Query         psy1778
Match_columns 66
No_of_seqs    112 out of 2420
Neff          11.8
Searched_HMMs 46136
Date          Fri Aug 16 22:48:42 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1778.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1778hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.8 1.2E-19 2.6E-24   88.9   3.2   59    3-66    187-245 (279)
  2 KOG2462|consensus               99.6 6.8E-16 1.5E-20   75.9   2.9   53    1-58    213-265 (279)
  3 KOG3623|consensus               99.4 4.6E-14   1E-18   77.0   1.4   51    2-57    921-971 (1007)
  4 KOG3623|consensus               99.3 3.3E-13 7.2E-18   73.8   1.7   59    3-66    894-952 (1007)
  5 PHA02768 hypothetical protein;  99.2 7.9E-12 1.7E-16   48.7   2.5   43    4-53      6-48  (55)
  6 KOG1074|consensus               99.2 2.8E-12   6E-17   70.9   0.1   56    3-63    353-408 (958)
  7 KOG3576|consensus               99.2 9.3E-12   2E-16   59.8   0.9   54    3-61    145-198 (267)
  8 PHA00733 hypothetical protein   99.1 4.2E-10 9.1E-15   51.1   4.6   53    2-61     72-124 (128)
  9 KOG1074|consensus               99.1 6.4E-11 1.4E-15   65.8   2.2   56    4-64    880-935 (958)
 10 KOG3576|consensus               98.9 1.1E-10 2.3E-15   56.3  -0.4   58    4-66    118-175 (267)
 11 PF13465 zf-H2C2_2:  Zinc-finge  98.9 2.2E-09 4.8E-14   36.2   2.2   26   20-48      1-26  (26)
 12 PHA00616 hypothetical protein   98.9 1.9E-09 4.1E-14   40.4   1.9   34    3-39      1-34  (44)
 13 PHA00616 hypothetical protein   98.7 1.1E-08 2.4E-13   38.3   1.6   30   35-66      2-31  (44)
 14 KOG3608|consensus               98.7 4.1E-08 8.9E-13   50.9   3.8   55    2-60    291-345 (467)
 15 PHA00732 hypothetical protein   98.6   1E-07 2.3E-12   40.0   2.8   44    3-57      1-45  (79)
 16 KOG3993|consensus               98.4 1.7E-07 3.6E-12   49.6   1.7   53    4-61    296-381 (500)
 17 KOG3608|consensus               98.3 1.3E-06 2.8E-11   45.6   3.9   52    4-60    264-316 (467)
 18 PF00096 zf-C2H2:  Zinc finger,  98.3 5.8E-07 1.3E-11   29.1   1.7   21    5-27      2-22  (23)
 19 PHA02768 hypothetical protein;  98.2 1.3E-06 2.9E-11   34.2   1.8   24   35-60      6-29  (55)
 20 COG5189 SFP1 Putative transcri  98.2 6.4E-07 1.4E-11   46.1   1.1   54    1-57    347-419 (423)
 21 PF00096 zf-C2H2:  Zinc finger,  98.1 2.9E-06 6.2E-11   27.4   1.5   23   35-59      1-23  (23)
 22 PF05605 zf-Di19:  Drought indu  98.1 3.5E-05 7.5E-10   30.1   4.7   51    3-61      2-54  (54)
 23 PF13912 zf-C2H2_6:  C2H2-type   97.9 4.7E-06   1E-10   28.0   1.1   22    4-27      2-23  (27)
 24 PF13894 zf-C2H2_4:  C2H2-type   97.9 1.1E-05 2.4E-10   26.0   1.7   18   10-27      5-22  (24)
 25 PLN03086 PRLI-interacting fact  97.9 3.1E-05 6.8E-10   42.8   4.2   53    2-64    452-504 (567)
 26 PF13894 zf-C2H2_4:  C2H2-type   97.9   2E-05 4.3E-10   25.3   2.1   24   35-60      1-24  (24)
 27 PF09237 GAGA:  GAGA factor;  I  97.9 2.6E-05 5.6E-10   30.1   2.5   33   30-65     21-53  (54)
 28 PF13912 zf-C2H2_6:  C2H2-type   97.9 5.5E-06 1.2E-10   27.8   0.6   25   35-61      2-26  (27)
 29 PHA00733 hypothetical protein   97.8 1.1E-05 2.3E-10   36.9   1.1   53    2-59     39-96  (128)
 30 smart00355 ZnF_C2H2 zinc finge  97.7 9.9E-05 2.1E-09   23.9   2.8   22    5-28      2-23  (26)
 31 PF09237 GAGA:  GAGA factor;  I  97.7 6.7E-05 1.4E-09   29.0   2.2   30    2-33     23-52  (54)
 32 PLN03086 PRLI-interacting fact  97.5 0.00028   6E-09   39.3   4.1   55    2-64    477-541 (567)
 33 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00078 1.7E-08   21.8   1.8   16   10-26      5-20  (24)
 34 PRK04860 hypothetical protein;  97.0 0.00062 1.3E-08   32.4   1.9   38    3-49    119-156 (160)
 35 PF12874 zf-met:  Zinc-finger o  96.8 0.00099 2.2E-08   21.6   1.2   16   42-57      6-21  (25)
 36 PF12756 zf-C2H2_2:  C2H2 type   96.5  0.0029 6.3E-08   27.2   1.9   49    6-59      2-73  (100)
 37 PHA00732 hypothetical protein   96.4  0.0027 5.9E-08   26.8   1.6   22   35-58      2-23  (79)
 38 PF12171 zf-C2H2_jaz:  Zinc-fin  96.0  0.0017 3.6E-08   21.6  -0.1   20    4-25      2-21  (27)
 39 PF13913 zf-C2HC_2:  zinc-finge  95.9   0.011 2.3E-07   19.5   1.8   19   36-57      4-22  (25)
 40 COG5048 FOG: Zn-finger [Genera  95.1   0.003 6.5E-08   33.3  -1.0   58    3-63    289-350 (467)
 41 smart00451 ZnF_U1 U1-like zinc  94.9   0.032 6.9E-07   19.4   1.7   22    3-26      3-24  (35)
 42 KOG3993|consensus               94.7  0.0031 6.8E-08   34.3  -1.6   51    4-59    268-318 (500)
 43 PF12756 zf-C2H2_2:  C2H2 type   94.3   0.074 1.6E-06   22.7   2.4   26    3-30     50-75  (100)
 44 KOG2893|consensus               94.2   0.018 3.9E-07   29.4   0.5   39   10-55     15-53  (341)
 45 COG5048 FOG: Zn-finger [Genera  92.5    0.14 3.1E-06   27.2   2.1   57    2-61     32-88  (467)
 46 COG4049 Uncharacterized protei  92.1   0.082 1.8E-06   20.9   0.8   21    4-26     18-38  (65)
 47 COG5189 SFP1 Putative transcri  91.4    0.14   3E-06   27.4   1.3   26   31-57    347-372 (423)
 48 KOG1146|consensus               90.4    0.31 6.8E-06   30.7   2.3   52    2-58    464-540 (1406)
 49 PF12013 DUF3505:  Protein of u  84.3     1.1 2.3E-05   20.0   1.7   25   35-61     81-109 (109)
 50 cd00350 rubredoxin_like Rubred  82.2     1.2 2.7E-05   15.4   1.2   24    4-44      2-25  (33)
 51 PF15269 zf-C2H2_7:  Zinc-finge  81.6     1.5 3.3E-05   16.6   1.4   22    4-27     21-42  (54)
 52 KOG4167|consensus               80.7     0.3 6.5E-06   29.0  -0.9   24    4-29    793-816 (907)
 53 PF04959 ARS2:  Arsenite-resist  77.8     1.9 4.1E-05   21.9   1.4   24    3-28     77-100 (214)
 54 PF09538 FYDLN_acid:  Protein o  76.2     2.6 5.7E-05   19.1   1.5   30    4-49     10-39  (108)
 55 PF05443 ROS_MUCR:  ROS/MUCR tr  74.2     2.1 4.6E-05   20.1   1.0   23   35-62     73-95  (132)
 56 KOG1146|consensus               72.7     1.9 4.2E-05   27.6   0.9   54    2-61   1283-1353(1406)
 57 PHA00626 hypothetical protein   71.3     2.1 4.7E-05   17.1   0.6   14    3-18     23-36  (59)
 58 COG2879 Uncharacterized small   71.1     5.9 0.00013   16.2   1.8   19   48-66     24-42  (65)
 59 smart00614 ZnF_BED BED zinc fi  70.8     5.2 0.00011   15.1   1.6   21   35-57     19-44  (50)
 60 PF07754 DUF1610:  Domain of un  70.1     2.5 5.4E-05   13.8   0.6    8    3-12     16-23  (24)
 61 PF09845 DUF2072:  Zn-ribbon co  69.4     3.1 6.6E-05   19.6   1.0   15    3-19      1-15  (131)
 62 smart00834 CxxC_CXXC_SSSS Puta  68.0     2.4 5.3E-05   15.0   0.4   12    4-17      6-17  (41)
 63 PRK09678 DNA-binding transcrip  67.4     1.7 3.8E-05   18.2  -0.0   44    4-52      2-45  (72)
 64 TIGR00373 conserved hypothetic  66.8     5.3 0.00011   19.2   1.5   31    4-48    110-140 (158)
 65 PF13719 zinc_ribbon_5:  zinc-r  66.7     6.2 0.00014   14.0   1.5   33    5-47      4-36  (37)
 66 smart00659 RPOLCX RNA polymera  66.6     5.7 0.00012   14.9   1.3   26    4-45      3-28  (44)
 67 KOG2071|consensus               66.4     6.1 0.00013   23.3   1.9   26    2-29    417-442 (579)
 68 PF13451 zf-trcl:  Probable zin  65.2     2.9 6.3E-05   16.2   0.4   16    2-19      3-18  (49)
 69 PF09723 Zn-ribbon_8:  Zinc rib  64.0     2.9 6.3E-05   15.3   0.3   29    4-44      6-34  (42)
 70 KOG2932|consensus               63.1     7.6 0.00016   21.2   1.7   27   35-61    145-172 (389)
 71 KOG3408|consensus               62.6       4 8.6E-05   19.0   0.6   22   35-58     58-79  (129)
 72 PF10571 UPF0547:  Uncharacteri  62.5     5.5 0.00012   13.1   0.8    6   10-15     19-24  (26)
 73 PRK06266 transcription initiat  61.1     6.9 0.00015   19.3   1.3   32    3-48    117-148 (178)
 74 smart00154 ZnF_AN1 AN1-like Zi  60.8     4.7  0.0001   14.6   0.6   13    3-17     12-24  (39)
 75 COG1592 Rubrerythrin [Energy p  60.2     8.3 0.00018   19.0   1.5   23    4-44    135-157 (166)
 76 KOG4173|consensus               59.9     3.1 6.7E-05   21.2   0.1   50    5-57    108-167 (253)
 77 TIGR02605 CxxC_CxxC_SSSS putat  59.5     4.1 8.8E-05   15.4   0.4   12    4-17      6-17  (52)
 78 COG3357 Predicted transcriptio  58.0     5.5 0.00012   17.6   0.7   14    2-17     57-70  (97)
 79 TIGR02098 MJ0042_CXXC MJ0042 f  57.1     9.8 0.00021   13.3   1.2   34    4-47      3-36  (38)
 80 TIGR02300 FYDLN_acid conserved  54.2      15 0.00033   17.3   1.8   30    4-49     10-39  (129)
 81 smart00734 ZnF_Rad18 Rad18-lik  54.2      10 0.00022   12.4   1.4   18   36-56      3-20  (26)
 82 PF01428 zf-AN1:  AN1-like Zinc  54.1     4.4 9.5E-05   14.9   0.0   13    3-17     13-25  (43)
 83 PF04780 DUF629:  Protein of un  52.9      15 0.00032   21.3   1.9   25    4-30     58-83  (466)
 84 PF13453 zf-TFIIB:  Transcripti  51.9      14  0.0003   13.3   1.8   19    4-24     20-38  (41)
 85 KOG2186|consensus               50.9     7.4 0.00016   20.6   0.6   46    4-57      4-49  (276)
 86 PLN02294 cytochrome c oxidase   50.0     8.9 0.00019   19.0   0.7   14    2-17    140-153 (174)
 87 PF13717 zinc_ribbon_4:  zinc-r  48.7      16 0.00034   12.9   1.4   32    5-46      4-35  (36)
 88 COG4957 Predicted transcriptio  47.8      11 0.00023   18.0   0.8   24    5-33     78-101 (148)
 89 PF09986 DUF2225:  Uncharacteri  47.6       9  0.0002   19.4   0.6   23    1-25      3-25  (214)
 90 smart00531 TFIIE Transcription  47.0      30 0.00066   16.4   2.2   36    3-47     99-134 (147)
 91 COG3364 Zn-ribbon containing p  47.0      10 0.00022   17.2   0.6   14    3-18      2-15  (112)
 92 KOG2231|consensus               46.7      23 0.00049   21.6   2.0   17   10-26    187-203 (669)
 93 PRK00398 rpoP DNA-directed RNA  46.0      11 0.00023   14.0   0.5   31    2-47      2-32  (46)
 94 PF08790 zf-LYAR:  LYAR-type C2  45.8     4.5 9.7E-05   13.7  -0.4    6   10-15      5-10  (28)
 95 COG3677 Transposase and inacti  45.6      11 0.00024   17.6   0.7   14    3-18     53-66  (129)
 96 COG1997 RPL43A Ribosomal prote  45.0     8.3 0.00018   16.9   0.2   31    3-48     35-65  (89)
 97 PF11789 zf-Nse:  Zinc-finger o  44.2      10 0.00023   15.0   0.4    7   10-16     29-35  (57)
 98 PF04606 Ogr_Delta:  Ogr/Delta-  42.9      11 0.00023   14.2   0.3   13    4-16     26-38  (47)
 99 PF02892 zf-BED:  BED zinc fing  42.4      22 0.00047   12.8   1.7   21   35-57     17-41  (45)
100 COG1773 Rubredoxin [Energy pro  42.2      12 0.00025   14.9   0.4   15    2-18      2-16  (55)
101 COG2888 Predicted Zn-ribbon RN  42.2      26 0.00055   14.3   1.3    8    4-13     28-35  (61)
102 KOG0717|consensus               40.0      18 0.00038   21.1   1.0   21   35-57    293-313 (508)
103 KOG0227|consensus               38.6      15 0.00033   18.7   0.5   19   35-55     54-72  (222)
104 cd00729 rubredoxin_SM Rubredox  38.6      16 0.00035   12.7   0.5   25    3-44      2-26  (34)
105 KOG1994|consensus               38.3      15 0.00033   19.2   0.5   19   35-55    240-258 (268)
106 KOG2482|consensus               37.6      33 0.00071   19.3   1.7   23    4-28    196-218 (423)
107 PF03604 DNA_RNApol_7kD:  DNA d  37.4      14 0.00031   12.8   0.3   26    4-45      1-26  (32)
108 PRK00464 nrdR transcriptional   35.8      14 0.00031   17.9   0.2   13    4-18     29-41  (154)
109 KOG2593|consensus               35.3      32 0.00069   19.8   1.5   16    3-20    128-143 (436)
110 cd00730 rubredoxin Rubredoxin;  35.1      23  0.0005   13.7   0.7   13    4-18      2-14  (50)
111 KOG2785|consensus               33.2      99  0.0021   17.7   3.3   52    3-58    166-242 (390)
112 KOG2807|consensus               32.0      89  0.0019   17.6   2.7   21   32-55    289-309 (378)
113 PTZ00043 cytochrome c oxidase   29.6      31 0.00067   18.2   0.8   15    2-18    180-194 (268)
114 KOG4124|consensus               29.3      20 0.00043   20.1   0.1   22   30-55    210-231 (442)
115 smart00440 ZnF_C2C2 C2C2 Zinc   29.2      28  0.0006   12.6   0.5   10    4-15     29-38  (40)
116 PTZ00448 hypothetical protein;  28.9      68  0.0015   18.2   2.0   23    3-27    314-336 (373)
117 KOG1842|consensus               28.4      39 0.00084   19.7   1.1   25   35-61     16-40  (505)
118 PF10426 zf-RAG1:  Recombinatio  27.9      41 0.00089   11.6   0.8    7   37-43      5-11  (30)
119 PF01927 Mut7-C:  Mut7-C RNAse   27.5      29 0.00062   16.5   0.5   10    4-15    125-134 (147)
120 COG3809 Uncharacterized protei  27.4      67  0.0015   13.9   1.5   21    6-28     24-44  (88)
121 PF04328 DUF466:  Protein of un  26.5      62  0.0013   13.3   1.9   12   54-65     30-41  (65)
122 PF07975 C1_4:  TFIIH C1-like d  26.1       8 0.00017   15.1  -1.2   13    4-18     22-34  (51)
123 PF10013 DUF2256:  Uncharacteri  26.1      39 0.00084   12.7   0.6   11    6-18     11-21  (42)
124 PF06858 NOG1:  Nucleolar GTP-b  25.6      54  0.0012   13.2   1.0   23   42-64     27-49  (58)
125 PF08792 A2L_zn_ribbon:  A2L zi  25.4      33 0.00071   12.0   0.4    6   10-15     26-31  (33)
126 PF10276 zf-CHCC:  Zinc-finger   24.8      24 0.00053   13.0  -0.0    6   10-15     34-39  (40)
127 KOG4385|consensus               24.0      57  0.0012   19.3   1.2   23    5-27    211-233 (581)
128 PF00301 Rubredoxin:  Rubredoxi  23.9      26 0.00055   13.4  -0.0   13    4-18      2-14  (47)
129 PLN03238 probable histone acet  23.7 1.4E+02   0.003   16.5   2.5   23    3-27     48-70  (290)
130 cd00974 DSRD Desulforedoxin (D  23.6      39 0.00084   11.5   0.4   11    3-15      4-14  (34)
131 KOG2295|consensus               23.6      84  0.0018   19.1   1.8   26    2-27    508-533 (648)
132 KOG4377|consensus               23.5      92   0.002   18.1   1.9   28    3-30    271-298 (480)
133 TIGR00319 desulf_FeS4 desulfof  23.4      38 0.00082   11.5   0.4   11    3-15      7-17  (34)
134 PRK03824 hypA hydrogenase nick  23.3      28  0.0006   16.4   0.0   14    3-18     70-83  (135)
135 TIGR03831 YgiT_finger YgiT-typ  22.9      44 0.00096   11.8   0.6   10    4-15     33-42  (46)
136 KOG4727|consensus               22.4      44 0.00096   16.8   0.6   21   35-57     76-96  (193)
137 COG5216 Uncharacterized conser  22.0      47   0.001   13.5   0.6   29    4-43     23-51  (67)
138 PF01215 COX5B:  Cytochrome c o  21.9      19 0.00042   17.1  -0.6   13    2-16    111-123 (136)
139 PF04423 Rad50_zn_hook:  Rad50   21.7      37 0.00081   13.0   0.3   12    5-18     22-33  (54)
140 COG5236 Uncharacterized conser  21.7 1.3E+02  0.0027   17.3   2.2   20    6-27    223-242 (493)
141 COG1996 RPC10 DNA-directed RNA  21.4      30 0.00066   13.4  -0.0   11    3-15      6-16  (49)
142 TIGR00622 ssl1 transcription f  21.3      90   0.002   14.5   1.4   23   35-59     82-104 (112)
143 COG4530 Uncharacterized protei  21.2      87  0.0019   14.6   1.3   12    2-15     25-36  (129)
144 PF01286 XPA_N:  XPA protein N-  21.2      35 0.00076   12.1   0.1   12    5-18      5-16  (34)
145 PF06397 Desulfoferrod_N:  Desu  21.1      35 0.00076   12.3   0.1   11    3-15      6-16  (36)
146 PF14353 CpXC:  CpXC protein     20.5      49  0.0011   15.1   0.5   13    4-18     39-51  (128)
147 KOG2636|consensus               20.4      96  0.0021   18.3   1.6   27   26-55    394-421 (497)
148 PF13878 zf-C2H2_3:  zinc-finge  20.2      71  0.0015   11.6   2.6   23    4-28     14-38  (41)
149 TIGR00244 transcriptional regu  20.2      54  0.0012   16.0   0.6   13    5-19     30-42  (147)
150 PF14690 zf-ISL3:  zinc-finger   20.0      65  0.0014   11.6   0.8    9    3-13      2-10  (47)

No 1  
>KOG2462|consensus
Probab=99.78  E-value=1.2e-19  Score=88.88  Aligned_cols=59  Identities=36%  Similarity=0.672  Sum_probs=55.3

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHhhCCCCCC
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNKIT   66 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~~~~~~   66 (66)
                      |.+|.  .||+.|+..+-|+-|+++|+|++| |.|..  |++.|...++|..|++||.+.|+|+
T Consensus       187 ~c~C~--iCGKaFSRPWLLQGHiRTHTGEKP-F~C~h--C~kAFADRSNLRAHmQTHS~~K~~q  245 (279)
T KOG2462|consen  187 PCECG--ICGKAFSRPWLLQGHIRTHTGEKP-FSCPH--CGKAFADRSNLRAHMQTHSDVKKHQ  245 (279)
T ss_pred             Ccccc--cccccccchHHhhcccccccCCCC-ccCCc--ccchhcchHHHHHHHHhhcCCcccc
Confidence            56677  999999999999999999999999 99988  9999999999999999999999885


No 2  
>KOG2462|consensus
Probab=99.60  E-value=6.8e-16  Score=75.94  Aligned_cols=53  Identities=38%  Similarity=0.739  Sum_probs=50.4

Q ss_pred             CCcccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHH
Q psy1778           1 MRMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKH   58 (66)
Q Consensus         1 ~~~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~   58 (66)
                      ||||.|.  .|++.|..+++|..||++|.+.+. |+|..  |+++|...+.|..|...
T Consensus       213 EKPF~C~--hC~kAFADRSNLRAHmQTHS~~K~-~qC~~--C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  213 EKPFSCP--HCGKAFADRSNLRAHMQTHSDVKK-HQCPR--CGKSFALKSYLNKHSES  265 (279)
T ss_pred             CCCccCC--cccchhcchHHHHHHHHhhcCCcc-ccCcc--hhhHHHHHHHHHHhhhh
Confidence            7999999  999999999999999999999999 99987  99999999999999763


No 3  
>KOG3623|consensus
Probab=99.42  E-value=4.6e-14  Score=77.05  Aligned_cols=51  Identities=35%  Similarity=0.729  Sum_probs=26.1

Q ss_pred             CcccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHH
Q psy1778           2 RMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLK   57 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~   57 (66)
                      |||.|.  .|.+.|..+-+|..|++.|.|++| |+|..  |+++|+.+.++.+||.
T Consensus       921 RPyqC~--iCkKAFKHKHHLtEHkRLHSGEKP-fQCdK--ClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  921 RPYQCI--ICKKAFKHKHHLTEHKRLHSGEKP-FQCDK--CLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             CCcccc--hhhHhhhhhhhhhhhhhhccCCCc-chhhh--hhhhcccccchHhhhc
Confidence            455555  555555555555555555555555 55533  5555555555555543


No 4  
>KOG3623|consensus
Probab=99.35  E-value=3.3e-13  Score=73.84  Aligned_cols=59  Identities=24%  Similarity=0.600  Sum_probs=56.8

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHhhCCCCCC
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNKIT   66 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~~~~~~   66 (66)
                      +|.|.  .|++.|.-.+.|.+|.--|+|++| ++|.+  |.+.|.....|..|.|.|.|||||+
T Consensus       894 myaCD--qCDK~FqKqSSLaRHKYEHsGqRP-yqC~i--CkKAFKHKHHLtEHkRLHSGEKPfQ  952 (1007)
T KOG3623|consen  894 MYACD--QCDKAFQKQSSLARHKYEHSGQRP-YQCII--CKKAFKHKHHLTEHKRLHSGEKPFQ  952 (1007)
T ss_pred             cchHH--HHHHHHHhhHHHHHhhhhhcCCCC-cccch--hhHhhhhhhhhhhhhhhccCCCcch
Confidence            68899  999999999999999999999999 99988  9999999999999999999999996


No 5  
>PHA02768 hypothetical protein; Provisional
Probab=99.24  E-value=7.9e-12  Score=48.75  Aligned_cols=43  Identities=19%  Similarity=0.580  Sum_probs=37.7

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHH
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLY   53 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~   53 (66)
                      |.|+  .||+.|.+..+|..|+++|+  ++ +.|..  |++.|...+.|.
T Consensus         6 y~C~--~CGK~Fs~~~~L~~H~r~H~--k~-~kc~~--C~k~f~~~s~l~   48 (55)
T PHA02768          6 YECP--ICGEIYIKRKSMITHLRKHN--TN-LKLSN--CKRISLRTGEYI   48 (55)
T ss_pred             cCcc--hhCCeeccHHHHHHHHHhcC--Cc-ccCCc--ccceecccceeE
Confidence            6788  99999999999999999998  57 88966  999998777654


No 6  
>KOG1074|consensus
Probab=99.19  E-value=2.8e-12  Score=70.91  Aligned_cols=56  Identities=27%  Similarity=0.539  Sum_probs=51.3

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHhhCCC
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTN   63 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~~~   63 (66)
                      +++|.  .|.+.|...+.|+.|.+.|++++| |+|.+  |+..|+...+|..|...|...-
T Consensus       353 khkCr--~CakvfgS~SaLqiHlRSHTGERP-fqCnv--CG~~FSTkGNLKvH~~rH~e~~  408 (958)
T KOG1074|consen  353 KHKCR--FCAKVFGSDSALQIHLRSHTGERP-FQCNV--CGNRFSTKGNLKVHFQRHREKY  408 (958)
T ss_pred             cchhh--hhHhhcCchhhhhhhhhccCCCCC-eeecc--cccccccccceeeeeeeccccC
Confidence            36788  999999999999999999999999 99988  9999999999999988776554


No 7  
>KOG3576|consensus
Probab=99.16  E-value=9.3e-12  Score=59.82  Aligned_cols=54  Identities=33%  Similarity=0.698  Sum_probs=47.9

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHhhC
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHS   61 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~   61 (66)
                      -+.|.  .||+.|.....|.+|+++|++.+| |.|..  |++.|.+.-+|..|++..+|
T Consensus       145 r~lct--~cgkgfndtfdlkrh~rthtgvrp-ykc~~--c~kaftqrcsleshl~kvhg  198 (267)
T KOG3576|consen  145 RHLCT--FCGKGFNDTFDLKRHTRTHTGVRP-YKCSL--CEKAFTQRCSLESHLKKVHG  198 (267)
T ss_pred             HHHHh--hccCcccchhhhhhhhccccCccc-cchhh--hhHHHHhhccHHHHHHHHcC
Confidence            46677  899999999999999999999999 99988  99999999999999886654


No 8  
>PHA00733 hypothetical protein
Probab=99.09  E-value=4.2e-10  Score=51.06  Aligned_cols=53  Identities=25%  Similarity=0.493  Sum_probs=46.8

Q ss_pred             CcccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHhhC
Q psy1778           2 RMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHS   61 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~   61 (66)
                      +||.|.  .|++.|.....|..|+.++  ..+ +.|..  |++.|.....|..|+...++
T Consensus        72 kPy~C~--~Cgk~Fss~s~L~~H~r~h--~~~-~~C~~--CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         72 SPYVCP--LCLMPFSSSVSLKQHIRYT--EHS-KVCPV--CGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCccCC--CCCCcCCCHHHHHHHHhcC--CcC-ccCCC--CCCccCCHHHHHHHHHHhcC
Confidence            689999  9999999999999999876  357 89987  99999999999999887654


No 9  
>KOG1074|consensus
Probab=99.08  E-value=6.4e-11  Score=65.78  Aligned_cols=56  Identities=30%  Similarity=0.618  Sum_probs=51.5

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHhhCCCC
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNK   64 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~~~~   64 (66)
                      ..|.  .|++.|.....|..|+++|++++| |.|.+  |.+.|....+|..||.+|....+
T Consensus       880 h~C~--vCgk~FsSSsALqiH~rTHtg~KP-F~C~f--C~~aFttrgnLKvHMgtH~w~q~  935 (958)
T KOG1074|consen  880 HVCN--VCGKQFSSSAALEIHMRTHTGPKP-FFCHF--CEEAFTTRGNLKVHMGTHMWVQP  935 (958)
T ss_pred             hhhc--cchhcccchHHHHHhhhcCCCCCC-ccchh--hhhhhhhhhhhhhhhccccccCC
Confidence            4677  999999999999999999999999 99988  99999999999999999875544


No 10 
>KOG3576|consensus
Probab=98.94  E-value=1.1e-10  Score=56.29  Aligned_cols=58  Identities=24%  Similarity=0.491  Sum_probs=53.8

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHhhCCCCCC
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNKIT   66 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~~~~~~   66 (66)
                      +.|.  .|++.|....-|.+|++.|...+. +.|..  |++.|...-.|..|+++|+|.+||.
T Consensus       118 ftCr--vCgK~F~lQRmlnrh~kch~~vkr-~lct~--cgkgfndtfdlkrh~rthtgvrpyk  175 (267)
T KOG3576|consen  118 FTCR--VCGKKFGLQRMLNRHLKCHSDVKR-HLCTF--CGKGFNDTFDLKRHTRTHTGVRPYK  175 (267)
T ss_pred             eeee--hhhhhhhHHHHHHHHhhhccHHHH-HHHhh--ccCcccchhhhhhhhccccCccccc
Confidence            6688  999999999999999999999888 89988  9999999999999999999999983


No 11 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.89  E-value=2.2e-09  Score=36.21  Aligned_cols=26  Identities=42%  Similarity=0.979  Sum_probs=22.9

Q ss_pred             HHHHHHHHhcCCCCCccCCcccccccccc
Q psy1778          20 HLQEHMLQHNENKPKFTCPYQDCLMSYVA   48 (66)
Q Consensus        20 ~l~~~~~~~~~~~~~~~c~~~~c~~~f~~   48 (66)
                      +|..|+++|++++| |.|..  |++.|.+
T Consensus         1 ~l~~H~~~H~~~k~-~~C~~--C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKP-YKCPY--CGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSS-EEESS--SSEEESS
T ss_pred             CHHHHhhhcCCCCC-CCCCC--CcCeeCc
Confidence            47899999999999 99987  9998863


No 12 
>PHA00616 hypothetical protein
Probab=98.87  E-value=1.9e-09  Score=40.36  Aligned_cols=34  Identities=29%  Similarity=0.693  Sum_probs=29.3

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcCCCCCccCCc
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPY   39 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~   39 (66)
                      ||.|.  .||+.|...+++..|++.++++++ +.|..
T Consensus         1 pYqC~--~CG~~F~~~s~l~~H~r~~hg~~~-~~~~~   34 (44)
T PHA00616          1 MYQCL--RCGGIFRKKKEVIEHLLSVHKQNK-LTLEY   34 (44)
T ss_pred             CCccc--hhhHHHhhHHHHHHHHHHhcCCCc-cceeE
Confidence            68888  999999999999999999998888 77653


No 13 
>PHA00616 hypothetical protein
Probab=98.70  E-value=1.1e-08  Score=38.29  Aligned_cols=30  Identities=33%  Similarity=0.568  Sum_probs=27.4

Q ss_pred             ccCCcccccccccccchHHHHHHHhhCCCCCC
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAHLKHVHSTNKIT   66 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h~~~~~~~~~~~   66 (66)
                      ++|..  |+..|.....+..|++.|++++++.
T Consensus         2 YqC~~--CG~~F~~~s~l~~H~r~~hg~~~~~   31 (44)
T PHA00616          2 YQCLR--CGGIFRKKKEVIEHLLSVHKQNKLT   31 (44)
T ss_pred             Cccch--hhHHHhhHHHHHHHHHHhcCCCccc
Confidence            78976  9999999999999999999998863


No 14 
>KOG3608|consensus
Probab=98.67  E-value=4.1e-08  Score=50.93  Aligned_cols=55  Identities=25%  Similarity=0.571  Sum_probs=38.1

Q ss_pred             CcccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHhh
Q psy1778           2 RMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVH   60 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~   60 (66)
                      |||+|.  .|.+.+...+.|.+|..+|+ +.. |.|..++|...+.....+..|.+.++
T Consensus       291 kpfKCd--~Cd~~c~~esdL~kH~~~HS-~~~-y~C~h~~C~~s~r~~~q~~~H~~evh  345 (467)
T KOG3608|consen  291 KPFKCD--ECDTRCVRESDLAKHVQVHS-KTV-YQCEHPDCHYSVRTYTQMRRHFLEVH  345 (467)
T ss_pred             CCcccc--chhhhhccHHHHHHHHHhcc-ccc-eecCCCCCcHHHHHHHHHHHHHHHhc
Confidence            677777  77777777777777777665 344 67776677777777777777766555


No 15 
>PHA00732 hypothetical protein
Probab=98.56  E-value=1e-07  Score=40.04  Aligned_cols=44  Identities=36%  Similarity=0.706  Sum_probs=36.1

Q ss_pred             cccCCccccCccccChHHHHHHHHH-hcCCCCCccCCcccccccccccchHHHHHH
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQ-HNENKPKFTCPYQDCLMSYVAKSSLYAHLK   57 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~-~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~   57 (66)
                      ||.|.  .|++.|.+...|..|++. |.   + +.|..  |++.|.   .+..|..
T Consensus         1 py~C~--~Cgk~F~s~s~Lk~H~r~~H~---~-~~C~~--CgKsF~---~l~~H~~   45 (79)
T PHA00732          1 MFKCP--ICGFTTVTLFALKQHARRNHT---L-TKCPV--CNKSYR---RLNQHFY   45 (79)
T ss_pred             CccCC--CCCCccCCHHHHHHHhhcccC---C-CccCC--CCCEeC---Chhhhhc
Confidence            68899  999999999999999984 54   4 68977  999987   4666654


No 16 
>KOG3993|consensus
Probab=98.40  E-value=1.7e-07  Score=49.57  Aligned_cols=53  Identities=25%  Similarity=0.485  Sum_probs=44.5

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcC---------------------------------CCCCccCCcccccccccccc
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNE---------------------------------NKPKFTCPYQDCLMSYVAKS   50 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~---------------------------------~~~~~~c~~~~c~~~f~~~~   50 (66)
                      |+|+  +|++.|+...+|..|.+.|..                                 +.. |.|..  |++.|....
T Consensus       296 YrCP--EC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi-~~C~~--C~KkFrRqA  370 (500)
T KOG3993|consen  296 YRCP--ECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGI-FSCHT--CGKKFRRQA  370 (500)
T ss_pred             ecCC--cccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCce-eecHH--hhhhhHHHH
Confidence            7899  999999999999999986621                                 113 67877  999999999


Q ss_pred             hHHHHHHHhhC
Q psy1778          51 SLYAHLKHVHS   61 (66)
Q Consensus        51 ~l~~h~~~~~~   61 (66)
                      +|..|+.+|+.
T Consensus       371 YLrKHqlthq~  381 (500)
T KOG3993|consen  371 YLRKHQLTHQR  381 (500)
T ss_pred             HHHHhHHhhhc
Confidence            99999888764


No 17 
>KOG3608|consensus
Probab=98.33  E-value=1.3e-06  Score=45.62  Aligned_cols=52  Identities=29%  Similarity=0.617  Sum_probs=42.9

Q ss_pred             ccCCccccCccccChHHHHHHHHH-hcCCCCCccCCcccccccccccchHHHHHHHhh
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQ-HNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVH   60 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~-~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~   60 (66)
                      |+|+  .|.......+.|..|++. |..++| |+|.-  |+..+...+.|..|..+|.
T Consensus       264 ykCp--lCdmtc~~~ssL~~H~r~rHs~dkp-fKCd~--Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  264 YKCP--LCDMTCSSASSLTTHIRYRHSKDKP-FKCDE--CDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             cccc--ccccCCCChHHHHHHHHhhhccCCC-ccccc--hhhhhccHHHHHHHHHhcc
Confidence            6788  888888888888888774 677888 89966  9999999999999988654


No 18 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.31  E-value=5.8e-07  Score=29.15  Aligned_cols=21  Identities=48%  Similarity=1.001  Sum_probs=11.8

Q ss_pred             cCCccccCccccChHHHHHHHHH
Q psy1778           5 PCPLVTCGKSFLRSEHLQEHMLQ   27 (66)
Q Consensus         5 ~c~~~~c~~~~~~~~~l~~~~~~   27 (66)
                      .|.  .|++.|.....|..|++.
T Consensus         2 ~C~--~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    2 KCP--ICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EET--TTTEEESSHHHHHHHHHH
T ss_pred             CCC--CCCCccCCHHHHHHHHhH
Confidence            455  555666655555555543


No 19 
>PHA02768 hypothetical protein; Provisional
Probab=98.19  E-value=1.3e-06  Score=34.21  Aligned_cols=24  Identities=29%  Similarity=0.797  Sum_probs=22.6

Q ss_pred             ccCCcccccccccccchHHHHHHHhh
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAHLKHVH   60 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h~~~~~   60 (66)
                      |.|..  |++.|...+.|..|+++|+
T Consensus         6 y~C~~--CGK~Fs~~~~L~~H~r~H~   29 (55)
T PHA02768          6 YECPI--CGEIYIKRKSMITHLRKHN   29 (55)
T ss_pred             cCcch--hCCeeccHHHHHHHHHhcC
Confidence            78977  9999999999999999988


No 20 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.19  E-value=6.4e-07  Score=46.12  Aligned_cols=54  Identities=31%  Similarity=0.667  Sum_probs=44.6

Q ss_pred             CCcccCCccccCccccChHHHHHHHHH-h------------------cCCCCCccCCcccccccccccchHHHHHH
Q psy1778           1 MRMFPCPLVTCGKSFLRSEHLQEHMLQ-H------------------NENKPKFTCPYQDCLMSYVAKSSLYAHLK   57 (66)
Q Consensus         1 ~~~~~c~~~~c~~~~~~~~~l~~~~~~-~------------------~~~~~~~~c~~~~c~~~f~~~~~l~~h~~   57 (66)
                      +|||+|+++.|++.+.....|.-|+.- |                  ...+| |.|.+  |++++.....|.-|..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KP-YrCev--C~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKP-YRCEV--CDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCc-eeccc--cchhhccCccceeccc
Confidence            489999999999999999888888652 1                  12478 99999  9999999999987743


No 21 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.08  E-value=2.9e-06  Score=27.44  Aligned_cols=23  Identities=35%  Similarity=0.788  Sum_probs=19.9

Q ss_pred             ccCCcccccccccccchHHHHHHHh
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAHLKHV   59 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h~~~~   59 (66)
                      |.|..  |++.|.....|..|++.|
T Consensus         1 y~C~~--C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPI--CGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETT--TTEEESSHHHHHHHHHHH
T ss_pred             CCCCC--CCCccCCHHHHHHHHhHC
Confidence            46866  999999999999999864


No 22 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.06  E-value=3.5e-05  Score=30.13  Aligned_cols=51  Identities=35%  Similarity=0.681  Sum_probs=36.9

Q ss_pred             cccCCccccCccccChHHHHHHHHH-hcCC-CCCccCCcccccccccccchHHHHHHHhhC
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQ-HNEN-KPKFTCPYQDCLMSYVAKSSLYAHLKHVHS   61 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~-~~~~-~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~   61 (66)
                      .|.|+  .|++ ......|..|... |..+ +. +.|.+  |...+.  .+|..|+...++
T Consensus         2 ~f~CP--~C~~-~~~~~~L~~H~~~~H~~~~~~-v~CPi--C~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCP--YCGK-GFSESSLVEHCEDEHRSESKN-VVCPI--CSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCC--CCCC-ccCHHHHHHHHHhHCcCCCCC-ccCCC--chhhhh--hHHHHHHHHhcC
Confidence            47899  9999 4557789999664 5443 45 89977  987544  488889876653


No 23 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.95  E-value=4.7e-06  Score=27.97  Aligned_cols=22  Identities=41%  Similarity=0.813  Sum_probs=10.5

Q ss_pred             ccCCccccCccccChHHHHHHHHH
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQ   27 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~   27 (66)
                      |.|.  .|++.|.....|..|++.
T Consensus         2 ~~C~--~C~~~F~~~~~l~~H~~~   23 (27)
T PF13912_consen    2 FECD--ECGKTFSSLSALREHKRS   23 (27)
T ss_dssp             EEET--TTTEEESSHHHHHHHHCT
T ss_pred             CCCC--ccCCccCChhHHHHHhHH
Confidence            4444  455555555444444443


No 24 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.91  E-value=1.1e-05  Score=25.97  Aligned_cols=18  Identities=44%  Similarity=0.805  Sum_probs=8.7

Q ss_pred             ccCccccChHHHHHHHHH
Q psy1778          10 TCGKSFLRSEHLQEHMLQ   27 (66)
Q Consensus        10 ~c~~~~~~~~~l~~~~~~   27 (66)
                      .|+..|.....+..|+..
T Consensus         5 ~C~~~~~~~~~l~~H~~~   22 (24)
T PF13894_consen    5 ICGKSFRSKSELRQHMRT   22 (24)
T ss_dssp             STS-EESSHHHHHHHHHH
T ss_pred             CCCCcCCcHHHHHHHHHh
Confidence            455555555555555443


No 25 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.90  E-value=3.1e-05  Score=42.83  Aligned_cols=53  Identities=21%  Similarity=0.524  Sum_probs=28.6

Q ss_pred             CcccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHhhCCCC
Q psy1778           2 RMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNK   64 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~~~~   64 (66)
                      +++.|.  .|+..|. ...+..|+.++.  ++ +.|  + |+..+ ....|..|+.++.++++
T Consensus       452 ~H~~C~--~Cgk~f~-~s~LekH~~~~H--kp-v~C--p-Cg~~~-~R~~L~~H~~thCp~Kp  504 (567)
T PLN03086        452 NHVHCE--KCGQAFQ-QGEMEKHMKVFH--EP-LQC--P-CGVVL-EKEQMVQHQASTCPLRL  504 (567)
T ss_pred             cCccCC--CCCCccc-hHHHHHHHHhcC--CC-ccC--C-CCCCc-chhHHHhhhhccCCCCc
Confidence            345666  6766664 455666666542  45 556  2 55433 34555556555554444


No 26 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.88  E-value=2e-05  Score=25.33  Aligned_cols=24  Identities=42%  Similarity=0.837  Sum_probs=19.1

Q ss_pred             ccCCcccccccccccchHHHHHHHhh
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAHLKHVH   60 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h~~~~~   60 (66)
                      |.|..  |+..|.....|..|+.+++
T Consensus         1 ~~C~~--C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPI--CGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SS--TS-EESSHHHHHHHHHHHS
T ss_pred             CCCcC--CCCcCCcHHHHHHHHHhhC
Confidence            46877  9999999999999998764


No 27 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.86  E-value=2.6e-05  Score=30.07  Aligned_cols=33  Identities=27%  Similarity=0.402  Sum_probs=21.9

Q ss_pred             CCCCCccCCcccccccccccchHHHHHHHhhCCCCC
Q psy1778          30 ENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTNKI   65 (66)
Q Consensus        30 ~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~~~~~   65 (66)
                      +..| -.|..  |+..+.+..+|..|+..+++.||-
T Consensus        21 S~~P-atCP~--C~a~~~~srnLrRHle~~H~~k~~   53 (54)
T PF09237_consen   21 SEQP-ATCPI--CGAVIRQSRNLRRHLEIRHFKKPG   53 (54)
T ss_dssp             TS---EE-TT--T--EESSHHHHHHHHHHHTTTS--
T ss_pred             cCCC-CCCCc--chhhccchhhHHHHHHHHhcccCC
Confidence            4567 78966  999999999999999888887763


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.86  E-value=5.5e-06  Score=27.81  Aligned_cols=25  Identities=28%  Similarity=0.482  Sum_probs=21.8

Q ss_pred             ccCCcccccccccccchHHHHHHHhhC
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAHLKHVHS   61 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h~~~~~~   61 (66)
                      +.|..  |+..|.....|..|++.|.+
T Consensus         2 ~~C~~--C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    2 FECDE--CGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             EEETT--TTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCc--cCCccCChhHHHHHhHHhcC
Confidence            78977  99999999999999987653


No 29 
>PHA00733 hypothetical protein
Probab=97.78  E-value=1.1e-05  Score=36.87  Aligned_cols=53  Identities=23%  Similarity=0.504  Sum_probs=37.3

Q ss_pred             CcccCCccccCccccChHHHHHH--H---HHhcCCCCCccCCcccccccccccchHHHHHHHh
Q psy1778           2 RMFPCPLVTCGKSFLRSEHLQEH--M---LQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHV   59 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~~l~~~--~---~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~   59 (66)
                      +++.|.  .|...|.....+..+  +   ..+.+.+| +.|..  |+..|.....|..|++.+
T Consensus        39 ~~~~~~--~~~~~~~~~~~l~~~~~l~~~~~~~~~kP-y~C~~--Cgk~Fss~s~L~~H~r~h   96 (128)
T PHA00733         39 KRLIRA--VVKTLIYNPQLLDESSYLYKLLTSKAVSP-YVCPL--CLMPFSSSVSLKQHIRYT   96 (128)
T ss_pred             hhHHHH--HHhhhccChhhhcchHHHHhhcccCCCCC-ccCCC--CCCcCCCHHHHHHHHhcC
Confidence            456666  677666665555444  1   12234678 99977  999999999999998854


No 30 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.70  E-value=9.9e-05  Score=23.91  Aligned_cols=22  Identities=50%  Similarity=0.996  Sum_probs=13.0

Q ss_pred             cCCccccCccccChHHHHHHHHHh
Q psy1778           5 PCPLVTCGKSFLRSEHLQEHMLQH   28 (66)
Q Consensus         5 ~c~~~~c~~~~~~~~~l~~~~~~~   28 (66)
                      .|.  .|++.|.....+..|+..|
T Consensus         2 ~C~--~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        2 RCP--ECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCC--CCcchhCCHHHHHHHHHHh
Confidence            455  5666666666666665544


No 31 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.66  E-value=6.7e-05  Score=28.96  Aligned_cols=30  Identities=30%  Similarity=0.619  Sum_probs=21.6

Q ss_pred             CcccCCccccCccccChHHHHHHHHHhcCCCC
Q psy1778           2 RMFPCPLVTCGKSFLRSEHLQEHMLQHNENKP   33 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~   33 (66)
                      .|..|+  .|+..+.+..+|.+|+.+..+.+|
T Consensus        23 ~PatCP--~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   23 QPATCP--ICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             --EE-T--TT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCCC--cchhhccchhhHHHHHHHHhcccC
Confidence            577899  999999999999999988777665


No 32 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.51  E-value=0.00028  Score=39.33  Aligned_cols=55  Identities=18%  Similarity=0.384  Sum_probs=39.4

Q ss_pred             CcccCCccccCccccChHHHHHHHHHhcCCCCCccCCccccccccc----------ccchHHHHHHHhhCCCC
Q psy1778           2 RMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYV----------AKSSLYAHLKHVHSTNK   64 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~----------~~~~l~~h~~~~~~~~~   64 (66)
                      +|+.|+   |+..+ .+..|..|+..+...++ +.|..  |+..+.          ....|..|+.+ .|.++
T Consensus       477 kpv~Cp---Cg~~~-~R~~L~~H~~thCp~Kp-i~C~f--C~~~v~~g~~~~d~~d~~s~Lt~HE~~-CG~rt  541 (567)
T PLN03086        477 EPLQCP---CGVVL-EKEQMVQHQASTCPLRL-ITCRF--CGDMVQAGGSAMDVRDRLRGMSEHESI-CGSRT  541 (567)
T ss_pred             CCccCC---CCCCc-chhHHHhhhhccCCCCc-eeCCC--CCCccccCccccchhhhhhhHHHHHHh-cCCcc
Confidence            456775   88654 66888889888888888 89987  988774          13467788775 35444


No 33 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.04  E-value=0.00078  Score=21.77  Aligned_cols=16  Identities=25%  Similarity=0.449  Sum_probs=6.7

Q ss_pred             ccCccccChHHHHHHHH
Q psy1778          10 TCGKSFLRSEHLQEHML   26 (66)
Q Consensus        10 ~c~~~~~~~~~l~~~~~   26 (66)
                      .|+.... ...|..|++
T Consensus         5 ~C~y~t~-~~~l~~H~~   20 (24)
T PF13909_consen    5 HCSYSTS-KSNLKRHLK   20 (24)
T ss_dssp             SSS-EES-HHHHHHHHH
T ss_pred             CCCCcCC-HHHHHHHHH
Confidence            4444443 444444444


No 34 
>PRK04860 hypothetical protein; Provisional
Probab=97.01  E-value=0.00062  Score=32.36  Aligned_cols=38  Identities=18%  Similarity=0.411  Sum_probs=29.8

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcCCCCCccCCccccccccccc
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAK   49 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~   49 (66)
                      +|.|.   |+.   ....+..|.+++.+.++ |.|..  |...|...
T Consensus       119 ~Y~C~---C~~---~~~~~rrH~ri~~g~~~-YrC~~--C~~~l~~~  156 (160)
T PRK04860        119 PYRCK---CQE---HQLTVRRHNRVVRGEAV-YRCRR--CGETLVFK  156 (160)
T ss_pred             EEEcC---CCC---eeCHHHHHHHHhcCCcc-EECCC--CCceeEEe
Confidence            46774   765   55678899999999999 99977  98877654


No 35 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.76  E-value=0.00099  Score=21.65  Aligned_cols=16  Identities=38%  Similarity=0.698  Sum_probs=8.3

Q ss_pred             ccccccccchHHHHHH
Q psy1778          42 CLMSYVAKSSLYAHLK   57 (66)
Q Consensus        42 c~~~f~~~~~l~~h~~   57 (66)
                      |...|.+...+..|++
T Consensus         6 C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    6 CNKSFSSENSLRQHLR   21 (25)
T ss_dssp             TTEEESSHHHHHHHHT
T ss_pred             CCCCcCCHHHHHHHHC
Confidence            5555555555555543


No 36 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.45  E-value=0.0029  Score=27.16  Aligned_cols=49  Identities=31%  Similarity=0.748  Sum_probs=19.7

Q ss_pred             CCccccCccccChHHHHHHHHH-hcC----------------------CCCCccCCcccccccccccchHHHHHHHh
Q psy1778           6 CPLVTCGKSFLRSEHLQEHMLQ-HNE----------------------NKPKFTCPYQDCLMSYVAKSSLYAHLKHV   59 (66)
Q Consensus         6 c~~~~c~~~~~~~~~l~~~~~~-~~~----------------------~~~~~~c~~~~c~~~f~~~~~l~~h~~~~   59 (66)
                      |.  .|+..|.....+..|+.. |.-                      ... +.|..  |...|.+...|..|++.+
T Consensus         2 C~--~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~-~~C~~--C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    2 CL--FCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKES-FRCPY--CNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -------------------------------------------------SS-EEBSS--SS-EESSHHHHHHHHHHT
T ss_pred             cc--ccccccccccccccccccccccccccccccccccccccccccccCCC-CCCCc--cCCCCcCHHHHHHHHcCc
Confidence            55  788888888787777642 210                      012 57877  999999999999999864


No 37 
>PHA00732 hypothetical protein
Probab=96.40  E-value=0.0027  Score=26.81  Aligned_cols=22  Identities=32%  Similarity=0.664  Sum_probs=19.9

Q ss_pred             ccCCcccccccccccchHHHHHHH
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAHLKH   58 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h~~~   58 (66)
                      +.|..  |+..|.....|..|++.
T Consensus         2 y~C~~--Cgk~F~s~s~Lk~H~r~   23 (79)
T PHA00732          2 FKCPI--CGFTTVTLFALKQHARR   23 (79)
T ss_pred             ccCCC--CCCccCCHHHHHHHhhc
Confidence            78977  99999999999999974


No 38 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.98  E-value=0.0017  Score=21.65  Aligned_cols=20  Identities=40%  Similarity=0.878  Sum_probs=10.4

Q ss_pred             ccCCccccCccccChHHHHHHH
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHM   25 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~   25 (66)
                      |.|.  .|++.|.....+..|+
T Consensus         2 ~~C~--~C~k~f~~~~~~~~H~   21 (27)
T PF12171_consen    2 FYCD--ACDKYFSSENQLKQHM   21 (27)
T ss_dssp             CBBT--TTTBBBSSHHHHHCCT
T ss_pred             CCcc--cCCCCcCCHHHHHHHH
Confidence            3455  5555555555555443


No 39 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.91  E-value=0.011  Score=19.50  Aligned_cols=19  Identities=32%  Similarity=0.628  Sum_probs=9.4

Q ss_pred             cCCcccccccccccchHHHHHH
Q psy1778          36 TCPYQDCLMSYVAKSSLYAHLK   57 (66)
Q Consensus        36 ~c~~~~c~~~f~~~~~l~~h~~   57 (66)
                      .|..  |++.| ....|..|+.
T Consensus         4 ~C~~--CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPI--CGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCC--CCCEE-CHHHHHHHHH
Confidence            4544  55555 4444555543


No 40 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.12  E-value=0.003  Score=33.32  Aligned_cols=58  Identities=31%  Similarity=0.560  Sum_probs=47.3

Q ss_pred             cccCCccccCccccChHHHHHHHH--HhcCC--CCCccCCcccccccccccchHHHHHHHhhCCC
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHML--QHNEN--KPKFTCPYQDCLMSYVAKSSLYAHLKHVHSTN   63 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~--~~~~~--~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~~~   63 (66)
                      ++.|.  .|...|.....+..|..  .|.++  ++ +.|....|+..|.....+..|..+|.+..
T Consensus       289 ~~~~~--~~~~~~s~~~~l~~~~~~~~h~~~~~~~-~~~p~~~~~~~~~~~~~~~~~~~~~~~~~  350 (467)
T COG5048         289 PIKSK--QCNISFSRSSPLTRHLRSVNHSGESLKP-FSCPYSLCGKLFSRNDALKRHILLHTSIS  350 (467)
T ss_pred             CCCCc--cccCCccccccccccccccccccccCCc-eeeeccCCCccccccccccCCcccccCCC
Confidence            45666  88999999999999999  79988  89 89972249999999999988887776544


No 41 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.88  E-value=0.032  Score=19.41  Aligned_cols=22  Identities=23%  Similarity=0.525  Sum_probs=12.2

Q ss_pred             cccCCccccCccccChHHHHHHHH
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHML   26 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~   26 (66)
                      +|.|.  .|+..|.....+..|+.
T Consensus         3 ~~~C~--~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCK--LCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEcc--ccCCccCCHHHHHHHHC
Confidence            34555  66666665555555543


No 42 
>KOG3993|consensus
Probab=94.67  E-value=0.0031  Score=34.26  Aligned_cols=51  Identities=16%  Similarity=0.408  Sum_probs=36.9

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHh
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHV   59 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~   59 (66)
                      |.|.  .|...|.....|.+|.-.--...- |.|  ++|++.|+=..+|..|.|=|
T Consensus       268 yiCq--LCK~kYeD~F~LAQHrC~RIV~vE-YrC--PEC~KVFsCPANLASHRRWH  318 (500)
T KOG3993|consen  268 YICQ--LCKEKYEDAFALAQHRCPRIVHVE-YRC--PECDKVFSCPANLASHRRWH  318 (500)
T ss_pred             HHHH--HHHHhhhhHHHHhhccCCeeEEee-ecC--CcccccccCchhhhhhhccc
Confidence            5677  777777777778877542211223 899  45999999999999997744


No 43 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.27  E-value=0.074  Score=22.72  Aligned_cols=26  Identities=46%  Similarity=0.852  Sum_probs=21.5

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcC
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNE   30 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~   30 (66)
                      .+.|.  .|+..|.....+..|+..+..
T Consensus        50 ~~~C~--~C~~~f~s~~~l~~Hm~~~~H   75 (100)
T PF12756_consen   50 SFRCP--YCNKTFRSREALQEHMRSKHH   75 (100)
T ss_dssp             SEEBS--SSS-EESSHHHHHHHHHHTTT
T ss_pred             CCCCC--ccCCCCcCHHHHHHHHcCccC
Confidence            47788  999999999999999997643


No 44 
>KOG2893|consensus
Probab=94.21  E-value=0.018  Score=29.37  Aligned_cols=39  Identities=23%  Similarity=0.463  Sum_probs=28.9

Q ss_pred             ccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHH
Q psy1778          10 TCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAH   55 (66)
Q Consensus        10 ~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h   55 (66)
                      .|++.|.....|.+|+++.    . |+|.+  |.+..-+-..|..|
T Consensus        15 ycnrefddekiliqhqkak----h-fkchi--chkkl~sgpglsih   53 (341)
T KOG2893|consen   15 YCNREFDDEKILIQHQKAK----H-FKCHI--CHKKLFSGPGLSIH   53 (341)
T ss_pred             ecccccchhhhhhhhhhhc----c-ceeee--ehhhhccCCCceee
Confidence            7999999999999998854    3 89977  87655444444444


No 45 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.45  E-value=0.14  Score=27.20  Aligned_cols=57  Identities=39%  Similarity=0.711  Sum_probs=46.6

Q ss_pred             CcccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHHHhhC
Q psy1778           2 RMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHS   61 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~   61 (66)
                      +++.|.  .|...|....+...|...+.+.++ ..|....|...+.....+..+...+..
T Consensus        32 ~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~   88 (467)
T COG5048          32 RPDSCP--NCTDSFSRLEHLTRHIRSHTGEKP-SQCSYSGCDKSFSRPLELSRHLRTHHN   88 (467)
T ss_pred             chhhcc--cccccccccchhhhhcccccccCC-ccccccccccccCCcchhhhhcccccc
Confidence            346677  888999999999999999999999 888877788888888888888776543


No 46 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=92.15  E-value=0.082  Score=20.93  Aligned_cols=21  Identities=33%  Similarity=0.789  Sum_probs=17.0

Q ss_pred             ccCCccccCccccChHHHHHHHH
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHML   26 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~   26 (66)
                      +.|+  .|+..|.....+.+|..
T Consensus        18 lrCP--RC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          18 LRCP--RCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             eeCC--chhHHHHHhHHHHHHhh
Confidence            5677  89999988888888854


No 47 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=91.38  E-value=0.14  Score=27.41  Aligned_cols=26  Identities=31%  Similarity=0.749  Sum_probs=23.8

Q ss_pred             CCCCccCCcccccccccccchHHHHHH
Q psy1778          31 NKPKFTCPYQDCLMSYVAKSSLYAHLK   57 (66)
Q Consensus        31 ~~~~~~c~~~~c~~~f~~~~~l~~h~~   57 (66)
                      ++| |.|.+++|.+.+.....|.-|+.
T Consensus       347 ~Kp-ykCpV~gC~K~YknqnGLKYH~l  372 (423)
T COG5189         347 GKP-YKCPVEGCNKKYKNQNGLKYHML  372 (423)
T ss_pred             Cce-ecCCCCCchhhhccccchhhhhh
Confidence            489 99999999999999999999975


No 48 
>KOG1146|consensus
Probab=90.41  E-value=0.31  Score=30.65  Aligned_cols=52  Identities=27%  Similarity=0.600  Sum_probs=41.4

Q ss_pred             CcccCCccccCccccChHHHHHHHHHhc-------------------------CCCCCccCCcccccccccccchHHHHH
Q psy1778           2 RMFPCPLVTCGKSFLRSEHLQEHMLQHN-------------------------ENKPKFTCPYQDCLMSYVAKSSLYAHL   56 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~~l~~~~~~~~-------------------------~~~~~~~c~~~~c~~~f~~~~~l~~h~   56 (66)
                      |.+.|.  .|+..+.....|..|++...                         +.++ +.|..  |...+.....|..|+
T Consensus       464 kt~~cp--kc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p-~~C~~--C~~stttng~Lsihl  538 (1406)
T KOG1146|consen  464 KTLKCP--KCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP-YPCRA--CNYSTTTNGNLSIHL  538 (1406)
T ss_pred             ccccCC--ccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc-cccee--eeeeeecchHHHHHH
Confidence            467888  99999999999999998611                         1245 67866  999999999999997


Q ss_pred             HH
Q psy1778          57 KH   58 (66)
Q Consensus        57 ~~   58 (66)
                      ..
T Consensus       539 qS  540 (1406)
T KOG1146|consen  539 QS  540 (1406)
T ss_pred             HH
Confidence            73


No 49 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=84.26  E-value=1.1  Score=19.98  Aligned_cols=25  Identities=24%  Similarity=0.569  Sum_probs=20.0

Q ss_pred             ccC----CcccccccccccchHHHHHHHhhC
Q psy1778          35 FTC----PYQDCLMSYVAKSSLYAHLKHVHS   61 (66)
Q Consensus        35 ~~c----~~~~c~~~f~~~~~l~~h~~~~~~   61 (66)
                      +.|    ..  |.....+...+..|.+..+|
T Consensus        81 ~~C~~~~~~--C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPH--CGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCC--CCcEeccHHHHHHHHHHhcC
Confidence            567    55  99888899999999887664


No 50 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=82.24  E-value=1.2  Score=15.42  Aligned_cols=24  Identities=38%  Similarity=1.050  Sum_probs=15.8

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccc
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLM   44 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~   44 (66)
                      |.|.  .||..+....            .+ ..|..  |+.
T Consensus         2 ~~C~--~CGy~y~~~~------------~~-~~CP~--Cg~   25 (33)
T cd00350           2 YVCP--VCGYIYDGEE------------AP-WVCPV--CGA   25 (33)
T ss_pred             EECC--CCCCEECCCc------------CC-CcCcC--CCC
Confidence            6777  8887764332            46 78866  865


No 51 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=81.59  E-value=1.5  Score=16.60  Aligned_cols=22  Identities=27%  Similarity=0.486  Sum_probs=15.8

Q ss_pred             ccCCccccCccccChHHHHHHHHH
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQ   27 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~   27 (66)
                      |+|-  +|..+...+++|..||+-
T Consensus        21 ykcf--qcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCF--QCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceee--cCCcccchHHHHHHHHHH
Confidence            4455  777777778888888763


No 52 
>KOG4167|consensus
Probab=80.72  E-value=0.3  Score=29.02  Aligned_cols=24  Identities=42%  Similarity=0.962  Sum_probs=20.8

Q ss_pred             ccCCccccCccccChHHHHHHHHHhc
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHN   29 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~   29 (66)
                      |.|.  +|++.|.-...+..||+.|.
T Consensus       793 FpCr--eC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  793 FPCR--ECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eehH--HHHHHHHHHhhhhHHHHHHH
Confidence            6788  99999998888889988875


No 53 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=77.80  E-value=1.9  Score=21.92  Aligned_cols=24  Identities=33%  Similarity=0.866  Sum_probs=18.3

Q ss_pred             cccCCccccCccccChHHHHHHHHHh
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQH   28 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~   28 (66)
                      .|.|.  .|++.|.-......|+...
T Consensus        77 K~~C~--lc~KlFkg~eFV~KHI~nK  100 (214)
T PF04959_consen   77 KWRCP--LCGKLFKGPEFVRKHIFNK  100 (214)
T ss_dssp             EEEE---SSS-EESSHHHHHHHHHHH
T ss_pred             EECCC--CCCcccCChHHHHHHHhhc
Confidence            58888  9999999999888887643


No 54 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=76.23  E-value=2.6  Score=19.06  Aligned_cols=30  Identities=30%  Similarity=0.869  Sum_probs=20.9

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCccccccccccc
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAK   49 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~   49 (66)
                      ..|+  .||..|-.           ....| ..|..  |+..|...
T Consensus        10 R~Cp--~CG~kFYD-----------Lnk~P-ivCP~--CG~~~~~~   39 (108)
T PF09538_consen   10 RTCP--SCGAKFYD-----------LNKDP-IVCPK--CGTEFPPE   39 (108)
T ss_pred             ccCC--CCcchhcc-----------CCCCC-ccCCC--CCCccCcc
Confidence            4577  89987742           23467 88965  99888766


No 55 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=74.20  E-value=2.1  Score=20.10  Aligned_cols=23  Identities=26%  Similarity=0.486  Sum_probs=13.4

Q ss_pred             ccCCcccccccccccchHHHHHHHhhCC
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAHLKHVHST   62 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h~~~~~~~   62 (66)
                      +.|..  |++.|..   |..|+++|+|-
T Consensus        73 i~cle--cGk~~k~---LkrHL~~~~gl   95 (132)
T PF05443_consen   73 IICLE--CGKKFKT---LKRHLRTHHGL   95 (132)
T ss_dssp             EE-TB--T--EESB---HHHHHHHTT-S
T ss_pred             eEEcc--CCcccch---HHHHHHHccCC
Confidence            56766  8887754   47888888664


No 56 
>KOG1146|consensus
Probab=72.71  E-value=1.9  Score=27.61  Aligned_cols=54  Identities=17%  Similarity=0.354  Sum_probs=39.1

Q ss_pred             CcccCCccccCccccChHHHHHHHHHhc-----------------CCCCCccCCcccccccccccchHHHHHHHhhC
Q psy1778           2 RMFPCPLVTCGKSFLRSEHLQEHMLQHN-----------------ENKPKFTCPYQDCLMSYVAKSSLYAHLKHVHS   61 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~~l~~~~~~~~-----------------~~~~~~~c~~~~c~~~f~~~~~l~~h~~~~~~   61 (66)
                      .+|.|.  .|...|.....+..|.+.-.                 ...+ + |..  |...|+....|..|++....
T Consensus      1283 ~~~~~~--~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~-~-c~~--c~~~~~~~~alqihm~~~~~ 1353 (1406)
T KOG1146|consen 1283 HRYLCR--QCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTY-H-CLA--CEVLLSGREALQIHMRSSAH 1353 (1406)
T ss_pred             hhHHHH--HHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCccccc-c-chH--HHhhcchhHHHHHHHHHhhh
Confidence            467787  88888988888888874210                 1122 3 766  98999999999999986543


No 57 
>PHA00626 hypothetical protein
Probab=71.34  E-value=2.1  Score=17.05  Aligned_cols=14  Identities=21%  Similarity=0.529  Sum_probs=10.8

Q ss_pred             cccCCccccCccccCh
Q psy1778           3 MFPCPLVTCGKSFLRS   18 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~   18 (66)
                      .|.|.  .||..|+..
T Consensus        23 rYkCk--dCGY~ft~~   36 (59)
T PHA00626         23 DYVCC--DCGYNDSKD   36 (59)
T ss_pred             ceEcC--CCCCeechh
Confidence            58888  999887643


No 58 
>COG2879 Uncharacterized small protein [Function unknown]
Probab=71.11  E-value=5.9  Score=16.21  Aligned_cols=19  Identities=11%  Similarity=0.207  Sum_probs=13.3

Q ss_pred             ccchHHHHHHHhhCCCCCC
Q psy1778          48 AKSSLYAHLKHVHSTNKIT   66 (66)
Q Consensus        48 ~~~~l~~h~~~~~~~~~~~   66 (66)
                      .-+....|++.++.++|.+
T Consensus        24 dYdnYVehmr~~hPd~p~m   42 (65)
T COG2879          24 DYDNYVEHMRKKHPDKPPM   42 (65)
T ss_pred             cHHHHHHHHHHhCcCCCcc
Confidence            3456677888888777753


No 59 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=70.84  E-value=5.2  Score=15.14  Aligned_cols=21  Identities=33%  Similarity=0.607  Sum_probs=14.4

Q ss_pred             ccCCccccccccccc-----chHHHHHH
Q psy1778          35 FTCPYQDCLMSYVAK-----SSLYAHLK   57 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~-----~~l~~h~~   57 (66)
                      ..|..  |+..+...     +.|..|+.
T Consensus        19 a~C~~--C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKY--CGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecC--CCCEeeeCCCCCcHHHHHHHH
Confidence            46766  87766554     57778877


No 60 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=70.12  E-value=2.5  Score=13.79  Aligned_cols=8  Identities=75%  Similarity=2.074  Sum_probs=4.9

Q ss_pred             cccCCccccC
Q psy1778           3 MFPCPLVTCG   12 (66)
Q Consensus         3 ~~~c~~~~c~   12 (66)
                      +|.|+  .||
T Consensus        16 ~f~CP--nCG   23 (24)
T PF07754_consen   16 PFPCP--NCG   23 (24)
T ss_pred             eEeCC--CCC
Confidence            46666  665


No 61 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=69.38  E-value=3.1  Score=19.58  Aligned_cols=15  Identities=27%  Similarity=0.740  Sum_probs=11.9

Q ss_pred             cccCCccccCccccChH
Q psy1778           3 MFPCPLVTCGKSFLRSE   19 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~   19 (66)
                      |+.|.  .||+.|..-+
T Consensus         1 PH~Ct--~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCT--KCGRVFEDGS   15 (131)
T ss_pred             CcccC--cCCCCcCCCc
Confidence            68898  9999987543


No 62 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=67.97  E-value=2.4  Score=15.03  Aligned_cols=12  Identities=33%  Similarity=1.043  Sum_probs=9.1

Q ss_pred             ccCCccccCccccC
Q psy1778           4 FPCPLVTCGKSFLR   17 (66)
Q Consensus         4 ~~c~~~~c~~~~~~   17 (66)
                      |.|.  .||..|..
T Consensus         6 y~C~--~Cg~~fe~   17 (41)
T smart00834        6 YRCE--DCGHTFEV   17 (41)
T ss_pred             EEcC--CCCCEEEE
Confidence            6787  99987753


No 63 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=67.44  E-value=1.7  Score=18.18  Aligned_cols=44  Identities=16%  Similarity=0.441  Sum_probs=22.6

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchH
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSL   52 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l   52 (66)
                      +.|+  .|+........-...  ....+.- ++|...+|+.+|.....+
T Consensus         2 m~CP--~Cg~~a~irtSr~~s--~~~~~~Y-~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678          2 FHCP--LCQHAAHARTSRYIT--DTTKERY-HQCQNVNCSATFITYESV   45 (72)
T ss_pred             ccCC--CCCCccEEEEChhcC--hhhheee-eecCCCCCCCEEEEEEEE
Confidence            3577  888654322211111  1122333 678755699888765443


No 64 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=66.78  E-value=5.3  Score=19.24  Aligned_cols=31  Identities=32%  Similarity=0.577  Sum_probs=21.4

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccc
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVA   48 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~   48 (66)
                      |.|+  .|+..|+....+.         .. |.|..  |+.....
T Consensus       110 Y~Cp--~c~~r~tf~eA~~---------~~-F~Cp~--Cg~~L~~  140 (158)
T TIGR00373       110 FICP--NMCVRFTFNEAME---------LN-FTCPR--CGAMLDY  140 (158)
T ss_pred             EECC--CCCcEeeHHHHHH---------cC-CcCCC--CCCEeee
Confidence            6788  8988877665553         24 89966  9876543


No 65 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=66.65  E-value=6.2  Score=14.02  Aligned_cols=33  Identities=21%  Similarity=0.584  Sum_probs=19.7

Q ss_pred             cCCccccCccccChHHHHHHHHHhcCCCCCccCCccccccccc
Q psy1778           5 PCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYV   47 (66)
Q Consensus         5 ~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~   47 (66)
                      .|+  .|+..|.-...-     +..+... ..|..  |...|.
T Consensus         4 ~CP--~C~~~f~v~~~~-----l~~~~~~-vrC~~--C~~~f~   36 (37)
T PF13719_consen    4 TCP--NCQTRFRVPDDK-----LPAGGRK-VRCPK--CGHVFR   36 (37)
T ss_pred             ECC--CCCceEEcCHHH-----cccCCcE-EECCC--CCcEee
Confidence            467  888887655431     2223334 78866  877663


No 66 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=66.59  E-value=5.7  Score=14.88  Aligned_cols=26  Identities=19%  Similarity=0.505  Sum_probs=17.2

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCccccccc
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMS   45 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~   45 (66)
                      |.|.  .||..|...           ...+ ..|..  |+..
T Consensus         3 Y~C~--~Cg~~~~~~-----------~~~~-irC~~--CG~r   28 (44)
T smart00659        3 YICG--ECGRENEIK-----------SKDV-VRCRE--CGYR   28 (44)
T ss_pred             EECC--CCCCEeecC-----------CCCc-eECCC--CCce
Confidence            7788  999877533           2345 78854  8754


No 67 
>KOG2071|consensus
Probab=66.39  E-value=6.1  Score=23.26  Aligned_cols=26  Identities=35%  Similarity=0.552  Sum_probs=20.2

Q ss_pred             CcccCCccccCccccChHHHHHHHHHhc
Q psy1778           2 RMFPCPLVTCGKSFLRSEHLQEHMLQHN   29 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~~l~~~~~~~~   29 (66)
                      +|-.|.  .||.+|........||..|.
T Consensus       417 ~pnqC~--~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  417 SPNQCK--SCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             Ccchhc--ccccccccchhhhhHhhhhh
Confidence            456788  89999988888777777664


No 68 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=65.19  E-value=2.9  Score=16.17  Aligned_cols=16  Identities=25%  Similarity=0.835  Sum_probs=11.3

Q ss_pred             CcccCCccccCccccChH
Q psy1778           2 RMFPCPLVTCGKSFLRSE   19 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~   19 (66)
                      +++.|.  +||..|.-..
T Consensus         3 k~l~C~--dCg~~FvfTa   18 (49)
T PF13451_consen    3 KTLTCK--DCGAEFVFTA   18 (49)
T ss_pred             eeEEcc--cCCCeEEEeh
Confidence            567888  9998665443


No 69 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=63.96  E-value=2.9  Score=15.34  Aligned_cols=29  Identities=28%  Similarity=0.770  Sum_probs=17.1

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccc
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLM   44 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~   44 (66)
                      |.|.  .||..|.....      +.. ..+ ..|..  |+.
T Consensus         6 y~C~--~Cg~~fe~~~~------~~~-~~~-~~CP~--Cg~   34 (42)
T PF09723_consen    6 YRCE--ECGHEFEVLQS------ISE-DDP-VPCPE--CGS   34 (42)
T ss_pred             EEeC--CCCCEEEEEEE------cCC-CCC-CcCCC--CCC
Confidence            6788  99987754322      111 334 67754  875


No 70 
>KOG2932|consensus
Probab=63.10  E-value=7.6  Score=21.22  Aligned_cols=27  Identities=37%  Similarity=0.844  Sum_probs=21.3

Q ss_pred             ccCCcc-cccccccccchHHHHHHHhhC
Q psy1778          35 FTCPYQ-DCLMSYVAKSSLYAHLKHVHS   61 (66)
Q Consensus        35 ~~c~~~-~c~~~f~~~~~l~~h~~~~~~   61 (66)
                      |.|..+ +|.++|.+...|..|+...++
T Consensus       145 FmC~~~~GC~RTyLsqrDlqAHInhrH~  172 (389)
T KOG2932|consen  145 FMCAAPHGCLRTYLSQRDLQAHINHRHG  172 (389)
T ss_pred             EEeecchhHHHHHhhHHHHHHHhhhhhc
Confidence            777654 599999999999999875443


No 71 
>KOG3408|consensus
Probab=62.56  E-value=4  Score=18.99  Aligned_cols=22  Identities=27%  Similarity=0.608  Sum_probs=18.8

Q ss_pred             ccCCcccccccccccchHHHHHHH
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAHLKH   58 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h~~~   58 (66)
                      +.|..  |.+-|.....|..|.++
T Consensus        58 fyCi~--CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   58 FYCIE--CARYFIDAKALKTHFKT   79 (129)
T ss_pred             eehhh--hhhhhcchHHHHHHHhc
Confidence            67877  99999999999988764


No 72 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=62.46  E-value=5.5  Score=13.13  Aligned_cols=6  Identities=50%  Similarity=1.287  Sum_probs=3.5

Q ss_pred             ccCccc
Q psy1778          10 TCGKSF   15 (66)
Q Consensus        10 ~c~~~~   15 (66)
                      .||..|
T Consensus        19 ~CG~~F   24 (26)
T PF10571_consen   19 HCGYDF   24 (26)
T ss_pred             CCCCCC
Confidence            566555


No 73 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=61.09  E-value=6.9  Score=19.30  Aligned_cols=32  Identities=31%  Similarity=0.675  Sum_probs=21.7

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccc
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVA   48 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~   48 (66)
                      -|.|+  .|+..|+....+.         .. |.|..  |+.....
T Consensus       117 ~Y~Cp--~C~~rytf~eA~~---------~~-F~Cp~--Cg~~L~~  148 (178)
T PRK06266        117 FFFCP--NCHIRFTFDEAME---------YG-FRCPQ--CGEMLEE  148 (178)
T ss_pred             EEECC--CCCcEEeHHHHhh---------cC-CcCCC--CCCCCee
Confidence            37788  8998887665432         24 89966  9876543


No 74 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=60.78  E-value=4.7  Score=14.61  Aligned_cols=13  Identities=38%  Similarity=0.884  Sum_probs=8.3

Q ss_pred             cccCCccccCccccC
Q psy1778           3 MFPCPLVTCGKSFLR   17 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~   17 (66)
                      |+.|.  .|++.|-.
T Consensus        12 ~f~C~--~C~~~FC~   24 (39)
T smart00154       12 GFKCR--HCGNLFCG   24 (39)
T ss_pred             CeECC--ccCCcccc
Confidence            56676  67776653


No 75 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=60.17  E-value=8.3  Score=18.96  Aligned_cols=23  Identities=35%  Similarity=0.976  Sum_probs=15.3

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccc
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLM   44 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~   44 (66)
                      |.|.  .||..+             .+.-| -.|.+  |+.
T Consensus       135 ~vC~--vCGy~~-------------~ge~P-~~CPi--Cga  157 (166)
T COG1592         135 WVCP--VCGYTH-------------EGEAP-EVCPI--CGA  157 (166)
T ss_pred             EEcC--CCCCcc-------------cCCCC-CcCCC--CCC
Confidence            7787  887653             34557 78866  863


No 76 
>KOG4173|consensus
Probab=59.93  E-value=3.1  Score=21.23  Aligned_cols=50  Identities=20%  Similarity=0.511  Sum_probs=30.2

Q ss_pred             cCCccccCccccChHHHHHHHH-Hh---------cCCCCCccCCcccccccccccchHHHHHH
Q psy1778           5 PCPLVTCGKSFLRSEHLQEHML-QH---------NENKPKFTCPYQDCLMSYVAKSSLYAHLK   57 (66)
Q Consensus         5 ~c~~~~c~~~~~~~~~l~~~~~-~~---------~~~~~~~~c~~~~c~~~f~~~~~l~~h~~   57 (66)
                      .|.  .|.+.|.+..-|..|+. .|         .|..- |+|.+.+|.-.|.....-..|+-
T Consensus       108 sCs--~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dM-y~ClvEgCt~KFkT~r~RkdH~I  167 (253)
T KOG4173|consen  108 SCS--FCKRAFPTGHLLDAHILEWHDSLFQALVERGQDM-YQCLVEGCTEKFKTSRDRKDHMI  167 (253)
T ss_pred             hhH--HHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccH-HHHHHHhhhhhhhhhhhhhhHHH
Confidence            455  77777777666665543 11         22222 67766677777777766666654


No 77 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=59.50  E-value=4.1  Score=15.43  Aligned_cols=12  Identities=33%  Similarity=1.029  Sum_probs=9.3

Q ss_pred             ccCCccccCccccC
Q psy1778           4 FPCPLVTCGKSFLR   17 (66)
Q Consensus         4 ~~c~~~~c~~~~~~   17 (66)
                      |.|.  .|+..|..
T Consensus         6 y~C~--~Cg~~fe~   17 (52)
T TIGR02605         6 YRCT--ACGHRFEV   17 (52)
T ss_pred             EEeC--CCCCEeEE
Confidence            6788  99987763


No 78 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=58.02  E-value=5.5  Score=17.58  Aligned_cols=14  Identities=36%  Similarity=0.705  Sum_probs=11.4

Q ss_pred             CcccCCccccCccccC
Q psy1778           2 RMFPCPLVTCGKSFLR   17 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~   17 (66)
                      +|-.|.  .||..|..
T Consensus        57 ~Pa~Ck--kCGfef~~   70 (97)
T COG3357          57 RPARCK--KCGFEFRD   70 (97)
T ss_pred             cChhhc--ccCccccc
Confidence            577888  99998865


No 79 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=57.12  E-value=9.8  Score=13.30  Aligned_cols=34  Identities=21%  Similarity=0.468  Sum_probs=19.3

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCccccccccc
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYV   47 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~   47 (66)
                      ..|+  .|+..|.-.....     ...... +.|..  |+..|.
T Consensus         3 ~~CP--~C~~~~~v~~~~~-----~~~~~~-v~C~~--C~~~~~   36 (38)
T TIGR02098         3 IQCP--NCKTSFRVVDSQL-----GANGGK-VRCGK--CGHVWY   36 (38)
T ss_pred             EECC--CCCCEEEeCHHHc-----CCCCCE-EECCC--CCCEEE
Confidence            4577  8888776543321     112223 67866  887664


No 80 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=54.24  E-value=15  Score=17.31  Aligned_cols=30  Identities=23%  Similarity=0.518  Sum_probs=20.0

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCccccccccccc
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAK   49 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~   49 (66)
                      ..|+  .||+.|-.           ....| ..|..  |+..|...
T Consensus        10 r~Cp--~cg~kFYD-----------Lnk~p-~vcP~--cg~~~~~~   39 (129)
T TIGR02300        10 RICP--NTGSKFYD-----------LNRRP-AVSPY--TGEQFPPE   39 (129)
T ss_pred             ccCC--CcCccccc-----------cCCCC-ccCCC--cCCccCcc
Confidence            4577  88887742           23457 88865  98877554


No 81 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=54.24  E-value=10  Score=12.39  Aligned_cols=18  Identities=28%  Similarity=0.772  Sum_probs=8.6

Q ss_pred             cCCcccccccccccchHHHHH
Q psy1778          36 TCPYQDCLMSYVAKSSLYAHL   56 (66)
Q Consensus        36 ~c~~~~c~~~f~~~~~l~~h~   56 (66)
                      .|.+  |...+ ....+..|+
T Consensus         3 ~CPi--C~~~v-~~~~in~HL   20 (26)
T smart00734        3 QCPV--CFREV-PENLINSHL   20 (26)
T ss_pred             cCCC--CcCcc-cHHHHHHHH
Confidence            4544  65554 334444444


No 82 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=54.12  E-value=4.4  Score=14.90  Aligned_cols=13  Identities=54%  Similarity=1.060  Sum_probs=6.3

Q ss_pred             cccCCccccCccccC
Q psy1778           3 MFPCPLVTCGKSFLR   17 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~   17 (66)
                      |+.|.  .|+..|-.
T Consensus        13 ~~~C~--~C~~~FC~   25 (43)
T PF01428_consen   13 PFKCK--HCGKSFCL   25 (43)
T ss_dssp             HEE-T--TTS-EE-T
T ss_pred             CeECC--CCCcccCc
Confidence            45666  77776653


No 83 
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=52.90  E-value=15  Score=21.26  Aligned_cols=25  Identities=36%  Similarity=0.741  Sum_probs=20.5

Q ss_pred             ccCCccccCccccChHHHHHHHH-HhcC
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHML-QHNE   30 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~-~~~~   30 (66)
                      |.|+  .|.+.|.....+..|+. -|.+
T Consensus        58 WiCp--~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   58 WICP--RCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             eeCC--cccceeCCHHHHHHHHHHhhhh
Confidence            6788  89999999999999976 3443


No 84 
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=51.89  E-value=14  Score=13.32  Aligned_cols=19  Identities=26%  Similarity=0.711  Sum_probs=12.7

Q ss_pred             ccCCccccCccccChHHHHHH
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEH   24 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~   24 (66)
                      ..|.  .|+..|.....+...
T Consensus        20 d~C~--~C~G~W~d~~el~~~   38 (41)
T PF13453_consen   20 DVCP--SCGGIWFDAGELEKL   38 (41)
T ss_pred             EECC--CCCeEEccHHHHHHH
Confidence            3466  788887777766543


No 85 
>KOG2186|consensus
Probab=50.92  E-value=7.4  Score=20.55  Aligned_cols=46  Identities=30%  Similarity=0.652  Sum_probs=29.4

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccccchHHHHHH
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVAKSSLYAHLK   57 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~~~~l~~h~~   57 (66)
                      |.|.  .||....- ..+..|+..-.+ .. |.|.  +|+.+|.. ..+..|..
T Consensus         4 FtCn--vCgEsvKK-p~vekH~srCrn-~~-fSCI--DC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCN--VCGESVKK-PQVEKHMSRCRN-AY-FSCI--DCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehh--hhhhhccc-cchHHHHHhccC-Ce-eEEe--eccccccc-chhhhhhh
Confidence            4566  88876543 345567765554 44 8884  49999988 44555654


No 86 
>PLN02294 cytochrome c oxidase subunit Vb
Probab=50.02  E-value=8.9  Score=18.99  Aligned_cols=14  Identities=36%  Similarity=0.925  Sum_probs=9.7

Q ss_pred             CcccCCccccCccccC
Q psy1778           2 RMFPCPLVTCGKSFLR   17 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~   17 (66)
                      +|..|.  +||..|..
T Consensus       140 kp~RCp--eCG~~fkL  153 (174)
T PLN02294        140 KSFECP--VCTQYFEL  153 (174)
T ss_pred             CceeCC--CCCCEEEE
Confidence            567777  78877653


No 87 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=48.73  E-value=16  Score=12.95  Aligned_cols=32  Identities=16%  Similarity=0.529  Sum_probs=18.3

Q ss_pred             cCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccc
Q psy1778           5 PCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSY   46 (66)
Q Consensus         5 ~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f   46 (66)
                      .|+  .|+..|.-....     +-..... ..|..  |+..|
T Consensus         4 ~Cp--~C~~~y~i~d~~-----ip~~g~~-v~C~~--C~~~f   35 (36)
T PF13717_consen    4 TCP--NCQAKYEIDDEK-----IPPKGRK-VRCSK--CGHVF   35 (36)
T ss_pred             ECC--CCCCEEeCCHHH-----CCCCCcE-EECCC--CCCEe
Confidence            466  888777655432     2222333 67865  87665


No 88 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=47.81  E-value=11  Score=18.03  Aligned_cols=24  Identities=33%  Similarity=0.553  Sum_probs=17.6

Q ss_pred             cCCccccCccccChHHHHHHHHHhcCCCC
Q psy1778           5 PCPLVTCGKSFLRSEHLQEHMLQHNENKP   33 (66)
Q Consensus         5 ~c~~~~c~~~~~~~~~l~~~~~~~~~~~~   33 (66)
                      .|-  ++|+.|.   .|.+|+.+|-+-.|
T Consensus        78 icL--EDGkkfK---SLKRHL~t~~gmTP  101 (148)
T COG4957          78 ICL--EDGKKFK---SLKRHLTTHYGLTP  101 (148)
T ss_pred             EEe--ccCcchH---HHHHHHhcccCCCH
Confidence            466  8888886   48889888766544


No 89 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=47.63  E-value=9  Score=19.43  Aligned_cols=23  Identities=26%  Similarity=0.642  Sum_probs=16.6

Q ss_pred             CCcccCCccccCccccChHHHHHHH
Q psy1778           1 MRMFPCPLVTCGKSFLRSEHLQEHM   25 (66)
Q Consensus         1 ~~~~~c~~~~c~~~~~~~~~l~~~~   25 (66)
                      ++...|+  .|+..|..........
T Consensus         3 ~k~~~CP--vC~~~F~~~~vrs~~~   25 (214)
T PF09986_consen    3 DKKITCP--VCGKEFKTKKVRSGKI   25 (214)
T ss_pred             CCceECC--CCCCeeeeeEEEcCCc
Confidence            3567898  9999998875554443


No 90 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=47.00  E-value=30  Score=16.40  Aligned_cols=36  Identities=28%  Similarity=0.565  Sum_probs=20.7

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcCCCCCccCCccccccccc
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYV   47 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~   47 (66)
                      -|.|+  .|+..|.....+..   .. .... |.|..  |+....
T Consensus        99 ~Y~Cp--~C~~~y~~~ea~~~---~d-~~~~-f~Cp~--Cg~~l~  134 (147)
T smart00531       99 YYKCP--NCQSKYTFLEANQL---LD-MDGT-FTCPR--CGEELE  134 (147)
T ss_pred             EEECc--CCCCEeeHHHHHHh---cC-CCCc-EECCC--CCCEEE
Confidence            36788  89988775433221   01 1233 88865  887554


No 91 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=47.00  E-value=10  Score=17.16  Aligned_cols=14  Identities=29%  Similarity=0.717  Sum_probs=11.5

Q ss_pred             cccCCccccCccccCh
Q psy1778           3 MFPCPLVTCGKSFLRS   18 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~   18 (66)
                      |+.|.  .||..|..-
T Consensus         2 pH~Ct--rCG~vf~~g   15 (112)
T COG3364           2 PHQCT--RCGEVFDDG   15 (112)
T ss_pred             Cceec--ccccccccc
Confidence            67888  999998763


No 92 
>KOG2231|consensus
Probab=46.71  E-value=23  Score=21.56  Aligned_cols=17  Identities=29%  Similarity=0.637  Sum_probs=11.2

Q ss_pred             ccCccccChHHHHHHHH
Q psy1778          10 TCGKSFLRSEHLQEHML   26 (66)
Q Consensus        10 ~c~~~~~~~~~l~~~~~   26 (66)
                      .|...|.....+..|++
T Consensus       187 ~C~~~fld~~el~rH~~  203 (669)
T KOG2231|consen  187 FCHERFLDDDELYRHLR  203 (669)
T ss_pred             hhhhhhccHHHHHHhhc
Confidence            66666666666666665


No 93 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=46.00  E-value=11  Score=13.99  Aligned_cols=31  Identities=26%  Similarity=0.694  Sum_probs=19.2

Q ss_pred             CcccCCccccCccccChHHHHHHHHHhcCCCCCccCCccccccccc
Q psy1778           2 RMFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYV   47 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~   47 (66)
                      ..|.|+  .||..+.-..          .... +.|..  |+..+.
T Consensus         2 ~~y~C~--~CG~~~~~~~----------~~~~-~~Cp~--CG~~~~   32 (46)
T PRK00398          2 AEYKCA--RCGREVELDE----------YGTG-VRCPY--CGYRIL   32 (46)
T ss_pred             CEEECC--CCCCEEEECC----------CCCc-eECCC--CCCeEE
Confidence            357888  9998764321          1115 78866  886544


No 94 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=45.83  E-value=4.5  Score=13.74  Aligned_cols=6  Identities=50%  Similarity=1.254  Sum_probs=3.0

Q ss_pred             ccCccc
Q psy1778          10 TCGKSF   15 (66)
Q Consensus        10 ~c~~~~   15 (66)
                      +|++.|
T Consensus         5 DC~~~F   10 (28)
T PF08790_consen    5 DCSKDF   10 (28)
T ss_dssp             TTTEEE
T ss_pred             cCCCCc
Confidence            455544


No 95 
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=45.60  E-value=11  Score=17.59  Aligned_cols=14  Identities=29%  Similarity=0.923  Sum_probs=10.9

Q ss_pred             cccCCccccCccccCh
Q psy1778           3 MFPCPLVTCGKSFLRS   18 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~   18 (66)
                      -|.|+  .|++.|...
T Consensus        53 RyrC~--~C~~tf~~~   66 (129)
T COG3677          53 RYKCK--SCGSTFTVE   66 (129)
T ss_pred             ccccC--CcCcceeee
Confidence            47888  999888655


No 96 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=44.98  E-value=8.3  Score=16.89  Aligned_cols=31  Identities=19%  Similarity=0.542  Sum_probs=17.5

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccccccc
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMSYVA   48 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~f~~   48 (66)
                      +|.|+  .|++.-.        .++.+  .. +.|..  |+..|.-
T Consensus        35 ~~~Cp--~C~~~~V--------kR~a~--GI-W~C~k--Cg~~fAG   65 (89)
T COG1997          35 KHVCP--FCGRTTV--------KRIAT--GI-WKCRK--CGAKFAG   65 (89)
T ss_pred             CCcCC--CCCCcce--------eeecc--Ce-EEcCC--CCCeecc
Confidence            56777  8876411        12222  24 77866  8877753


No 97 
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=44.20  E-value=10  Score=14.97  Aligned_cols=7  Identities=43%  Similarity=1.165  Sum_probs=2.4

Q ss_pred             ccCcccc
Q psy1778          10 TCGKSFL   16 (66)
Q Consensus        10 ~c~~~~~   16 (66)
                      .|+-.|.
T Consensus        29 ~C~H~fe   35 (57)
T PF11789_consen   29 KCGHTFE   35 (57)
T ss_dssp             SS--EEE
T ss_pred             CCCCeec
Confidence            4555554


No 98 
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=42.93  E-value=11  Score=14.19  Aligned_cols=13  Identities=31%  Similarity=0.889  Sum_probs=6.9

Q ss_pred             ccCCccccCcccc
Q psy1778           4 FPCPLVTCGKSFL   16 (66)
Q Consensus         4 ~~c~~~~c~~~~~   16 (66)
                      +.|...+||..|.
T Consensus        26 ~qC~N~~Cg~tfv   38 (47)
T PF04606_consen   26 CQCTNPECGHTFV   38 (47)
T ss_pred             EEECCCcCCCEEE
Confidence            4455455665554


No 99 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=42.36  E-value=22  Score=12.81  Aligned_cols=21  Identities=38%  Similarity=0.545  Sum_probs=12.1

Q ss_pred             ccCCcccccccccc----cchHHHHHH
Q psy1778          35 FTCPYQDCLMSYVA----KSSLYAHLK   57 (66)
Q Consensus        35 ~~c~~~~c~~~f~~----~~~l~~h~~   57 (66)
                      ..|..  |...+..    .+.|..|++
T Consensus        17 a~C~~--C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   17 AKCKY--CGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             EEETT--TTEE-----SSTHHHHHHHH
T ss_pred             EEeCC--CCeEEeeCCCcHHHHHHhhh
Confidence            67766  8776655    366777763


No 100
>COG1773 Rubredoxin [Energy production and conversion]
Probab=42.17  E-value=12  Score=14.92  Aligned_cols=15  Identities=20%  Similarity=0.689  Sum_probs=11.2

Q ss_pred             CcccCCccccCccccCh
Q psy1778           2 RMFPCPLVTCGKSFLRS   18 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~   18 (66)
                      +.|.|.  .||..|...
T Consensus         2 ~~~~C~--~CG~vYd~e   16 (55)
T COG1773           2 KRWRCS--VCGYVYDPE   16 (55)
T ss_pred             CceEec--CCceEeccc
Confidence            457888  899887654


No 101
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=42.17  E-value=26  Score=14.28  Aligned_cols=8  Identities=75%  Similarity=2.224  Sum_probs=4.5

Q ss_pred             ccCCccccCc
Q psy1778           4 FPCPLVTCGK   13 (66)
Q Consensus         4 ~~c~~~~c~~   13 (66)
                      |.|+  .||.
T Consensus        28 F~CP--nCGe   35 (61)
T COG2888          28 FPCP--NCGE   35 (61)
T ss_pred             eeCC--CCCc
Confidence            4555  6664


No 102
>KOG0717|consensus
Probab=39.97  E-value=18  Score=21.05  Aligned_cols=21  Identities=24%  Similarity=0.471  Sum_probs=18.2

Q ss_pred             ccCCcccccccccccchHHHHHH
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAHLK   57 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h~~   57 (66)
                      +.|.+  |.++|.+...+..|..
T Consensus       293 lyC~v--CnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVV--CNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEee--ccccccchHHHHhhHH
Confidence            57877  9999999999998865


No 103
>KOG0227|consensus
Probab=38.62  E-value=15  Score=18.67  Aligned_cols=19  Identities=32%  Similarity=0.635  Sum_probs=14.4

Q ss_pred             ccCCcccccccccccchHHHH
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAH   55 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h   55 (66)
                      |.|.+  |.....+..+...|
T Consensus        54 yeCkL--ClT~H~ne~Syl~H   72 (222)
T KOG0227|consen   54 YECKL--CLTLHNNEGSYLAH   72 (222)
T ss_pred             eeehh--hhhhhcchhhhhhh
Confidence            78988  98877777776655


No 104
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=38.55  E-value=16  Score=12.72  Aligned_cols=25  Identities=32%  Similarity=0.828  Sum_probs=16.2

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcCCCCCccCCcccccc
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLM   44 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~   44 (66)
                      .|.|.  .||..+...            ..| ..|.+  |+.
T Consensus         2 ~~~C~--~CG~i~~g~------------~~p-~~CP~--Cg~   26 (34)
T cd00729           2 VWVCP--VCGYIHEGE------------EAP-EKCPI--CGA   26 (34)
T ss_pred             eEECC--CCCCEeECC------------cCC-CcCcC--CCC
Confidence            47888  899765321            246 67866  865


No 105
>KOG1994|consensus
Probab=38.26  E-value=15  Score=19.19  Aligned_cols=19  Identities=32%  Similarity=0.898  Sum_probs=16.9

Q ss_pred             ccCCcccccccccccchHHHH
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAH   55 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h   55 (66)
                      |.|.+  |+..|.....|..|
T Consensus       240 ~YC~f--CG~~y~~~edl~eh  258 (268)
T KOG1994|consen  240 YYCFF--CGIKYKDEEDLYEH  258 (268)
T ss_pred             eEEEE--eccccCCHHHHHHh
Confidence            88988  99999999988876


No 106
>KOG2482|consensus
Probab=37.55  E-value=33  Score=19.27  Aligned_cols=23  Identities=35%  Similarity=0.652  Sum_probs=18.4

Q ss_pred             ccCCccccCccccChHHHHHHHHHh
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQH   28 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~   28 (66)
                      +.|-  .|.+.|..+..|..||+-.
T Consensus       196 ~~CL--yCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  196 LRCL--YCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             heee--eeccccCCcHHHHHHHHhc
Confidence            4566  8889999999999888744


No 107
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=37.39  E-value=14  Score=12.83  Aligned_cols=26  Identities=27%  Similarity=0.720  Sum_probs=14.4

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCccccccc
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCLMS   45 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~~~   45 (66)
                      |.|.  .|+..+...           ...+ ..|..  |+..
T Consensus         1 Y~C~--~Cg~~~~~~-----------~~~~-irC~~--CG~R   26 (32)
T PF03604_consen    1 YICG--ECGAEVELK-----------PGDP-IRCPE--CGHR   26 (32)
T ss_dssp             EBES--SSSSSE-BS-----------TSST-SSBSS--SS-S
T ss_pred             CCCC--cCCCeeEcC-----------CCCc-EECCc--CCCe
Confidence            5677  888765421           1235 78855  8754


No 108
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=35.79  E-value=14  Score=17.87  Aligned_cols=13  Identities=38%  Similarity=0.766  Sum_probs=10.3

Q ss_pred             ccCCccccCccccCh
Q psy1778           4 FPCPLVTCGKSFLRS   18 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~   18 (66)
                      +.|+  .||++|..-
T Consensus        29 ~~c~--~c~~~f~~~   41 (154)
T PRK00464         29 RECL--ACGKRFTTF   41 (154)
T ss_pred             eecc--ccCCcceEe
Confidence            7788  999888754


No 109
>KOG2593|consensus
Probab=35.33  E-value=32  Score=19.80  Aligned_cols=16  Identities=31%  Similarity=0.781  Sum_probs=10.6

Q ss_pred             cccCCccccCccccChHH
Q psy1778           3 MFPCPLVTCGKSFLRSEH   20 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~   20 (66)
                      -|.|+  .|.+.|..-..
T Consensus       128 ~Y~Cp--~C~kkyt~Lea  143 (436)
T KOG2593|consen  128 GYVCP--NCQKKYTSLEA  143 (436)
T ss_pred             cccCC--ccccchhhhHH
Confidence            36777  88877765443


No 110
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=35.08  E-value=23  Score=13.68  Aligned_cols=13  Identities=23%  Similarity=0.772  Sum_probs=10.1

Q ss_pred             ccCCccccCccccCh
Q psy1778           4 FPCPLVTCGKSFLRS   18 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~   18 (66)
                      |.|.  .||..+...
T Consensus         2 y~C~--~CgyiYd~~   14 (50)
T cd00730           2 YECR--ICGYIYDPA   14 (50)
T ss_pred             cCCC--CCCeEECCC
Confidence            6788  899887754


No 111
>KOG2785|consensus
Probab=33.23  E-value=99  Score=17.73  Aligned_cols=52  Identities=23%  Similarity=0.466  Sum_probs=36.7

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcCC-CC---------------------CccCCccccc---ccccccchHHHHHH
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNEN-KP---------------------KFTCPYQDCL---MSYVAKSSLYAHLK   57 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~~-~~---------------------~~~c~~~~c~---~~f~~~~~l~~h~~   57 (66)
                      |--|-  .|+..+..-.....||..+.+- .|                     -+.|..  |.   ..|.+......||.
T Consensus       166 Pt~CL--fC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~--CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  166 PTDCL--FCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLF--CNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             Cccee--ecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEE--eccccCcccccHHHHHHHh
Confidence            44566  8998888888888888765432 11                     045655  66   88999999999987


Q ss_pred             H
Q psy1778          58 H   58 (66)
Q Consensus        58 ~   58 (66)
                      .
T Consensus       242 ~  242 (390)
T KOG2785|consen  242 D  242 (390)
T ss_pred             h
Confidence            3


No 112
>KOG2807|consensus
Probab=32.02  E-value=89  Score=17.61  Aligned_cols=21  Identities=29%  Similarity=0.703  Sum_probs=13.4

Q ss_pred             CCCccCCcccccccccccchHHHH
Q psy1778          32 KPKFTCPYQDCLMSYVAKSSLYAH   55 (66)
Q Consensus        32 ~~~~~c~~~~c~~~f~~~~~l~~h   55 (66)
                      .| ..|..  |+-+......|..-
T Consensus       289 LP-~eCpi--C~ltLVss~hLARS  309 (378)
T KOG2807|consen  289 LP-IECPI--CSLTLVSSPHLARS  309 (378)
T ss_pred             CC-ccCCc--cceeEecchHHHHH
Confidence            35 66755  77777666666644


No 113
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=29.58  E-value=31  Score=18.15  Aligned_cols=15  Identities=20%  Similarity=0.700  Sum_probs=11.6

Q ss_pred             CcccCCccccCccccCh
Q psy1778           2 RMFPCPLVTCGKSFLRS   18 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~   18 (66)
                      ++..|.  +||..|...
T Consensus       180 kpqRCp--ECGqVFKLV  194 (268)
T PTZ00043        180 FLYRCG--ECDQIFMLV  194 (268)
T ss_pred             CCccCC--CCCcEEEEE
Confidence            577898  999888653


No 114
>KOG4124|consensus
Probab=29.33  E-value=20  Score=20.12  Aligned_cols=22  Identities=23%  Similarity=0.247  Sum_probs=12.5

Q ss_pred             CCCCCccCCcccccccccccchHHHH
Q psy1778          30 ENKPKFTCPYQDCLMSYVAKSSLYAH   55 (66)
Q Consensus        30 ~~~~~~~c~~~~c~~~f~~~~~l~~h   55 (66)
                      ..+| |.|.   |+........|..|
T Consensus       210 ~~~p-~k~~---~~~~~~T~~~l~~H  231 (442)
T KOG4124|consen  210 TGTP-KKMP---ESLVMDTSSPLSDH  231 (442)
T ss_pred             ccCC-ccCc---ccccccccchhhhc
Confidence            3456 6664   55666666665544


No 115
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=29.22  E-value=28  Score=12.60  Aligned_cols=10  Identities=30%  Similarity=1.235  Sum_probs=4.7

Q ss_pred             ccCCccccCccc
Q psy1778           4 FPCPLVTCGKSF   15 (66)
Q Consensus         4 ~~c~~~~c~~~~   15 (66)
                      |.|.  .|+..|
T Consensus        29 y~C~--~C~~~w   38 (40)
T smart00440       29 YVCT--KCGHRW   38 (40)
T ss_pred             EEeC--CCCCEe
Confidence            3444  555444


No 116
>PTZ00448 hypothetical protein; Provisional
Probab=28.92  E-value=68  Score=18.22  Aligned_cols=23  Identities=17%  Similarity=0.553  Sum_probs=17.1

Q ss_pred             cccCCccccCccccChHHHHHHHHH
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQ   27 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~   27 (66)
                      .|.|.  .|+-.|........|.++
T Consensus       314 ~~tC~--~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCR--KCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             Ccccc--ccccccCCHHHHHHHhhh
Confidence            36688  888888777777777664


No 117
>KOG1842|consensus
Probab=28.39  E-value=39  Score=19.70  Aligned_cols=25  Identities=40%  Similarity=0.721  Sum_probs=19.5

Q ss_pred             ccCCcccccccccccchHHHHHHHhhC
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAHLKHVHS   61 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h~~~~~~   61 (66)
                      |.|.+  |...|.....|..|.-.-|+
T Consensus        16 flCPi--C~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   16 FLCPI--CLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             ccCch--HhhhhhhHHHHHHHHhhhcc
Confidence            78876  99999988888888765443


No 118
>PF10426 zf-RAG1:  Recombination-activating protein 1 zinc-finger domain;  InterPro: IPR019485 During lymphocyte development, the genes encoding immunoglobulins and T-cell receptors are assembled from variable (V), diversity (D), and joining (J) gene segments. This combinatorial process, known as V(D)J recombination, allows the generation of an enormous range of binding specificities from a limited amount of genetic information. The V(D)J recombination-activating proteins 1 and 2 (RAG1 and RAG2) form a complex that initiates this process by binding to the conserved recombination signal sequences (RSS) and introducing a double-strand break between the RSS and the adjacent coding segment. These breaks are generated in two steps, nicking of one strand (hydrolysis), followed by hairpin formation (transesterification). RAG1/2 has also been shown to function as a transposase in vitro, and to possess RSS-independent endonuclease activity (end processing) and hairpin opening. RAG1 alone can bind to RSS but stable, efficient binding requires RAG2. All known catalytic activities require the presence of both proteins. For more information see []. Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets [].  This entry represents a C2H2-type zinc-finger domain found in the RAG1 protein. The structure contains the characteristic two-stranded beta-sheet and alpha-helix of a classical zinc-finger. The domain binds one zinc and, in complex with an adjacent RING-type zinc finger domain, helps to stabilise the whole of the dimerisation region of recombination activating protein 1 (RAG1) []. The function of the whole is to bind double-stranded DNA. ; GO: 0016788 hydrolase activity, acting on ester bonds, 0016881 acid-amino acid ligase activity; PDB: 1RMD_A.
Probab=27.88  E-value=41  Score=11.62  Aligned_cols=7  Identities=57%  Similarity=1.507  Sum_probs=1.2

Q ss_pred             CCccccc
Q psy1778          37 CPYQDCL   43 (66)
Q Consensus        37 c~~~~c~   43 (66)
                      |.+.+|.
T Consensus         5 CPvkdC~   11 (30)
T PF10426_consen    5 CPVKDCD   11 (30)
T ss_dssp             --STT--
T ss_pred             cccccCc
Confidence            4333443


No 119
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=27.48  E-value=29  Score=16.46  Aligned_cols=10  Identities=50%  Similarity=1.507  Sum_probs=5.8

Q ss_pred             ccCCccccCccc
Q psy1778           4 FPCPLVTCGKSF   15 (66)
Q Consensus         4 ~~c~~~~c~~~~   15 (66)
                      |.|+  .|++.|
T Consensus       125 ~~C~--~C~kiy  134 (147)
T PF01927_consen  125 WRCP--GCGKIY  134 (147)
T ss_pred             EECC--CCCCEe
Confidence            4566  666654


No 120
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.36  E-value=67  Score=13.93  Aligned_cols=21  Identities=24%  Similarity=0.623  Sum_probs=16.7

Q ss_pred             CCccccCccccChHHHHHHHHHh
Q psy1778           6 CPLVTCGKSFLRSEHLQEHMLQH   28 (66)
Q Consensus         6 c~~~~c~~~~~~~~~l~~~~~~~   28 (66)
                      |+  .|+.+|...+.|-.-+...
T Consensus        24 CP--rCrGVWLDrGELdKli~r~   44 (88)
T COG3809          24 CP--RCRGVWLDRGELDKLIERS   44 (88)
T ss_pred             CC--ccccEeecchhHHHHHHHh
Confidence            66  8999999999988776543


No 121
>PF04328 DUF466:  Protein of unknown function (DUF466);  InterPro: IPR007423 This is a small bacterial protein of unknown function.
Probab=26.48  E-value=62  Score=13.26  Aligned_cols=12  Identities=17%  Similarity=0.396  Sum_probs=6.5

Q ss_pred             HHHHHhhCCCCC
Q psy1778          54 AHLKHVHSTNKI   65 (66)
Q Consensus        54 ~h~~~~~~~~~~   65 (66)
                      .|++.++.+.|.
T Consensus        30 ~H~~~~HP~~p~   41 (65)
T PF04328_consen   30 EHMRRHHPDEPP   41 (65)
T ss_pred             HHHHHHCcCCCC
Confidence            455656655543


No 122
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=26.13  E-value=8  Score=15.09  Aligned_cols=13  Identities=31%  Similarity=0.973  Sum_probs=4.7

Q ss_pred             ccCCccccCccccCh
Q psy1778           4 FPCPLVTCGKSFLRS   18 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~   18 (66)
                      |.|+  .|...|-..
T Consensus        22 y~C~--~C~~~FC~d   34 (51)
T PF07975_consen   22 YRCP--KCKNHFCID   34 (51)
T ss_dssp             E--T--TTT--B-HH
T ss_pred             EECC--CCCCccccC
Confidence            6666  676666433


No 123
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=26.11  E-value=39  Score=12.69  Aligned_cols=11  Identities=45%  Similarity=1.337  Sum_probs=7.9

Q ss_pred             CCccccCccccCh
Q psy1778           6 CPLVTCGKSFLRS   18 (66)
Q Consensus         6 c~~~~c~~~~~~~   18 (66)
                      |.  .|++.|.-.
T Consensus        11 C~--~C~rpf~WR   21 (42)
T PF10013_consen   11 CP--VCGRPFTWR   21 (42)
T ss_pred             Cc--ccCCcchHH
Confidence            66  888887654


No 124
>PF06858 NOG1:  Nucleolar GTP-binding protein 1 (NOG1);  InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1). The NOG1 family includes eukaryotic, bacterial and archaeal proteins. In Saccharomyces cerevisiae, the NOG1 gene has been shown to be essential for cell viability, suggesting that NOG1 may play an important role in nucleolar functions. In particular, NOG1 is believed to be functionally linked to ribosome biogenesis, which occurs in the nucleolus. In eukaryotes, NOG1 mutants were found to disrupt the biogenesis of the 60S ribosomal subunit []. The DRG and OBG proteins as well as the prokaryotic NOG-like proteins are homologous throughout their length to the amino half of eukaryotic NOG1, which contains the GTP binding motifs (IPR006073 from INTERPRO); the N-terminal GTP-binding motif is required for function.; GO: 0005525 GTP binding; PDB: 2E87_A.
Probab=25.60  E-value=54  Score=13.23  Aligned_cols=23  Identities=22%  Similarity=0.362  Sum_probs=12.8

Q ss_pred             ccccccccchHHHHHHHhhCCCC
Q psy1778          42 CLMSYVAKSSLYAHLKHVHSTNK   64 (66)
Q Consensus        42 c~~~f~~~~~l~~h~~~~~~~~~   64 (66)
                      |+.+....-.|....+..-+++|
T Consensus        27 CGysie~Q~~L~~~ik~~F~~~P   49 (58)
T PF06858_consen   27 CGYSIEEQLSLFKEIKPLFPNKP   49 (58)
T ss_dssp             TSS-HHHHHHHHHHHHHHTTTS-
T ss_pred             CCCCHHHHHHHHHHHHHHcCCCC
Confidence            76666666666666655554554


No 125
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=25.38  E-value=33  Score=11.96  Aligned_cols=6  Identities=67%  Similarity=1.398  Sum_probs=3.0

Q ss_pred             ccCccc
Q psy1778          10 TCGKSF   15 (66)
Q Consensus        10 ~c~~~~   15 (66)
                      .|+.+|
T Consensus        26 ~Cg~~~   31 (33)
T PF08792_consen   26 FCGSSF   31 (33)
T ss_pred             cCCcEe
Confidence            555443


No 126
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=24.75  E-value=24  Score=12.98  Aligned_cols=6  Identities=33%  Similarity=1.176  Sum_probs=2.8

Q ss_pred             ccCccc
Q psy1778          10 TCGKSF   15 (66)
Q Consensus        10 ~c~~~~   15 (66)
                      .|+..|
T Consensus        34 YCg~~y   39 (40)
T PF10276_consen   34 YCGTRY   39 (40)
T ss_dssp             TTTEEE
T ss_pred             CCCCEE
Confidence            555443


No 127
>KOG4385|consensus
Probab=24.00  E-value=57  Score=19.33  Aligned_cols=23  Identities=13%  Similarity=0.212  Sum_probs=19.1

Q ss_pred             cCCccccCccccChHHHHHHHHH
Q psy1778           5 PCPLVTCGKSFLRSEHLQEHMLQ   27 (66)
Q Consensus         5 ~c~~~~c~~~~~~~~~l~~~~~~   27 (66)
                      .|.|+.|+..+.....+..|...
T Consensus       211 vckwpgcE~~~ed~~~flKhln~  233 (581)
T KOG4385|consen  211 VCKWPGCEAVCEDFGSFLKHLNT  233 (581)
T ss_pred             ccCCCchhhhccchHHHHHhhcc
Confidence            58888999999888888888664


No 128
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=23.92  E-value=26  Score=13.38  Aligned_cols=13  Identities=31%  Similarity=1.009  Sum_probs=9.2

Q ss_pred             ccCCccccCccccCh
Q psy1778           4 FPCPLVTCGKSFLRS   18 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~   18 (66)
                      |.|.  .|+..+...
T Consensus         2 y~C~--~CgyvYd~~   14 (47)
T PF00301_consen    2 YQCP--VCGYVYDPE   14 (47)
T ss_dssp             EEET--TTSBEEETT
T ss_pred             cCCC--CCCEEEcCC
Confidence            6677  888777654


No 129
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=23.67  E-value=1.4e+02  Score=16.46  Aligned_cols=23  Identities=22%  Similarity=0.550  Sum_probs=18.8

Q ss_pred             cccCCccccCccccChHHHHHHHHH
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQ   27 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~   27 (66)
                      -|.|.  .|-+-|.....+..|+..
T Consensus        48 lyiCe--~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         48 LYICE--YCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             EEEcC--CCcchhCCHHHHHHHHHh
Confidence            46788  898888899999999773


No 130
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=23.62  E-value=39  Score=11.55  Aligned_cols=11  Identities=27%  Similarity=1.020  Sum_probs=7.5

Q ss_pred             cccCCccccCccc
Q psy1778           3 MFPCPLVTCGKSF   15 (66)
Q Consensus         3 ~~~c~~~~c~~~~   15 (66)
                      -|+|.  .|+...
T Consensus         4 ~ykC~--~CGniv   14 (34)
T cd00974           4 VYKCE--ICGNIV   14 (34)
T ss_pred             EEEcC--CCCcEE
Confidence            46777  787654


No 131
>KOG2295|consensus
Probab=23.61  E-value=84  Score=19.08  Aligned_cols=26  Identities=31%  Similarity=0.699  Sum_probs=20.7

Q ss_pred             CcccCCccccCccccChHHHHHHHHH
Q psy1778           2 RMFPCPLVTCGKSFLRSEHLQEHMLQ   27 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~~~~~l~~~~~~   27 (66)
                      ..|.|+...|.+.|.-......|+..
T Consensus       508 dKy~C~lsgc~KlF~gpEFvrKHi~~  533 (648)
T KOG2295|consen  508 DKYLCPLSGCAKLFKGPEFVRKHINK  533 (648)
T ss_pred             ccccCCCcchHhhccCHHHHHHHHHH
Confidence            35889877788999988888888764


No 132
>KOG4377|consensus
Probab=23.46  E-value=92  Score=18.15  Aligned_cols=28  Identities=14%  Similarity=0.191  Sum_probs=21.5

Q ss_pred             cccCCccccCccccChHHHHHHHHHhcC
Q psy1778           3 MFPCPLVTCGKSFLRSEHLQEHMLQHNE   30 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~~~l~~~~~~~~~   30 (66)
                      -|.|..+.|+.-+.++..+.+|..+|.-
T Consensus       271 hyhcl~e~C~ykr~~k~DvirH~~~hkk  298 (480)
T KOG4377|consen  271 HYHCLNEYCFYKRGQKNDVIRHVEIHKK  298 (480)
T ss_pred             hhcccCccccccccchhhhHHHHHHHhh
Confidence            4667777898877778888899887753


No 133
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=23.35  E-value=38  Score=11.55  Aligned_cols=11  Identities=27%  Similarity=1.038  Sum_probs=7.4

Q ss_pred             cccCCccccCccc
Q psy1778           3 MFPCPLVTCGKSF   15 (66)
Q Consensus         3 ~~~c~~~~c~~~~   15 (66)
                      -|+|.  .|+...
T Consensus         7 ~ykC~--~Cgniv   17 (34)
T TIGR00319         7 VYKCE--VCGNIV   17 (34)
T ss_pred             EEEcC--CCCcEE
Confidence            46777  787654


No 134
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=23.33  E-value=28  Score=16.40  Aligned_cols=14  Identities=21%  Similarity=0.776  Sum_probs=10.1

Q ss_pred             cccCCccccCccccCh
Q psy1778           3 MFPCPLVTCGKSFLRS   18 (66)
Q Consensus         3 ~~~c~~~~c~~~~~~~   18 (66)
                      .+.|.  .||..|...
T Consensus        70 ~~~C~--~CG~~~~~~   83 (135)
T PRK03824         70 VLKCR--NCGNEWSLK   83 (135)
T ss_pred             EEECC--CCCCEEecc
Confidence            36788  999877653


No 135
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=22.90  E-value=44  Score=11.85  Aligned_cols=10  Identities=40%  Similarity=1.461  Sum_probs=5.5

Q ss_pred             ccCCccccCccc
Q psy1778           4 FPCPLVTCGKSF   15 (66)
Q Consensus         4 ~~c~~~~c~~~~   15 (66)
                      +.|.  .||..+
T Consensus        33 ~~C~--~CGE~~   42 (46)
T TIGR03831        33 LVCP--QCGEEY   42 (46)
T ss_pred             cccc--cCCCEe
Confidence            3466  666544


No 136
>KOG4727|consensus
Probab=22.41  E-value=44  Score=16.79  Aligned_cols=21  Identities=14%  Similarity=0.412  Sum_probs=16.4

Q ss_pred             ccCCcccccccccccchHHHHHH
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAHLK   57 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h~~   57 (66)
                      |.|.+  |.-.+..+.++..|+.
T Consensus        76 yyCdV--CdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   76 YYCDV--CDCVVKDSINFLDHIN   96 (193)
T ss_pred             eeeee--cceeehhhHHHHHHhc
Confidence            77988  9888888877776653


No 137
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=21.98  E-value=47  Score=13.48  Aligned_cols=29  Identities=38%  Similarity=0.819  Sum_probs=15.4

Q ss_pred             ccCCccccCccccChHHHHHHHHHhcCCCCCccCCccccc
Q psy1778           4 FPCPLVTCGKSFLRSEHLQEHMLQHNENKPKFTCPYQDCL   43 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~~~l~~~~~~~~~~~~~~~c~~~~c~   43 (66)
                      |.|+   ||.+|.-...     -...|++. -.|..  |.
T Consensus        23 yPCP---CGDRFeIsLe-----Dl~~GE~V-ArCPS--CS   51 (67)
T COG5216          23 YPCP---CGDRFEISLE-----DLRNGEVV-ARCPS--CS   51 (67)
T ss_pred             ecCC---CCCEeEEEHH-----HhhCCceE-EEcCC--ce
Confidence            5675   8877753311     12345555 56754  64


No 138
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=21.93  E-value=19  Score=17.15  Aligned_cols=13  Identities=38%  Similarity=1.007  Sum_probs=7.8

Q ss_pred             CcccCCccccCcccc
Q psy1778           2 RMFPCPLVTCGKSFL   16 (66)
Q Consensus         2 ~~~~c~~~~c~~~~~   16 (66)
                      +|..|.  +||..|.
T Consensus       111 ~~~RCp--eCG~~fk  123 (136)
T PF01215_consen  111 KPQRCP--ECGQVFK  123 (136)
T ss_dssp             SEEEET--TTEEEEE
T ss_pred             CccCCC--CCCeEEE
Confidence            355666  6776654


No 139
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=21.73  E-value=37  Score=12.98  Aligned_cols=12  Identities=33%  Similarity=0.957  Sum_probs=5.4

Q ss_pred             cCCccccCccccCh
Q psy1778           5 PCPLVTCGKSFLRS   18 (66)
Q Consensus         5 ~c~~~~c~~~~~~~   18 (66)
                      .|+  .|++.|...
T Consensus        22 ~CP--lC~r~l~~e   33 (54)
T PF04423_consen   22 CCP--LCGRPLDEE   33 (54)
T ss_dssp             E-T--TT--EE-HH
T ss_pred             cCC--CCCCCCCHH
Confidence            577  888877654


No 140
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=21.69  E-value=1.3e+02  Score=17.25  Aligned_cols=20  Identities=25%  Similarity=0.511  Sum_probs=14.3

Q ss_pred             CCccccCccccChHHHHHHHHH
Q psy1778           6 CPLVTCGKSFLRSEHLQEHMLQ   27 (66)
Q Consensus         6 c~~~~c~~~~~~~~~l~~~~~~   27 (66)
                      |.  .|...|-....|..|++.
T Consensus       223 C~--FC~~~FYdDDEL~~HcR~  242 (493)
T COG5236         223 CI--FCKIYFYDDDELRRHCRL  242 (493)
T ss_pred             hh--hccceecChHHHHHHHHh
Confidence            55  677777777777777764


No 141
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=21.38  E-value=30  Score=13.42  Aligned_cols=11  Identities=27%  Similarity=1.066  Sum_probs=8.9

Q ss_pred             cccCCccccCccc
Q psy1778           3 MFPCPLVTCGKSF   15 (66)
Q Consensus         3 ~~~c~~~~c~~~~   15 (66)
                      -|.|.  .||+.+
T Consensus         6 ~Y~C~--~Cg~~~   16 (49)
T COG1996           6 EYKCA--RCGREV   16 (49)
T ss_pred             EEEhh--hcCCee
Confidence            47888  999887


No 142
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=21.34  E-value=90  Score=14.47  Aligned_cols=23  Identities=13%  Similarity=0.504  Sum_probs=13.6

Q ss_pred             ccCCcccccccccccchHHHHHHHh
Q psy1778          35 FTCPYQDCLMSYVAKSSLYAHLKHV   59 (66)
Q Consensus        35 ~~c~~~~c~~~f~~~~~l~~h~~~~   59 (66)
                      |.|..  |...|...-....|...|
T Consensus        82 y~C~~--C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        82 YVCAV--CKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             eeCCC--CCCccccccchhhhhhcc
Confidence            55654  666666666666665443


No 143
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.23  E-value=87  Score=14.56  Aligned_cols=12  Identities=33%  Similarity=0.526  Sum_probs=8.0

Q ss_pred             CcccCCccccCccc
Q psy1778           2 RMFPCPLVTCGKSF   15 (66)
Q Consensus         2 ~~~~c~~~~c~~~~   15 (66)
                      .|..|+  .||++|
T Consensus        25 dPiVsP--ytG~s~   36 (129)
T COG4530          25 DPIVSP--YTGKSY   36 (129)
T ss_pred             CccccC--cccccc
Confidence            356666  777777


No 144
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=21.19  E-value=35  Score=12.11  Aligned_cols=12  Identities=50%  Similarity=1.207  Sum_probs=5.1

Q ss_pred             cCCccccCccccCh
Q psy1778           5 PCPLVTCGKSFLRS   18 (66)
Q Consensus         5 ~c~~~~c~~~~~~~   18 (66)
                      .|.  +|++.|..+
T Consensus         5 ~C~--eC~~~f~dS   16 (34)
T PF01286_consen    5 KCD--ECGKPFMDS   16 (34)
T ss_dssp             E-T--TT--EES-S
T ss_pred             hHh--HhCCHHHHH
Confidence            466  788777543


No 145
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=21.10  E-value=35  Score=12.28  Aligned_cols=11  Identities=27%  Similarity=1.029  Sum_probs=5.5

Q ss_pred             cccCCccccCccc
Q psy1778           3 MFPCPLVTCGKSF   15 (66)
Q Consensus         3 ~~~c~~~~c~~~~   15 (66)
                      -|+|.  .||...
T Consensus         6 ~YkC~--~CGniV   16 (36)
T PF06397_consen    6 FYKCE--HCGNIV   16 (36)
T ss_dssp             EEE-T--TT--EE
T ss_pred             EEEcc--CCCCEE
Confidence            47788  888654


No 146
>PF14353 CpXC:  CpXC protein
Probab=20.51  E-value=49  Score=15.15  Aligned_cols=13  Identities=46%  Similarity=1.262  Sum_probs=8.7

Q ss_pred             ccCCccccCccccCh
Q psy1778           4 FPCPLVTCGKSFLRS   18 (66)
Q Consensus         4 ~~c~~~~c~~~~~~~   18 (66)
                      +.|+  .||..+.-.
T Consensus        39 ~~CP--~Cg~~~~~~   51 (128)
T PF14353_consen   39 FTCP--SCGHKFRLE   51 (128)
T ss_pred             EECC--CCCCceecC
Confidence            5677  888766543


No 147
>KOG2636|consensus
Probab=20.40  E-value=96  Score=18.29  Aligned_cols=27  Identities=19%  Similarity=0.450  Sum_probs=18.3

Q ss_pred             HHhcCCCCCccCCccccc-ccccccchHHHH
Q psy1778          26 LQHNENKPKFTCPYQDCL-MSYVAKSSLYAH   55 (66)
Q Consensus        26 ~~~~~~~~~~~c~~~~c~-~~f~~~~~l~~h   55 (66)
                      +.|+.... |.|.+  |+ .++.-...+..|
T Consensus       394 KLHGL~~e-y~CEI--CGNy~Y~GrkaF~RH  421 (497)
T KOG2636|consen  394 KLHGLDIE-YNCEI--CGNYVYKGRKAFDRH  421 (497)
T ss_pred             hhcCCCcc-cceee--ccCccccCcHHHHHH
Confidence            45666677 88887  87 666666666655


No 148
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=20.21  E-value=71  Score=11.62  Aligned_cols=23  Identities=35%  Similarity=0.628  Sum_probs=12.4

Q ss_pred             ccCCccccCccccC--hHHHHHHHHHh
Q psy1778           4 FPCPLVTCGKSFLR--SEHLQEHMLQH   28 (66)
Q Consensus         4 ~~c~~~~c~~~~~~--~~~l~~~~~~~   28 (66)
                      -.|.  .||..+..  ......|.+-|
T Consensus        14 ~~C~--~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCP--TCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCC--CCCCEECCCCHHHHHHHHHHH
Confidence            3566  78765443  34445555544


No 149
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=20.19  E-value=54  Score=15.97  Aligned_cols=13  Identities=31%  Similarity=0.667  Sum_probs=9.1

Q ss_pred             cCCccccCccccChH
Q psy1778           5 PCPLVTCGKSFLRSE   19 (66)
Q Consensus         5 ~c~~~~c~~~~~~~~   19 (66)
                      .|.  .|++.|.+-.
T Consensus        30 eC~--~C~~RFTTyE   42 (147)
T TIGR00244        30 ECL--ECHERFTTFE   42 (147)
T ss_pred             cCC--ccCCccceee
Confidence            466  8888887643


No 150
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=20.03  E-value=65  Score=11.59  Aligned_cols=9  Identities=44%  Similarity=1.106  Sum_probs=5.8

Q ss_pred             cccCCccccCc
Q psy1778           3 MFPCPLVTCGK   13 (66)
Q Consensus         3 ~~~c~~~~c~~   13 (66)
                      |..|+  .||.
T Consensus         2 ~~~Cp--~Cg~   10 (47)
T PF14690_consen    2 PPRCP--HCGS   10 (47)
T ss_pred             CccCC--CcCC
Confidence            55666  7774


Done!