind
           PtdIns(3,4,5)P3 with high affinity,the 3G variants bind
           PtdIns(3,4,5)P3 with about 30-fold lower affinity and
           require the polybasic region for plasma membrane
           targeting. These ARF-GEFs share a common, tripartite
           structure consisting of an N-terminal coiled-coil
           domain, a central domain with homology to the yeast
           protein Sec7, a PH domain, and a C-terminal polybasic
           region. The Sec7 domain is autoinhibited by conserved
           elements proximal to the PH domain. GRP1 binds to the
           DNA binding domain of certain nuclear receptors
           (TRalpha, TRbeta, AR, ER, but not RXR), and can repress
           thyroid hormone receptor (TR)-mediated transactivation
           by decreasing TR-complex formation on thyroid hormone
           response elements. ARNO promotes sequential activation
           of Arf6, Cdc42 and Rac1 and insulin secretion. Cytohesin
           acts as a PI 3-kinase effector mediating biological
           responses including cell spreading and adhesion,
           chemotaxis, protein trafficking, and cytoskeletal
           rearrangements, only some of which appear to depend on
           their ability to activate ARFs. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 118

 Score = 30.0 bits (68), Expect = 0.23
 Identities = 9/18 (50%), Positives = 12/18 (66%)

Query: 39  AANSEERDDWIAAIQQQI 56
           AA  EE D+WI +I+  I
Sbjct: 98  AATEEEMDEWIKSIKASI 115


>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology
           (PH) domain, repeat 2.  ADAP (also called centaurin
           alpha) is a phophatidlyinositide binding protein
           consisting of an N-terminal ArfGAP domain and two PH
           domains. In response to growth factor activation, PI3K
           phosphorylates phosphatidylinositol 4,5-bisphosphate to
           phosphatidylinositol 3,4,5-trisphosphate. Centaurin
           alpha 1 is recruited to the plasma membrane following
           growth factor stimulation by specific binding of its PH
           domain to phosphatidylinositol 3,4,5-trisphosphate.
           Centaurin alpha 2 is constitutively bound to the plasma
           membrane since it binds phosphatidylinositol
           4,5-bisphosphate and phosphatidylinositol
           3,4,5-trisphosphate with equal affinity. This cd
           contains the second PH domain repeat. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 105

 Score = 29.9 bits (68), Expect = 0.24
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 16  GTQDSDSFELLIVSLDNKQWQFEAANSEERDDWIAAIQQQI 56
           G +    F   +V+ D + +   A   EER +WI AIQ+ +
Sbjct: 64  GIKGHWGFGFTLVTPD-RTFVLSAETEEERREWITAIQKVL 103


>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases.  Rab GTPases are
           implicated in vesicle trafficking.
          Length = 164

 Score = 30.2 bits (69), Expect = 0.28
 Identities = 9/40 (22%), Positives = 15/40 (37%), Gaps = 1/40 (2%)

Query: 125 ESNPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQ 164
               R +    A   A +     ++ET A    NV+  F+
Sbjct: 117 LEEQRQVSREEAEAFAEEHG-LPFFETSAKTNTNVEEAFE 155


>gnl|CDD|241437 cd13283, PH_GPBP, Goodpasture antigen binding protein Pleckstrin
          homology (PH) domain.  The GPBP (also called Collagen
          type IV alpha-3-binding protein/hCERT; START
          domain-containing protein 11/StARD11; StAR-related
          lipid transfer protein 11) is a kinase that
          phosphorylates an N-terminal region of the alpha 3
          chain of type IV collagen, which is commonly known as
          the goodpasture antigen. Its splice variant the
          ceramide transporter (CERT) mediates the cytosolic
          transport of ceramide. There have been additional
          splice variants identified, but all of them function as
          ceramide transport proteins. GPBP and CERT both contain
          an N-terminal PH domain, followed by a serine rich
          domain, and a C-terminal START domain. However, GPBP
          has an additional serine rich domain just upstream of
          its START domain. They are members of the oxysterol
          binding protein (OSBP) family which includes OSBP,
          OSBP-related proteins (ORP), Goodpasture antigen
          binding protein (GPBP), and Four phosphate adaptor
          protein 1 (FAPP1). They have a wide range of purported
          functions including sterol transport, cell cycle
          control, pollen development and vessicle transport from
          Golgi recognize both PI lipids and ARF proteins. PH
          domains have diverse functions, but in general are
          involved in targeting proteins to the appropriate
          cellular location or in the interaction with a binding
          partner. They share little sequence conservation, but
          all have a common fold, which is electrostatically
          polarized. Less than 10% of PH domains bind
          phosphoinositide phosphates (PIPs) with high affinity
          and specificity. PH domains are distinguished from
          other PIP-binding domains by their specific
          high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 100

 Score = 29.5 bits (67), Expect = 0.28
 Identities = 9/28 (32%), Positives = 16/28 (57%)

Query: 28 VSLDNKQWQFEAANSEERDDWIAAIQQQ 55
          VS+++  W   A + EER  W+ A++  
Sbjct: 63 VSVNDSVWYLRAESPEERQRWVDALEAH 90


>gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology
           (PH) domain.  SH3BP2 (the gene that encodes the adaptor
           protein 3BP2), HD, ITU, IT10C3, and ADD1 are located
           near the Huntington's Disease Gene on Human Chromosome
           4pl6.3. SH3BP2 lies in a region that is often missing in
           individuals with Wolf-Hirschhorn syndrome (WHS). Gain of
           function mutations in SH3BP2 causes enhanced B-cell
           antigen receptor (BCR)-mediated activation of nuclear
           factor of activated T cells (NFAT), resulting in a rare,
           genetic disorder called cherubism. This results in an
           increase in the signaling complex formation with Syk,
           phospholipase C-gamma2 (PLC-gamma2), and Vav1. It was
           recently discovered that Tankyrase regulates 3BP2
           stability through ADP-ribosylation and ubiquitylation by
           the E3-ubiquitin ligase. Cherubism mutations uncouple
           3BP2 from Tankyrase-mediated protein destruction, which
           results in its stabilization and subsequent
           hyperactivation of the Src, Syk, and Vav signaling
           pathways. SH3BP2 is also a potential negative regulator
           of the abl oncogene. PH domains have diverse functions,
           but in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 113

 Score = 29.3 bits (66), Expect = 0.41
 Identities = 9/35 (25%), Positives = 24/35 (68%)

Query: 22  SFELLIVSLDNKQWQFEAANSEERDDWIAAIQQQI 56
            F+++ +S D++ W F A + +E  +W+ +++++I
Sbjct: 75  VFKIIHLSKDHRTWYFSAKSEDEMKEWMESLRKEI 109


>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH)
          domain, repeat 1.  Pleckstrin is a protein found in
          platelets. This name is derived from platelet and
          leukocyte C kinase substrate and the KSTR string of
          amino acids. Pleckstrin 2 contains two PH domains and a
          DEP (dishvelled, egl-10, and pleckstrin) domain. Unlike
          pleckstrin 1, pleckstrin 2 does not contain obvious
          sites of PKC phosphorylation. Pleckstrin 2 plays a role
          in actin rearrangement, large lamellipodia and
          peripheral ruffle formation, and may help orchestrate
          cytoskeletal arrangement. The PH domains of pleckstrin
          2 are thought to contribute to lamellipodia formation.
          This cd contains the first PH domain repeat. PH domains
          have diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 108

 Score = 29.3 bits (66), Expect = 0.41
 Identities = 8/20 (40%), Positives = 11/20 (55%)

Query: 37 FEAANSEERDDWIAAIQQQI 56
           +A + EERD W   I + I
Sbjct: 79 LQACSREERDAWAKDITKAI 98


>gnl|CDD|241254 cd01219, PH1_FGD1, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia protein 1 pleckstrin
           homology (PH), N-terminal domain.  In general, FGDs have
           a RhoGEF (DH) domain, followed by an N-terminal PH
           domain, a FYVE domain and a C-terminal PH domain. All
           FGDs are guanine nucleotide exchange factors that
           activates the Rho GTPase Cdc42, an important regulator
           of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the
           N-terminal PH domain is involved in intracellular
           targeting of the DH domain. Mutations in the FGD1 gene
           are responsible for the X-linked disorder known as
           faciogenital dysplasia (FGDY). Both FGD1 and FGD3 are
           targeted by the ubiquitin ligase SCF(FWD1/beta-TrCP)
           upon phosphorylation of two serine residues in its
           DSGIDS motif and subsequently degraded by the
           proteasome. However, FGD1 and FGD3 induced significantly
           different morphological changes in HeLa Tet-Off cells
           and while FGD1 induced long finger-like protrusions,
           FGD3 induced broad sheet-like protrusions when the level
           of GTP-bound Cdc42 was significantly increased by the
           inducible expression of FGD3. They also reciprocally
           regulated cell motility in inducibly expressed in HeLa
           Tet-Off cells, FGD1 stimulated cell migration while FGD3
           inhibited it. FGD1 and FGD3 therefore play different
           roles to regulate cellular functions, even though their
           intracellular levels are tightly controlled by the same
           destruction pathway through SCF(FWD1/beta-TrCP).  PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 107

 Score = 29.2 bits (65), Expect = 0.41
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 26  LIVSLDNKQWQFEAANSEERDDWIAAIQQQILSSLQT 62
            +VS   +  + +A   EE+ DWI AI+  I    QT
Sbjct: 67  FLVSGKQRSLELQARTEEEKKDWIQAIEATINRHEQT 103


>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21).  The localization and
           function of Rab21 are not clearly defined, with
           conflicting data reported. Rab21 has been reported to
           localize in the ER in human intestinal epithelial cells,
           with partial colocalization with alpha-glucosidase, a
           late endosomal/lysosomal marker. More recently, Rab21
           was shown to colocalize with and affect the morphology
           of early endosomes. In Dictyostelium, GTP-bound Rab21,
           together with two novel LIM domain proteins, LimF and
           ChLim, has been shown to regulate phagocytosis. GTPase
           activating proteins (GAPs) interact with GTP-bound Rab
           and accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 162

 Score = 29.9 bits (68), Expect = 0.44
 Identities = 8/37 (21%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 129 RIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQD 165
           R++ ++ A   A  +    ++ET A  G  ++ +F  
Sbjct: 121 RVVSKSEAEEYAKSVG-AKHFETSAKTGKGIEELFLS 156


>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain.  PH domains have
          diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 92

 Score = 28.9 bits (64), Expect = 0.47
 Identities = 9/33 (27%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 19 DSDSFELLIVSLDNKQWQFEAANSEERDDWIAA 51
            + FEL +     + +  +A + EER++W+ A
Sbjct: 61 KPNCFEL-VTPDRGRTYYLQAESEEEREEWLEA 92


>gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine
           triphosphatases (GTPases).  The Ras family of the Ras
           superfamily includes classical N-Ras, H-Ras, and K-Ras,
           as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG,
           Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.
           Ras proteins regulate cell growth, proliferation and
           differentiation. Ras is activated by guanine nucleotide
           exchange factors (GEFs) that release GDP and allow GTP
           binding. Many RasGEFs have been identified. These are
           sequestered in the cytosol until activation by growth
           factors triggers recruitment to the plasma membrane or
           Golgi, where the GEF colocalizes with Ras. Active
           GTP-bound Ras interacts with several effector proteins:
           among the best characterized are the Raf kinases,
           phosphatidylinositol 3-kinase (PI3K), RalGEFs and
           NORE/MST1. Most Ras proteins contain a lipid
           modification site at the C-terminus, with a typical
           sequence motif CaaX, where a = an aliphatic amino acid
           and X = any amino acid. Lipid binding is essential for
           membrane attachment, a key feature of most Ras proteins.
           Due to the presence of truncated sequences in this CD,
           the lipid modification site is not available for
           annotation.
          Length = 160

 Score = 29.4 bits (67), Expect = 0.52
 Identities = 11/41 (26%), Positives = 17/41 (41%), Gaps = 1/41 (2%)

Query: 125 ESNPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQD 165
             N R +       LA +   C + ET A   +N+D +F  
Sbjct: 116 LENERQVSTEEGEALAEEWG-CPFLETSAKTNINIDELFNT 155


>gnl|CDD|133343 cd04143, Rhes_like, Ras homolog enriched in striatum (Rhes) and
           activator of G-protein signaling 1 (Dexras1/AGS1).  This
           subfamily includes Rhes (Ras homolog enriched in
           striatum) and Dexras1/AGS1 (activator of G-protein
           signaling 1). These proteins are homologous, but exhibit
           significant differences in tissue distribution and
           subcellular localization. Rhes is found primarily in the
           striatum of the brain, but is also expressed in other
           areas of the brain, such as the cerebral cortex,
           hippocampus, inferior colliculus, and cerebellum. Rhes
           expression is controlled by thyroid hormones. In rat
           PC12 cells, Rhes is farnesylated and localizes to the
           plasma membrane. Rhes binds and activates PI3K, and
           plays a role in coupling serpentine membrane receptors
           with heterotrimeric G-protein signaling. Rhes has
           recently been shown to be reduced under conditions of
           dopamine supersensitivity and may play a role in
           determining dopamine receptor sensitivity. Dexras1/AGS1
           is a dexamethasone-induced Ras protein that is expressed
           primarily in the brain, with low expression levels in
           other tissues. Dexras1 localizes primarily to the
           cytoplasm, and is a critical regulator of the circadian
           master clock to photic and nonphotic input. Most Ras
           proteins contain a lipid modification site at the
           C-terminus, with a typical sequence motif CaaX, where a
           = an aliphatic amino acid and X = any amino acid. Lipid
           binding is essential for membrane attachment, a key
           feature of most Ras proteins.
          Length = 247

 Score = 29.3 bits (66), Expect = 0.74
 Identities = 10/37 (27%), Positives = 18/37 (48%)

Query: 128 PRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQ 164
           PR +      +L    + C+Y+E  A    N+D +F+
Sbjct: 128 PREVQRDEVEQLVGGDENCAYFEVSAKKNSNLDEMFR 164


>gnl|CDD|241259 cd01225, PH_Cool_Pix, Cloned out of library/PAK-interactive
           exchange factor pleckstrin homology (PH) domain.  There
           are two forms of Pix proteins: alpha Pix (also called
           Rho guanine nucleotide exchange factor (GEF) 6/90Cool-2)
           and beta Pix (GEF7/p85Cool-1). betaPix contains  an
           N-terminal SH3 domain, a RhoGEF/DH domain, a PH domain,
           a GIT1 binding domain (GBD), and a C-terminal
           coiled-coil (CC) domain. alphaPix differs in that it
           contains a calponin homology (CH) domain, which
           interacts with beta-parvin, N-terminal to the SH3
           domain. alphaPix is an exchange factor for Rac1 and
           Cdc42 and mediates Pak activation on cell adhesion to
           fibronectin. Mutations in alphaPix can cause X-linked
           mental retardation. alphaPix also interacts with
           Huntington's disease protein (htt), and enhances the
           aggregation of mutant htt (muthtt) by facilitating
           SDS-soluble muthtt-muthtt interactions. The DH-PH domain
           of a Pix was required for its binding to htt. In the
           majority of Rho GEF proteins, the DH-PH domain is
           responsible for the exchange activity. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 100

 Score = 28.4 bits (64), Expect = 0.82
 Identities = 7/19 (36%), Positives = 12/19 (63%)

Query: 40  ANSEERDDWIAAIQQQILS 58
            +S ++ +WI  +QQQI  
Sbjct: 82  NSSNDQQEWIEHLQQQIKG 100


>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH
          domains Pleckstrin homology (PH) domain.  ACAP (also
          called centaurin beta) functions both as a Rab35
          effector and as an Arf6-GTPase-activating protein (GAP)
          by which it controls actin remodeling and membrane
          trafficking. ACAP contain an NH2-terminal
          bin/amphiphysin/Rvs (BAR) domain, a
          phospholipid-binding domain, a PH domain, a GAP domain,
          and four ankyrin repeats. The AZAPs constitute a family
          of Arf GAPs that are characterized by an NH2-terminal
          pleckstrin homology (PH) domain and a central Arf GAP
          domain followed by two or more ankyrin repeats. On the
          basis of sequence and domain organization, the AZAP
          family is further subdivided into four subfamilies: 1)
          the ACAPs contain an NH2-terminal bin/amphiphysin/Rvs
          (BAR) domain (a phospholipid-binding domain that is
          thought to sense membrane curvature), a single PH
          domain followed by the GAP domain, and four ankyrin
          repeats; 2) the ASAPs also contain an NH2-terminal BAR
          domain, the tandem PH domain/GAP domain, three ankyrin
          repeats, two proline-rich regions, and a COOH-terminal
          Src homology 3 domain; 3) the AGAPs contain an
          NH2-terminal GTPase-like domain (GLD), a split PH
          domain, and the GAP domain followed by four ankyrin
          repeats; and 4) the ARAPs contain both an Arf GAP
          domain and a Rho GAP domain, as well as an NH2-terminal
          sterile-a motif (SAM), a proline-rich region, a
          GTPase-binding domain, and five PH domains. PMID
          18003747 and 19055940 Centaurin can bind to
          phosphatidlyinositol (3,4,5)P3. PH domains have diverse
          functions, but in general are involved in targeting
          proteins to the appropriate cellular location or in the
          interaction with a binding partner. They share little
          sequence conservation, but all have a common fold,
          which is electrostatically polarized. Less than 10% of
          PH domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 98

 Score = 28.0 bits (63), Expect = 1.2
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 23 FELLIVSLDNKQWQFEAANSEERDDWIAAIQQQILSSLQ 61
          FE  +VS   K +  +A + E+R  WI AIQ  I S+L 
Sbjct: 63 FE--VVS-PTKSYMLQAESEEDRQAWIQAIQAAIASALN 98


>gnl|CDD|215692 pfam00071, Ras, Ras family.  Includes sub-families Ras, Rab, Rac,
           Ral, Ran, Rap Ypt1 and more. Shares P-loop motif with
           GTP_EFTU, arf and myosin_head. See pfam00009 pfam00025,
           pfam00063. As regards Rab GTPases, these are important
           regulators of vesicle formation, motility and fusion.
           They share a fold in common with all Ras GTPases: this
           is a six-stranded beta-sheet surrounded by five
           alpha-helices.
          Length = 162

 Score = 28.2 bits (64), Expect = 1.2
 Identities = 10/37 (27%), Positives = 17/37 (45%), Gaps = 1/37 (2%)

Query: 129 RIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQD 165
           R++       LA +L    + ET A    NV+  F++
Sbjct: 120 RVVSTEEGEALAKELG-LPFMETSAKTNENVEEAFEE 155


>gnl|CDD|206702 cd04129, Rho2, Ras homology family 2 (Rho2) of small guanosine
           triphosphatases (GTPases).  Rho2 is a fungal GTPase that
           plays a role in cell morphogenesis, control of cell wall
           integrity, control of growth polarity, and maintenance
           of growth direction. Rho2 activates the protein kinase C
           homolog Pck2, and Pck2 controls Mok1, the major (1-3)
           alpha-D-glucan synthase. Together with Rho1 (RhoA), Rho2
           regulates the construction of the cell wall. Unlike
           Rho1, Rho2 is not an essential protein, but its
           overexpression is lethal. Most Rho proteins contain a
           lipid modification site at the C-terminus, with a
           typical sequence motif CaaX, where a = an aliphatic
           amino acid and X = any amino acid. Lipid binding is
           essential for proper intracellular localization via
           membrane attachment. As with other Rho family GTPases,
           the GDP/GTP cycling is regulated by GEFs (guanine
           nucleotide exchange factors), GAPs (GTPase-activating
           proteins) and GDIs (guanine nucleotide dissociation
           inhibitors).
          Length = 190

 Score = 28.6 bits (64), Expect = 1.3
 Identities = 10/39 (25%), Positives = 17/39 (43%)

Query: 126 SNPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQ 164
           +    +   +A+ +A  +    Y E  A  G  VD VF+
Sbjct: 128 ATDEFVPIQQAKLVARAIGAKKYMECSALTGEGVDDVFE 166


>gnl|CDD|99993 cd03823, GT1_ExpE7_like, This family is most closely related to the
           GT1 family of glycosyltransferases. ExpE7 in
           Sinorhizobium meliloti has been shown to be involved in
           the biosynthesis of galactoglucans (exopolysaccharide
           II).
          Length = 359

 Score = 28.8 bits (65), Expect = 1.4
 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 3/24 (12%)

Query: 123 WPESNPRIIDEARARR---LASDL 143
           WPE+ P +I EA A     +ASD+
Sbjct: 272 WPENFPLVIREALAAGVPVIASDI 295


>gnl|CDD|223043 PHA03323, PHA03323, nuclear egress membrane protein UL34;
          Provisional.
          Length = 272

 Score = 28.5 bits (64), Expect = 1.5
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 1/26 (3%)

Query: 65 LQSIRSRVPGNLTCADCAEAGPTWAS 90
          +Q IR  VPGNL C +  +AG     
Sbjct: 15 IQRIRLVVPGNLRCGEG-DAGLYEPK 39


>gnl|CDD|177868 PLN02222, PLN02222, phosphoinositide phospholipase C 2.
          Length = 581

 Score = 28.8 bits (64), Expect = 1.5
 Identities = 22/79 (27%), Positives = 30/79 (37%), Gaps = 23/79 (29%)

Query: 70  SRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPESNPR 129
           S + GN   +DC+E  P   +L  G                    VR +ELD WP S+  
Sbjct: 120 SYLTGNQLSSDCSEV-PIIDALKKG--------------------VRVIELDIWPNSDKD 158

Query: 130 IIDEARARRLAS--DLKRC 146
            ID      L +   L +C
Sbjct: 159 DIDVLHGMTLTTPVGLIKC 177


>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of
           small guanosine triphosphatases (GTPases).  Ras-like
           GTPase superfamily. The Ras-like superfamily of small
           GTPases consists of several families with an extremely
           high degree of structural and functional similarity. The
           Ras superfamily is divided into at least four families
           in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.
           This superfamily also includes proteins like the GTP
           translation factors, Era-like GTPases, and G-alpha chain
           of the heterotrimeric G proteins. Members of the Ras
           superfamily regulate a wide variety of cellular
           functions: the Ras family regulates gene expression, the
           Rho family regulates cytoskeletal reorganization and
           gene expression, the Rab and Sar1/Arf families regulate
           vesicle trafficking, and the Ran family regulates
           nucleocytoplasmic transport and microtubule
           organization. The GTP translation factor family
           regulates initiation, elongation, termination, and
           release in translation, and the Era-like GTPase family
           regulates cell division, sporulation, and DNA
           replication. Members of the Ras superfamily are
           identified by the GTP binding site, which is made up of
           five characteristic sequence motifs, and the switch I
           and switch II regions.
          Length = 161

 Score = 28.2 bits (63), Expect = 1.5
 Identities = 8/39 (20%), Positives = 15/39 (38%)

Query: 127 NPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQD 165
             R ++E       + +     +E  A  G  VD +F+ 
Sbjct: 120 EEREVEELLRLEELAKILGVPVFEVSAKTGEGVDELFEK 158


>gnl|CDD|236548 PRK09525, lacZ, beta-D-galactosidase; Reviewed.
          Length = 1027

 Score = 28.7 bits (65), Expect = 1.7
 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 7/56 (12%)

Query: 6   NAAEIPIILVGTQDSDSFELLIVSLDNKQWQFEAANSEERDDWIAAIQQQILSSLQ 61
            +   P +   TQD   F    + L N++WQF    S     W    ++Q+L+ L+
Sbjct: 737 ASHAAPQL---TQDEQDFC---IELGNQRWQF-NRQSGLLSQWWVGGKEQLLTPLR 785


>gnl|CDD|152648 pfam12213, Dpoe2NT, DNA polymerases epsilon N terminal.  This
          domain is found in eukaryotes, and is approximately 70
          amino acids in length. The family is found in
          association with pfam04042. There is a single
          completely conserved residue F that may be functionally
          important. This domain is the N terminal domain of DNA
          polymerase epsilon subunit B. It forms a primarily
          alpha helical structure in which four helices are
          arranged in two hairpins with connecting loops
          containing beta strands which form a short parallel
          sheet. DNA polymerase epsilon is required in DNA
          replication for synthesis of the leading strand. This
          domain has close structural relation to AAA+ protein C
          terminal domains.
          Length = 72

 Score = 26.9 bits (60), Expect = 1.8
 Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 4/28 (14%)

Query: 36 QFEAANSEERDDW----IAAIQQQILSS 59
             +    ER+DW    I A+++Q LSS
Sbjct: 31 VLLSLGEPEREDWLEKIIEAVEKQPLSS 58


>gnl|CDD|241408 cd13254, PH2_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and
          PH domain Pleckstrin homology (PH) domain, repeat 2.
          ARAP proteins (also called centaurin delta) are
          phosphatidylinositol 3,4,5-trisphosphate-dependent
          GTPase-activating proteins that modulate actin
          cytoskeleton remodeling by regulating ARF and RHO
          family members. They bind phosphatidylinositol
          3,4,5-trisphosphate (PtdIns(3,4,5)P3) and
          phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4,5)P2)
          binding. There are 3 mammalian ARAP proteins: ARAP1,
          ARAP2, and ARAP3. All ARAP proteins contain a
          N-terminal SAM (sterile alpha motif) domain, 5 PH
          domains, an ArfGAP domain, 2 ankyrin domain, A RhoGap
          domain, and a Ras-associating domain. This hierarchy
          contains the second PH domain in ARAP. PH domains have
          diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 90

 Score = 27.3 bits (61), Expect = 1.8
 Identities = 10/35 (28%), Positives = 18/35 (51%), Gaps = 3/35 (8%)

Query: 19 DSDSFELLIVSLDNKQWQFEAANSEERDDWIAAIQ 53
          D  SF+L       + + F A +  E+ +W+ A+Q
Sbjct: 59 DKRSFDLTTPY---RIFSFTAESEREKQEWVEALQ 90


>gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7).  Rab7 subfamily. Rab7 is
           a small Rab GTPase that regulates vesicular traffic from
           early to late endosomal stages of the endocytic pathway.
           The yeast Ypt7 and mammalian Rab7 are both involved in
           transport to the vacuole/lysosome, whereas Ypt7 is also
           required for homotypic vacuole fusion. Mammalian Rab7 is
           an essential participant in the autophagic pathway for
           sequestration and targeting of cytoplasmic components to
           the lytic compartment. Mammalian Rab7 is also proposed
           to function as a tumor suppressor. GTPase activating
           proteins (GAPs) interact with GTP-bound Rab and
           accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 172

 Score = 27.6 bits (62), Expect = 2.0
 Identities = 10/37 (27%), Positives = 18/37 (48%)

Query: 129 RIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQD 165
           R +   +A++         Y+ET A   +NVD+ F+ 
Sbjct: 125 RQVSTKKAQQWCKSKGNIPYFETSAKEAINVDQAFET 161


>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2
           Pleckstrin homology (PH) domain.  The binding of TAPP2
           (also called PLEKHA2) adaptors to PtdIns(3,4)P(2), but
           not PI(3,4, 5)P3, function as negative regulators of
           insulin and PI3K signalling pathways (i.e.
           TAPP/utrophin/syntrophin complex). TAPP2 contains two
           sequential PH domains in which the C-terminal PH domain
           specifically binds PtdIns(3,4)P2 with high affinity. The
           N-terminal PH domain does not interact with any
           phosphoinositide tested. They also contain a C-terminal
           PDZ-binding motif that interacts with several
           PDZ-binding proteins, including PTPN13 (known previously
           as PTPL1 or FAP-1) as well as the scaffolding proteins
           MUPP1 (multiple PDZ-domain-containing protein 1),
           syntrophin and utrophin. The members here are most
           sequence similar to TAPP2 proteins, but may not be
           actual TAPP2 proteins. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 110

 Score = 27.4 bits (61), Expect = 2.1
 Identities = 9/41 (21%), Positives = 19/41 (46%), Gaps = 1/41 (2%)

Query: 27  IVSLDNKQWQFEAANSEERDDWIAAIQQQILSSLQTASLQS 67
           IV+   + +  +A +  E + WI+AI     +   T +  +
Sbjct: 71  IVT-PARTFYVQADSKAEMESWISAINLARQALRATITPNT 110


>gnl|CDD|184651 PRK14370, PRK14370, hypothetical protein; Provisional.
          Length = 120

 Score = 27.5 bits (61), Expect = 2.1
 Identities = 8/12 (66%), Positives = 9/12 (75%)

Query: 145 RCSYYETCATYG 156
           RC YY TC+ YG
Sbjct: 31  RCRYYPTCSNYG 42


>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional.
          Length = 249

 Score = 27.6 bits (62), Expect = 2.7
 Identities = 16/53 (30%), Positives = 18/53 (33%), Gaps = 16/53 (30%)

Query: 109 GAHVSRVRSLELD---------------EWPESNPRIIDEARARRLASD-LKR 145
            A     RSL L+                WPE      +EAR   LA   LKR
Sbjct: 161 AALEMLTRSLALELAPEVRVNAVAPGAILWPEDGNSFDEEARQAILARTPLKR 213


>gnl|CDD|241292 cd01261, PH_SOS, Son of Sevenless (SOS) Pleckstrin homology (PH)
           domain.  SOS is a Ras guanine nucleotide exchange
           factor. SOS is thought to transmit signals from
           activated receptor tyrosine kinases to the Ras signaling
           pathway. SOS contains a histone domain, Dbl-homology
           (DH), a PH domain, Rem domain, Cdc25 domain, and a Grb2
           binding domain. The SOS PH domain binds to
           phosphatidylinositol-4,5-bisphosphate (PIP2) and
           phosphatidic acid (PA). SOS is dependent on Ras binding
           to the allosteric site via its histone domain for both a
           lower level of activity (Ras GDP) and maximal activity
           (Ras GTP). The DH domain blocks the allosteric Ras
           binding site in SOS. The PH domain is closely associated
           with the DH domain and the action of the DH-PH unit
           gates a reciprocal interaction between Ras and SOS. The
           C-terminal proline-rich domain of SOS binds to the
           adapter protein Grb2 which localizes the Sos protein to
           the plasma membrane and diminishes the negative effect
           of the C-terminal domain on the guanine nucleotide
           exchange activity of the CDC25-homology domain of SOS.
           PH domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 109

 Score = 26.9 bits (60), Expect = 3.1
 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 6/39 (15%)

Query: 18  QDSD----SFELLIVSLDNKQWQFEAANSEERDDWIAAI 52
           +D+D    +FE  IV  D   +   A ++EE+++W+AA+
Sbjct: 69  EDTDELKNAFE--IVPRDEPSYILFAKSAEEKNNWMAAL 105


>gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH)
           domain.  Btk is a member of the Tec family of
           cytoplasmic protein tyrosine kinases that includes BMX,
           IL2-inducible T-cell kinase (Itk) and Tec. Btk plays a
           role in the maturation of B cells. Tec proteins general
           have an N-terminal PH domain, followed by a Tek homology
           (TH) domain, a SH3 domain, a SH2 domain and a kinase
           domain. The Btk PH domain binds phosphatidylinositol
           3,4,5-trisphosphate and responds to signalling via
           phosphatidylinositol 3-kinase. The PH domain is also
           involved in membrane anchoring which is confirmed by the
           discovery of a mutation of a critical arginine residue
           in the BTK PH domain. This results in severe human
           immunodeficiency known as X-linked agammaglobulinemia
           (XLA) in humans and a related disorder is mice.PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 140

 Score = 26.8 bits (60), Expect = 3.5
 Identities = 7/18 (38%), Positives = 14/18 (77%)

Query: 39  AANSEERDDWIAAIQQQI 56
           A + E+RD+WI A++++ 
Sbjct: 85  APSEEDRDEWILALRKEC 102


>gnl|CDD|241531 cd13380, PH_Skap1, Src kinase-associated phosphoprotein 1
          Pleckstrin homology (PH) domain.  Adaptor protein Skap1
          (also called Skap55/Src kinase-associated
          phosphoprotein of 55 kDa) and its partner, ADAP
          (adhesion and degranulation promoting adapter protein)
          help reorganize the cytoskeleton and/or promote
          integrin-mediated adhesion upon immunoreceptor
          activation. Skap1 is also involved in T Cell Receptor
          (TCR)-induced RapL-Rap1 complex formation and LFA-1
          activation. Skap1 has an N-terminal coiled-coil
          conformation which is proposed to be involved in
          homodimer formation, a central PH domain and a
          C-terminal SH3 domain that associates with ADAP. The
          Skap1 PH domain plays a role in controlling integrin
          function via recruitment of ADAP-SKAP complexes to
          integrins as well as in controlling the ability of ADAP
          to interact with the CBM signalosome and regulate
          NF-kappaB. SKAP1 is necessary for RapL binding to
          membranes in a PH domain-dependent manner and the PI3K
          pathway. Skap adaptor proteins couple receptors to
          cytoskeletal rearrangements. Skap55/Skap1, Skap2, and
          Skap-homology (Skap-hom) have an N-terminal coiled-coil
          conformation, a central PH domain and a C-terminal SH3
          domain. Their PH domains bind 3'-phosphoinositides as
          well as directly affecting targets such as in Skap55
          where it directly affecting integrin regulation by ADAP
          and NF-kappaB activation or in Skap-hom where the
          dimerization and PH domains comprise a
          3'-phosphoinositide-gated molecular switch that
          controls ruffle formation. PH domains have diverse
          functions, but in general are involved in targeting
          proteins to the appropriate cellular location or in the
          interaction with a binding partner. They share little
          sequence conservation, but all have a common fold,
          which is electrostatically polarized. Less than 10% of
          PH domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 106

 Score = 26.4 bits (58), Expect = 3.7
 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 2/31 (6%)

Query: 23 FELLIVSLDNKQWQFEAANSEERDDWIAAIQ 53
          FEL   + + + ++F AA+  E  DW+  IQ
Sbjct: 71 FEL--TTPNQRTYEFTAASPSEARDWVDQIQ 99


>gnl|CDD|173818 cd07493, Peptidases_S8_9, Peptidase S8 family domain,
          uncharacterized subfamily 9.  This family is a member
          of the Peptidases S8 or Subtilases serine endo- and
          exo-peptidase clan. They have an Asp/His/Ser catalytic
          triad similar to that found in trypsin-like proteases,
          but do not share their three-dimensional structure and
          are not homologous to trypsin. The stability of
          subtilases may be enhanced by calcium, some members
          have been shown to bind up to 4 ions via binding sites
          with different affinity. Some members of this clan
          contain disulfide bonds. These enzymes can be intra-
          and extracellular, some function at extreme
          temperatures and pH values.
          Length = 261

 Score = 27.3 bits (61), Expect = 4.0
 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 12/50 (24%)

Query: 7  AAEIPIILVGTQDSDSFELLIVSLDNKQWQFEAANSE---ERDDWIAAIQ 53
          A   P ++VGT  + S+ L            E   SE   E D+W+AA +
Sbjct: 58 AGYTPGVMVGTAPNASYYLART---------EDVASETPVEEDNWVAAAE 98


>gnl|CDD|241538 cd13387, PH1_FGD3, FYVE, RhoGEF and PH domain
          containing/faciogenital dysplasia protein 3 pleckstrin
          homology (PH), N-terminal domain.  In general, FGDs
          have a RhoGEF (DH) domain, followed by an N-terminal PH
          domain, a FYVE domain and a C-terminal PH domain. All
          FGDs are guanine nucleotide exchange factors that
          activates the Rho GTPase Cdc42, an important regulator
          of membrane trafficking. The RhoGEF domain is
          responsible for GEF catalytic activity, while the
          N-terminal PH domain is involved in intracellular
          targeting of the DH domain. Both FGD1 and FGD3 are
          targeted by the ubiquitin ligase SCF(FWD1/beta-TrCP)
          upon phosphorylation of two serine residues in its
          DSGIDS motif and subsequently degraded by the
          proteasome. However, FGD1 and FGD3 induced
          significantly different morphological changes in HeLa
          Tet-Off cells and while FGD1 induced long finger-like
          protrusions, FGD3 induced broad sheet-like protrusions
          when the level of GTP-bound Cdc42 was significantly
          increased by the inducible expression of FGD3. They
          also reciprocally regulated cell motility in inducibly
          expressed in HeLa Tet-Off cells, FGD1 stimulated cell
          migration while FGD3 inhibited it. FGD1 and FGD3
          therefore play different roles to regulate cellular
          functions, even though their intracellular levels are
          tightly controlled by the same destruction pathway
          through SCF(FWD1/beta-TrCP).  PH domains have diverse
          functions, but in general are involved in targeting
          proteins to the appropriate cellular location or in the
          interaction with a binding partner. They share little
          sequence conservation, but all have a common fold,
          which is electrostatically polarized. Less than 10% of
          PH domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 107

 Score = 26.5 bits (58), Expect = 4.4
 Identities = 9/31 (29%), Positives = 16/31 (51%)

Query: 26 LIVSLDNKQWQFEAANSEERDDWIAAIQQQI 56
           I++   +  + +A   EE+ +WI  IQ  I
Sbjct: 67 FIITGKKRSLELQARTEEEKKEWIQVIQATI 97


>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and
           Rab22; regulates early endosome fusion.  The
           Rab5-related subfamily includes Rab5 and Rab22 of
           mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants.
           The members of this subfamily are involved in
           endocytosis and endocytic-sorting pathways. In mammals,
           Rab5 GTPases localize to early endosomes and regulate
           fusion of clathrin-coated vesicles to early endosomes
           and fusion between early endosomes. In yeast, Ypt51p
           family members similarly regulate membrane trafficking
           through prevacuolar compartments. GTPase activating
           proteins (GAPs) interact with GTP-bound Rab and
           accelerate the hydrolysis of GTP to GDP. Guanine
           nucleotide exchange factors (GEFs) interact with
           GDP-bound Rabs to promote the formation of the GTP-bound
           state. Rabs are further regulated by guanine nucleotide
           dissociation inhibitors (GDIs), which facilitate Rab
           recycling by masking C-terminal lipid binding and
           promoting cytosolic localization. Most Rab GTPases
           contain a lipid modification site at the C-terminus,
           with sequence motifs CC, CXC, or CCX. Lipid binding is
           essential for membrane attachment, a key feature of most
           Rab proteins. Due to the presence of truncated sequences
           in this CD, the lipid modification site is not available
           for annotation.
          Length = 163

 Score = 26.7 bits (60), Expect = 4.5
 Identities = 10/40 (25%), Positives = 18/40 (45%), Gaps = 1/40 (2%)

Query: 126 SNPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQD 165
            + R +    A+  A +     + ET A  G NV+ +F +
Sbjct: 119 ESKRQVSTEEAQEYADENG-LLFMETSAKTGENVNELFTE 157


>gnl|CDD|241420 cd13266, PH_Skap_family, Src kinase-associated phosphoprotein
          family Pleckstrin homology (PH) domain.  Skap adaptor
          proteins couple receptors to cytoskeletal
          rearrangements. Src kinase-associated phosphoprotein of
          55 kDa (Skap55)/Src kinase-associated phosphoprotein 1
          (Skap1), Skap2, and Skap-homology (Skap-hom) have an
          N-terminal coiled-coil conformation, a central PH
          domain and a C-terminal SH3 domain. Their PH domains
          bind 3'-phosphoinositides as well as directly affecting
          targets such as in Skap55 where it directly affecting
          integrin regulation by ADAP and NF-kappaB activation or
          in Skap-hom where the dimerization and PH domains
          comprise a 3'-phosphoinositide-gated molecular switch
          that controls ruffle formation. PH domains are only
          found in eukaryotes. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. PH domains have diverse
          functions, but in general are involved in targeting
          proteins to the appropriate cellular location or in the
          interaction with a binding partner. They share little
          sequence conservation, but all have a common fold,
          which is electrostatically polarized. Less than 10% of
          PH domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 106

 Score = 26.3 bits (58), Expect = 4.5
 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query: 23 FELLIVSLDNKQWQFEAANSEERDDWIAAIQ 53
          FE  I + D + +QF AA+ +E  +W+  I+
Sbjct: 71 FE--ISAPDKRVYQFTAASPKEAREWVDQIK 99


>gnl|CDD|241307 cd10571, PH_beta_spectrin, Beta-spectrin pleckstrin homology (PH)
           domain.  Beta spectrin binds actin and functions as a
           major component of the cytoskeleton underlying cellular
           membranes. Beta spectrin consists of multiple spectrin
           repeats followed by a PH domain, which binds to
           inositol-1,4,5-trisphosphate. The PH domain of
           beta-spectrin is thought to play a role in the
           association of spectrin with the plasma membrane of
           cells. PH domains have diverse functions, but in general
           are involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 105

 Score = 26.0 bits (58), Expect = 4.8
 Identities = 8/25 (32%), Positives = 15/25 (60%)

Query: 31  DNKQWQFEAANSEERDDWIAAIQQQ 55
           D  ++ F+A + EE +DW+  +Q  
Sbjct: 81  DGSEYLFQAKDEEEMNDWVQKLQAA 105


>gnl|CDD|241401 cd13247, BAR-PH_APPL, Adaptor protein containing PH domain, PTB
           domain, and Leucine zipper motif Bin1/amphiphysin/Rvs167
           (BAR)-Pleckstrin homology (PH) domain.  APPL (also
           called DCC-interacting protein (DIP)-13alpha) interacts
           with oncoprotein serine/threonine kinase AKT2, tumor
           suppressor protein DCC (deleted in colorectal cancer),
           Rab5, GIPC (GAIP-interacting protein, C terminus), human
           follicle-stimulating hormone receptor (FSHR), and the
           adiponectin receptors AdipoR1 and AdipoR2. There are two
           isoforms of human APPL: APPL1 and APPL2, which share
           about 50% sequence identity. APPL has a BAR and a PH
           domain near its N terminus, and the two domains are
           thought to function as a unit (BAR-PH domain).
           C-terminal to this is a PTB domain. Lipid binding assays
           show that the BAR, PH, and PTB domains can bind
           phospholipids. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 125

 Score = 26.5 bits (59), Expect = 4.9
 Identities = 7/20 (35%), Positives = 13/20 (65%)

Query: 33  KQWQFEAANSEERDDWIAAI 52
           K    +A + ++R++WIA I
Sbjct: 100 KAIVLQAESEKDREEWIATI 119


>gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH)
          domain, repeat 1.  The functions of these fungal
          proteins are unknown, but they all contain 2 PH
          domains. This cd represents the first PH repeat. PH
          domains have diverse functions, but in general are
          involved in targeting proteins to the appropriate
          cellular location or in the interaction with a binding
          partner. They share little sequence conservation, but
          all have a common fold, which is electrostatically
          polarized. Less than 10% of PH domains bind
          phosphoinositide phosphates (PIPs) with high affinity
          and specificity. PH domains are distinguished from
          other PIP-binding domains by their specific
          high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 106

 Score = 26.1 bits (58), Expect = 5.3
 Identities = 6/23 (26%), Positives = 18/23 (78%)

Query: 32 NKQWQFEAANSEERDDWIAAIQQ 54
          +K + F+A++ ++ ++W+ AI++
Sbjct: 75 SKNYHFQASSEKDANEWVEAIRE 97


>gnl|CDD|133330 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho
           family GTPase similar to Cdc42.  Wrch-1 (Wnt-1
           responsive Cdc42 homolog) is a Rho family GTPase that
           shares significant sequence and functional similarity
           with Cdc42. Wrch-1 was first identified in mouse mammary
           epithelial cells, where its transcription is upregulated
           in Wnt-1 transformation. Wrch-1 contains N- and
           C-terminal extensions relative to cdc42, suggesting
           potential differences in cellular localization and
           function. The Wrch-1 N-terminal extension contains
           putative SH3 domain-binding motifs and has been shown to
           bind the SH3 domain-containing protein Grb2, which
           increases the level of active Wrch-1 in cells. Unlike
           Cdc42, which localizes to the cytosol and perinuclear
           membranes, Wrch-1 localizes extensively with the plasma
           membrane and endosomes. The membrane association,
           localization, and biological activity of Wrch-1 indicate
           an atypical model of regulation distinct from other Rho
           family GTPases. Most Rho proteins contain a lipid
           modification site at the C-terminus, with a typical
           sequence motif CaaX, where a = an aliphatic amino acid
           and X = any amino acid. Lipid binding is essential for
           membrane attachment, a key feature of most Rho proteins.
           Due to the presence of truncated sequences in this CD,
           the lipid modification site is not available for
           annotation.
          Length = 173

 Score = 26.6 bits (59), Expect = 5.5
 Identities = 11/33 (33%), Positives = 17/33 (51%)

Query: 131 IDEARARRLASDLKRCSYYETCATYGLNVDRVF 163
           + ++RA+ LA  +  C Y E  A    N+  VF
Sbjct: 134 VSQSRAKALAEKIGACEYIECSALTQKNLKEVF 166


>gnl|CDD|177873 PLN02228, PLN02228, Phosphoinositide phospholipase C.
          Length = 567

 Score = 26.9 bits (59), Expect = 6.0
 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 2/34 (5%)

Query: 115 VRSLELDEWPESNPRIIDEARARRLAS--DLKRC 146
           V+ +ELD WP  +    +    R L S  DL++C
Sbjct: 147 VKVIELDLWPNPSGNAAEVRHGRTLTSHEDLQKC 180


>gnl|CDD|239216 cd02865, Heme_Cu_Oxidase_III_2, Heme-copper oxidase subunit III
           subfamily.  Heme-copper oxidases are transmembrane
           protein complexes in the respiratory chains of
           prokaryotes and mitochondria which couple the reduction
           of molecular oxygen to water to, proton pumping across
           the membrane. The heme-copper oxidase superfamily is
           diverse in terms of electron donors, subunit
           composition, and heme types.  This superfamily includes
           cytochrome c and ubiquinol oxidases.  Bacterial oxidases
           typically contain 3 or 4 subunits in contrast to the 13
           subunit bovine cytochrome c oxidase (CcO). Subunits I,
           II, and III of mammalian CcO are encoded within the
           mitochondrial genome and the remaining 10 subunits are
           encoded within the nuclear genome. Subunits I, II and
           III of ubiquinol oxidase are homologous to the
           corresponding subunits in CcO.  Although not required
           for catalytic activity, subunit III is believed to play
           a role in assembly of the multimer complex. Rhodobacter
           CcO subunit III stabilizes the integrity of the
           binuclear center in subunit I.  It has been proposed
           that Archaea acquired heme-copper oxidases through gene
           transfer from Gram-positive bacteria.
          Length = 184

 Score = 26.6 bits (59), Expect = 6.3
 Identities = 6/27 (22%), Positives = 8/27 (29%), Gaps = 1/27 (3%)

Query: 84  AGPTWASLNLGLLLCIQCCGVHRCLGA 110
             P   SLN  +L       +     A
Sbjct: 47  PLPNLLSLNTAVLAAS-SVAMQWARRA 72


>gnl|CDD|241446 cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol binding protein
          homologs 1 and 2 Pleckstrin homology (PH) domain.
          Yeast Osh1p is proposed to function in postsynthetic
          sterol regulation, piecemeal microautophagy of the
          nucleus, and cell polarity establishment. Yeast Osh2p
          is proposed to function in sterol metabolism and cell
          polarity establishment. Both Osh1p and Osh2p contain 3
          N-terminal ankyrin repeats, a PH domain, a FFAT motif
          (two phenylalanines in an acidic tract), and a
          C-terminal OSBP-related domain. OSBP andOsh1p PH
          domains specifically localize to the Golgi apparatus in
          a PtdIns4P-dependent manner. Oxysterol binding proteins
          are a multigene family that is conserved in yeast,
          flies, worms, mammals and plants. In general OSBPs and
          ORPs have been found to be involved in the transport
          and metabolism of cholesterol and related lipids in
          eukaryotes. They all contain a C-terminal oxysterol
          binding domain, and most contain an N-terminal PH
          domain. OSBP PH domains bind to membrane
          phosphoinositides and thus likely play an important
          role in intracellular targeting. They are members of
          the oxysterol binding protein (OSBP) family which
          includes OSBP, OSBP-related proteins (ORP), Goodpasture
          antigen binding protein (GPBP), and Four phosphate
          adaptor protein 1 (FAPP1). They have a wide range of
          purported functions including sterol transport, cell
          cycle control, pollen development and vessicle
          transport from Golgi recognize both PI lipids and ARF
          proteins. PH domains have diverse functions, but in
          general are involved in targeting proteins to the
          appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 103

 Score = 25.7 bits (57), Expect = 6.8
 Identities = 10/34 (29%), Positives = 18/34 (52%)

Query: 23 FELLIVSLDNKQWQFEAANSEERDDWIAAIQQQI 56
          FE+   +  + +W  +A +  E   WI A+Q+ I
Sbjct: 64 FEVSSKTSGSPKWYLKANHPVEAARWIQALQKAI 97


>gnl|CDD|179118 PRK00771, PRK00771, signal recognition particle protein Srp54;
           Provisional.
          Length = 437

 Score = 26.7 bits (60), Expect = 7.0
 Identities = 10/22 (45%), Positives = 14/22 (63%), Gaps = 5/22 (22%)

Query: 119 ELDEWPESNPRIIDEARARRLA 140
           EL+     NP II+ +R RR+A
Sbjct: 378 ELE-----NPEIINASRIRRIA 394


>gnl|CDD|241413 cd13259, PH5_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH
           domain Pleckstrin homology (PH) domain, repeat 5.  ARAP
           proteins (also called centaurin delta) are
           phosphatidylinositol 3,4,5-trisphosphate-dependent
           GTPase-activating proteins that modulate actin
           cytoskeleton remodeling by regulating ARF and RHO family
           members. They bind phosphatidylinositol
           3,4,5-trisphosphate (PtdIns(3,4,5)P3) and
           phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4,5)P2)
           binding. There are 3 mammalian ARAP proteins: ARAP1,
           ARAP2, and ARAP3. All ARAP proteins contain a N-terminal
           SAM (sterile alpha motif) domain, 5 PH domains, an
           ArfGAP domain, 2 ankyrin domain, A RhoGap domain, and a
           Ras-associating domain. This hierarchy contains the five
           PH domain in ARAP. PH domains have diverse functions,
           but in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 121

 Score = 25.8 bits (57), Expect = 7.1
 Identities = 9/27 (33%), Positives = 14/27 (51%)

Query: 26  LIVSLDNKQWQFEAANSEERDDWIAAI 52
             V L+ +QW       EE  +W+A+I
Sbjct: 84  FTVILEKQQWYLCCDTQEELWEWMASI 110


>gnl|CDD|206711 cd04140, ARHI_like, A Ras homolog member I (ARHI).  ARHI (A Ras
           homolog member I) is a member of the Ras family with
           several unique structural and functional properties.
           ARHI is expressed in normal human ovarian and breast
           tissue, but its expression is decreased or eliminated in
           breast and ovarian cancer. ARHI contains an N-terminal
           extension of 34 residues (human) that is required to
           retain its tumor suppressive activity. Unlike most other
           Ras family members, ARHI is maintained in the
           constitutively active (GTP-bound) state in resting cells
           and has modest GTPase activity. ARHI inhibits STAT3
           (signal transducers and activators of transcription 3),
           a latent transcription factor whose abnormal activation
           plays a critical role in oncogenesis. Most Ras proteins
           contain a lipid modification site at the C-terminus,
           with a typical sequence motif CaaX, where a = an
           aliphatic amino acid and X = any amino acid. Lipid
           binding is essential for membrane attachment, a key
           feature of most Ras proteins. Due to the presence of
           truncated sequences in this CD, the lipid modification
           site is not available for annotation.
          Length = 165

 Score = 26.3 bits (58), Expect = 7.4
 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 1/40 (2%)

Query: 125 ESNPRIIDEARARRLASDLKRCSYYETCATYGLNVDRVFQ 164
           ES  R +  +    LA     C++ ET A    NV  +FQ
Sbjct: 120 ESPSREVSSSEGAALARTWN-CAFMETSAKTNHNVQELFQ 158


>gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and
          3-Phosphoinositides Pleckstrin homology (PH) domain.
          DAPP1 (also known as PHISH/3'
          phosphoinositide-interacting SH2 domain-containing
          protein or Bam32) plays a role in B-cell activation and
          has potential roles in T-cell and mast cell function.
          DAPP1 promotes B cell receptor (BCR) induced activation
          of Rho GTPases Rac1 and Cdc42, which feed into
          mitogen-activated protein kinases (MAPK) activation
          pathways and affect cytoskeletal rearrangement.
          DAPP1can also regulate BCR-induced activation of
          extracellular signal-regulated kinase (ERK), and c-jun
          NH2-terminal kinase (JNK). DAPP1 contains an N-terminal
          SH2 domain and a C-terminal pleckstrin homology (PH)
          domain with a single tyrosine phosphorylation site
          located centrally. DAPP1 binds strongly to both
          PtdIns(3,4,5)P3 and PtdIns(3,4)P2. The PH domain is
          essential for plasma membrane recruitment of PI3K upon
          cell activation. PH domains have diverse functions, but
          in general are involved in targeting proteins to the
          appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 96

 Score = 25.3 bits (56), Expect = 7.7
 Identities = 5/22 (22%), Positives = 12/22 (54%)

Query: 35 WQFEAANSEERDDWIAAIQQQI 56
          +   A   EE D+W+  ++ ++
Sbjct: 75 FYMYAKTEEEADEWVKLLKWKL 96


>gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin
           homology (PH) domain.  DOCK-D subfamily (also called
           Zizimin subfamily) consists of Dock9/Zizimin1,
           Dock10/Zizimin3, and Dock11/Zizimin2. DOCK-D has a
           N-terminal DUF3398 domain, a PH-like domain, a Dock
           Homology Region 1, DHR1 (also called CZH1), a C2 domain,
           and a C-terminal DHR2 domain (also called CZH2).
           Zizimin1 is enriched in the brain, lung, and kidney;
           zizimin2 is found in B and T lymphocytes, and zizimin3
           is enriched in brain, lung, spleen and thymus. Zizimin1
           functions in autoinhibition and membrane targeting.
           Zizimin2 is an immune-related and age-regulated guanine
           nucleotide exchange factor, which facilitates filopodial
           formation through activation of Cdc42, which results in
           activation of cell migration. No function has been
           determined for Zizimin3 to date. The N-terminal half of
           zizimin1 binds to the GEF domain through three distinct
           areas, including CZH1, to inhibit the interaction with
           Cdc42. In addition its PH domain binds phosphoinositides
           and mediates zizimin1 membrane targeting. DOCK is a
           family of proteins involved in intracellular signalling
           networks. They act as guanine nucleotide exchange
           factors for small G proteins of the Rho family, such as
           Rac and Cdc42. There are 4 subfamilies of DOCK family
           proteins based on their sequence homology: A-D. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 125

 Score = 25.7 bits (57), Expect = 8.0
 Identities = 12/39 (30%), Positives = 16/39 (41%), Gaps = 6/39 (15%)

Query: 22  SFELLIVSLDNKQWQFEAANSEERDDWI----AAIQQQI 56
            FEL +   D K +   A +  E DDWI      +Q   
Sbjct: 80  CFELRMQ--DGKSYVLAAESESEMDDWISKLNKILQINK 116


>gnl|CDD|238509 cd01038, Endonuclease_DUF559, Domain of unknown function, appears
          to be related to a diverse group of endonucleases.
          Length = 108

 Score = 25.7 bits (57), Expect = 8.4
 Identities = 11/26 (42%), Positives = 14/26 (53%)

Query: 26 LIVSLDNKQWQFEAANSEERDDWIAA 51
          L+V LD  Q   + A   ERD W+ A
Sbjct: 54 LVVELDGGQHDEQIAYDAERDAWLEA 79


>gnl|CDD|241431 cd13277, PH_Bem3, Bud emergence protein 3 (Bem3) Pleckstrin
           homology (PH) domain.  Bud emergence in Saccharomyces
           cerevisiae involves cell cycle-regulated reorganizations
           of cortical cytoskeletal elements and requires the
           action of the Rho-type GTPase Cdc42. Bem3 contains a
           RhoGAP domain and a PH domain. Though Bem3 and Bem2 both
           contain a RhoGAP, but only Bem3 is able to stimulate the
           hydrolysis of GTP on Cdc42. Bem3 is thought to be the
           GAP for Cdc42. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 111

 Score = 25.7 bits (57), Expect = 8.5
 Identities = 7/18 (38%), Positives = 13/18 (72%)

Query: 39  AANSEERDDWIAAIQQQI 56
           A   +ERD+W++A+ + I
Sbjct: 93  AETDKERDEWVSALSEYI 110


>gnl|CDD|241294 cd01263, PH_anillin, Anillin Pleckstrin homology (PH) domain.
           Anillin (Rhotekin/RTKN; also called PLEKHK/Pleckstrin
           homology domain-containing family K) is an actin binding
           protein involved in cytokinesis. It interacts with
           GTP-bound Rho proteins and results in the inhibition of
           their GTPase activity. Dysregulation of the Rho signal
           transduction pathway has been implicated in many forms
           of cancer. Anillin proteins have a N-terminal HRI
           domain/ACC (anti-parallel coiled-coil) finger domain or
           Rho-binding domain binds small GTPases from the Rho
           family. The C-terminal PH domain helps target anillin to
           ectopic septin containing foci. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 119

 Score = 25.7 bits (57), Expect = 8.7
 Identities = 11/41 (26%), Positives = 17/41 (41%), Gaps = 8/41 (19%)

Query: 22  SFELLIVSLDN--------KQWQFEAANSEERDDWIAAIQQ 54
           +FEL  +            K+    A   EER +W+ A+ Q
Sbjct: 73  TFELETLRPAEDSDGTNEKKRVLLSADTKEERIEWLDALNQ 113


>gnl|CDD|237860 PRK14939, gyrB, DNA gyrase subunit B; Provisional.
          Length = 756

 Score = 26.2 bits (59), Expect = 9.6
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 11/37 (29%)

Query: 120 LDEWPESNP--------RIIDEARAR---RLASDLKR 145
           L E+ E NP        +IID ARAR   R A +L R
Sbjct: 358 LSEFLEENPNEAKIIVGKIIDAARAREAARKARELTR 394


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.321    0.133    0.411 

Gapped
Lambda     K      H
   0.267   0.0618    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 8,076,194
Number of extensions: 683595
Number of successful extensions: 888
Number of sequences better than 10.0: 1
Number of HSP's gapped: 888
Number of HSP's successfully gapped: 88
Length of query: 165
Length of database: 10,937,602
Length adjustment: 90
Effective length of query: 75
Effective length of database: 6,945,742
Effective search space: 520930650
Effective search space used: 520930650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.2 bits)