RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy17801
         (97 letters)



>gnl|CDD|218201 pfam04668, Tsg, Twisted gastrulation (Tsg) protein conserved
           region.  Tsg was identified in Drosophila as being
           required to specify the dorsal-most structures in the
           embryo, for example amnioserosa. Biochemical experiments
           have revealed three key properties of Tsg: it can
           synergistically inhibit Dpp/BMP action in both
           Drosophila and vertebrates by forming a tripartite
           complete between itself, SOG/chordin and a BMP ligand;
           Tsg seems to enhance the Tld/BMP-1-mediated cleavage
           rate of SOG/chordin and may change the preference of
           site utilisation; Tsg can promote the dissociation of
           chordin cysteine-rich-containing fragments from the
           ligand to inhibit BMP signalling.
          Length = 133

 Score =  110 bits (276), Expect = 9e-33
 Identities = 39/68 (57%), Positives = 49/68 (72%)

Query: 3   KTSDQETADPLTAVTLNCTVAYMSTCMSWSKCKTSCRSMGSTSVRWFHDGCCECIGDTCI 62
              +  T+ P   +T+NCTV Y   CMSW+KCK SC SMG++S RWFHDGCCEC+G  C+
Sbjct: 60  GAHNVVTSVPSNGITVNCTVLYFDQCMSWNKCKQSCESMGASSYRWFHDGCCECVGPECL 119

Query: 63  NYGINQSR 70
           NYG N+SR
Sbjct: 120 NYGSNESR 127


>gnl|CDD|188395 TIGR03865, PQQ_CXXCW, PQQ-dependent catabolism-associated CXXCW
           motif protein.  Members of this protein family have a
           CXXXCW motif, consistent with a possible role in redox
           cofactor binding. This protein family shows strong
           relationships by phylogenetic profiling and conserved
           gene neighborhoods with a transport system for alcohols
           metabolized by PQQ-dependent enzymes.
          Length = 162

 Score = 25.8 bits (57), Expect = 3.6
 Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 6/44 (13%)

Query: 10  ADPLTAVTLNCTVAYMSTC-MSWSKCKTSCRSMGSTSVRWFHDG 52
            D    +   C     + C MSW+  K +  ++G ++V W+ DG
Sbjct: 113 GDKGRPLVFYC----RADCWMSWNAAKRA-LALGYSNVYWYPDG 151


>gnl|CDD|132618 TIGR03579, EF_0833, conserved hypothetical protein
           EF_0833/AHA_3914.  Members of this family of relatively
           rare proteins are found in both Gram-positive (e.g.
           Enterococcus faecalis) and Gram-negative (e.g. Aeromonas
           hydrophila) bacteria, as part of a cluster of conserved
           proteins. The function is unknown.
          Length = 209

 Score = 25.5 bits (56), Expect = 4.5
 Identities = 6/15 (40%), Positives = 13/15 (86%)

Query: 81  VWARPVCGGSMMGAV 95
           +W +P+ GG+++GA+
Sbjct: 185 IWKKPIAGGAILGAM 199


>gnl|CDD|213325 cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal
           peptide synthetases (NRPS), including Bacillus subtilis
           termination module Surfactin (SrfA-C).  The adenylation
           (A) domain of NRPS recognizes a specific amino acid or
           hydroxy acid and activates it as an (amino) acyl
           adenylate by hydrolysis of ATP. The activated acyl
           moiety then forms a thioester to the enzyme-bound
           cofactor phosphopantetheine of a peptidyl carrier
           protein domain. NRPSs are large multifunctional enzymes
           which synthesize many therapeutically useful peptides in
           bacteria and fungi via a template-directed, nucleic acid
           independent nonribosomal mechanism. These natural
           products include antibiotics, immunosuppressants, plant
           and animal toxins, and enzyme inhibitors. NRPS has a
           distinct modular structure in which each module is
           responsible for the recognition, activation, and, in
           some cases, modification of a single amino acid residue
           of the final peptide product. The modules can be
           subdivided into domains that catalyze specific
           biochemical reactions. This family includes the
           adenylation domain of the Bacillus subtilis termination
           module (Surfactin domain, SrfA-C) which recognizes a
           specific amino acid building block, which is then
           activated and transferred to the terminal thiol of the
           4'-phosphopantetheine (Ppan) arm of the downstream
           peptidyl carrier protein (PCP) domain.
          Length = 474

 Score = 24.8 bits (55), Expect = 8.5
 Identities = 6/13 (46%), Positives = 7/13 (53%)

Query: 46  VRWFHDGCCECIG 58
            RW  DG  E +G
Sbjct: 366 ARWRPDGNIEFLG 378


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.322    0.129    0.445 

Gapped
Lambda     K      H
   0.267   0.0597    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,337,303
Number of extensions: 297314
Number of successful extensions: 315
Number of sequences better than 10.0: 1
Number of HSP's gapped: 314
Number of HSP's successfully gapped: 15
Length of query: 97
Length of database: 10,937,602
Length adjustment: 64
Effective length of query: 33
Effective length of database: 8,098,946
Effective search space: 267265218
Effective search space used: 267265218
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (24.5 bits)