RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy17806
         (130 letters)



>gnl|CDD|240982 cd12538, RRM_U2AF35, RNA recognition motif in U2 small nuclear
           ribonucleoprotein auxiliary factor U2AF 35 kDa subunit
           (U2AF35).  This subgroup corresponds to the RRM of
           U2AF35, also termed U2AF1, which is one of the small
           subunits of U2 small nuclear ribonucleoprotein (snRNP)
           auxiliary factor (U2AF). It has been implicated in the
           recruitment of U2 snRNP to pre-mRNAs and is a highly
           conserved heterodimer composed of large and small
           subunits. U2AF35 directly binds to the 3' splice site of
           the conserved AG dinucleotide and performs multiple
           functions in the splicing process in a
           substrate-specific manner. It promotes U2 snRNP binding
           to the branch-point sequences of introns through
           association with the large subunit of U2AF, U2AF65 (also
           termed U2AF2). U2AF35 contains two N-terminal zinc
           fingers, a central RNA recognition motif (RRM), also
           termed RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain), and a C-terminal
           arginine/serine (SR)-rich segment interrupted by
           glycines. U2AF35 binds both U2AF65 and the pre-mRNA
           through its RRM domain. .
          Length = 104

 Score =  169 bits (429), Expect = 8e-56
 Identities = 63/73 (86%), Positives = 70/73 (95%)

Query: 1   MQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNR 60
           +QEH+D F+EDVFVE E+KYGEIEEMNVCDNLGDHLVGNVY+KFRREEDAEKAVNDLNNR
Sbjct: 32  LQEHFDEFYEDVFVELEEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVNDLNNR 91

Query: 61  WFGGRPVYAELSP 73
           WF G+P+YAELSP
Sbjct: 92  WFNGQPIYAELSP 104


>gnl|CDD|240733 cd12287, RRM_U2AF35_like, RNA recognition motif in U2 small nuclear
           ribonucleoprotein auxiliary factor U2AF 35 kDa subunit
           (U2AF35) and similar proteins.  This subfamily
           corresponds to the RRM in U2 small nuclear
           ribonucleoprotein (snRNP) auxiliary factor (U2AF) which
           has been implicated in the recruitment of U2 snRNP to
           pre-mRNAs. It is a highly conserved heterodimer composed
           of large and small subunits; this family includes the
           small subunit of U2AF (U2AF35 or U2AF1) and U2AF 35 kDa
           subunit B (U2AF35B or C3H60). U2AF35 directly binds to
           the 3' splice site of the conserved AG dinucleotide and
           performs multiple functions in the splicing process in a
           substrate-specific manner. It promotes U2 snRNP binding
           to the branch-point sequences of introns through
           association with the large subunit of U2AF (U2AF65 or
           U2AF2). Although the biological role of U2AF35B remains
           unclear, it shows high sequence homolgy to U2AF35, which
           contains two N-terminal zinc fingers, a central RNA
           recognition motif (RRM), also termed RBD (RNA binding
           domain) or RNP (ribonucleoprotein domain), and a
           C-terminal arginine/serine (SR) -rich segment
           interrupted by glycines. In contrast to U2AF35, U2AF35B
           has a plant-specific conserved C-terminal region
           containing SERE motif(s), which may have an important
           function specific to higher plants. .
          Length = 102

 Score =  124 bits (313), Expect = 3e-38
 Identities = 46/73 (63%), Positives = 60/73 (82%), Gaps = 1/73 (1%)

Query: 1   MQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNR 60
           +QEH+D F+EDVF+E   ++GEIE++ VCDNLGDHL+GNVY+KF  EEDAE A+  LN R
Sbjct: 31  IQEHFDEFYEDVFLELS-RFGEIEDLVVCDNLGDHLLGNVYVKFETEEDAEAALQALNGR 89

Query: 61  WFGGRPVYAELSP 73
           ++ GRP+Y ELSP
Sbjct: 90  YYAGRPLYPELSP 102


>gnl|CDD|240983 cd12539, RRM_U2AF35B, RNA recognition motif in splicing factor U2AF
           35 kDa subunit B (U2AF35B).  This subgroup corresponds
           to the RRM of U2AF35B, also termed zinc finger CCCH
           domain-containing protein 60 (C3H60), which is one of
           the small subunits of U2 small nuclear ribonucleoprotein
           (snRNP) auxiliary factor (U2AF). It has been implicated
           in the recruitment of U2 snRNP to pre-mRNAs and is a
           highly conserved heterodimer composed of large and small
           subunits. Members in this family are mainly found in
           plant. They show high sequence homology to vertebrates
           U2AF35 that directly binds to the 3' splice site of the
           conserved AG dinucleotide and performs multiple
           functions in the splicing process in a
           substrate-specific manner. U2AF35B contains two
           N-terminal zinc fingers, a central RNA recognition motif
           (RRM), also termed RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain), and a C-terminal
           arginine/serine (SR)-rich domain. In contrast to U2AF35,
           U2AF35B has a plant-specific conserved C-terminal region
           containing SERE motif(s), which may have an important
           function specific to higher plants. .
          Length = 103

 Score =  108 bits (273), Expect = 4e-32
 Identities = 41/72 (56%), Positives = 55/72 (76%), Gaps = 1/72 (1%)

Query: 2   QEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRW 61
           QEH+++F+ED+F E   K+GE+E +NVCDNLGDH+VGNVY+KFR EE A  A+  L  R+
Sbjct: 33  QEHFEDFYEDIFEEL-SKFGEVEALNVCDNLGDHMVGNVYVKFRDEEHAAAALKALQGRF 91

Query: 62  FGGRPVYAELSP 73
           + GRP+  E SP
Sbjct: 92  YDGRPIIVEFSP 103


>gnl|CDD|240984 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 small nuclear
           ribonucleoprotein auxiliary factor 35 kDa
           subunit-related protein 1 (U2AFBPL) and similar
           proteins.  This subgroup corresponds to the RRM of
           U2AFBPL, a human homolog of the imprinted mouse gene
           U2afbp-rs, which encodes a U2 small nuclear
           ribonucleoprotein auxiliary factor 35 kDa
           subunit-related protein 1 (U2AFBPL), also termed CCCH
           type zinc finger, RNA-binding motif and serine/arginine
           rich protein 1 (U2AF1RS1), or U2 small nuclear RNA
           auxiliary factor 1-like 1 (U2AF1L1). Although the
           biological role of U2AFBPL remains unclear, it shows
           high sequence homology to splicing factor U2AF 35 kDa
           subunit (U2AF35 or U2AF1) that directly binds to the 3'
           splice site of the conserved AG dinucleotide and
           performs multiple functions in the splicing process in a
           substrate-specific manner. Like U2AF35, U2AFBPL contains
           two N-terminal zinc fingers, a central RNA recognition
           motif (RRM), also termed RBD (RNA binding domain) or RNP
           (ribonucleoprotein domain), and a C-terminal
           arginine/serine (SR)-rich domain. .
          Length = 105

 Score = 71.5 bits (176), Expect = 2e-17
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 1   MQEHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNR 60
           +   ++ F++DV  E E K+GE+ +  VC N   HL GNVY++++ EE+A  A    N R
Sbjct: 34  LYSDFEEFYDDVLPEFE-KFGEVVQFKVCCNYEPHLRGNVYVQYQSEEEALAAFKMFNGR 92

Query: 61  WFGGRPVYAELSP 73
           W+ G+ +  E SP
Sbjct: 93  WYAGKQLTCEFSP 105


>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate
          RNA-binding protein 39 (RBM39) and similar proteins.
          This subfamily corresponds to the RRM3 of RBM39, also
          termed hepatocellular carcinoma protein 1, or
          RNA-binding region-containing protein 2, or splicing
          factor HCC1, ia nuclear autoantigen that contains an
          N-terminal arginine/serine rich (RS) motif and three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          An octapeptide sequence called the RS-ERK motif is
          repeated six times in the RS region of RBM39. Based on
          the specific domain composition, RBM39 has been
          classified into a family of non-snRNP (small nuclear
          ribonucleoprotein) splicing factors that are usually
          not complexed to snRNAs. .
          Length = 85

 Score = 64.5 bits (158), Expect = 6e-15
 Identities = 28/72 (38%), Positives = 37/72 (51%), Gaps = 8/72 (11%)

Query: 6  DNFF----EDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRW 61
          D +     EDV  EC  K+G +E + V  N      G VY+KF+  E A+K +  LN RW
Sbjct: 18 DEWDDEIKEDVLEECS-KFGPVEHIKVDKN---SPEGVVYVKFKTVEAAQKCIQALNGRW 73

Query: 62 FGGRPVYAELSP 73
          F GR + AE   
Sbjct: 74 FDGRQITAEYVD 85


>gnl|CDD|214637 smart00361, RRM_1, RNA recognition motif. 
          Length = 70

 Score = 64.0 bits (156), Expect = 8e-15
 Identities = 32/70 (45%), Positives = 43/70 (61%), Gaps = 4/70 (5%)

Query: 5  YDNFFEDVFVECEDKYGEIEEMN--VCDNLG--DHLVGNVYIKFRREEDAEKAVNDLNNR 60
           D  FE    E E+ +GE+ ++N    D++G  +H  GNVYI F R EDA +A+ DLN R
Sbjct: 1  KDEDFERELKEEEEYFGEVGKINKIYIDDVGYENHKRGNVYITFERSEDAARAIVDLNGR 60

Query: 61 WFGGRPVYAE 70
          +F GR V AE
Sbjct: 61 YFDGRLVKAE 70


>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large
          nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa
          subunit (U2AF65) and similar proteins.  This subfamily
          corresponds to the RRM3 of U2AF65 and dU2AF50. U2AF65,
          also termed U2AF2, is the large subunit of U2 small
          nuclear ribonucleoprotein (snRNP) auxiliary factor
          (U2AF), which has been implicated in the recruitment of
          U2 snRNP to pre-mRNAs and is a highly conserved
          heterodimer composed of large and small subunits.
          U2AF65 specifically recognizes the intron
          polypyrimidine tract upstream of the 3' splice site and
          promotes binding of U2 snRNP to the pre-mRNA
          branchpoint. U2AF65 also plays an important role in the
          nuclear export of mRNA. It facilitates the formation of
          a messenger ribonucleoprotein export complex,
          containing both the NXF1 receptor and the RNA
          substrate. Moreover, U2AF65 interacts directly and
          specifically with expanded CAG RNA, and serves as an
          adaptor to link expanded CAG RNA to NXF1 for RNA
          export. U2AF65 contains an N-terminal RS domain rich in
          arginine and serine, followed by a proline-rich segment
          and three C-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). The N-terminal RS domain
          stabilizes the interaction of U2 snRNP with the branch
          point (BP) by contacting the branch region, and further
          promotes base pair interactions between U2 snRNA and
          the BP. The proline-rich segment mediates
          protein-protein interactions with the RRM domain of the
          small U2AF subunit (U2AF35 or U2AF1). The RRM1 and RRM2
          are sufficient for specific RNA binding, while RRM3 is
          responsible for protein-protein interactions. The
          family also includes Splicing factor U2AF 50 kDa
          subunit (dU2AF50), the Drosophila ortholog of U2AF65.
          dU2AF50 functions as an essential pre-mRNA splicing
          factor in flies. It associates with intronless mRNAs
          and plays a significant and unexpected role in the
          nuclear export of a large number of intronless mRNAs.
          Length = 89

 Score = 55.6 bits (135), Expect = 2e-11
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 3  EHYDNFFEDVFVECEDKYGEIEEMNV----CDNLGDHLVGNVYIKFRREEDAEKAVNDLN 58
          E Y+   EDV  EC  KYG++  + +     + +    VG V+++F   EDA+KA   L 
Sbjct: 19 EEYEEILEDVKEECG-KYGKVLSVVIPRPEAEGVDVPGVGKVFVEFADVEDAQKAQLALA 77

Query: 59 NRWFGGRPV 67
           R F GR V
Sbjct: 78 GRKFDGRTV 86


>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily.  RRM,
          also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), is a highly abundant domain
          in eukaryotes found in proteins involved in
          post-transcriptional gene expression processes
          including mRNA and rRNA processing, RNA export, and RNA
          stability. This domain is 90 amino acids in length and
          consists of a four-stranded beta-sheet packed against
          two alpha-helices. RRM usually interacts with ssRNA,
          but is also known to interact with ssDNA as well as
          proteins. RRM binds a variable number of nucleotides,
          ranging from two to eight. The active site includes
          three aromatic side-chains located within the conserved
          RNP1 and RNP2 motifs of the domain. The RRM domain is
          found in a variety heterogeneous nuclear
          ribonucleoproteins (hnRNPs), proteins implicated in
          regulation of alternative splicing, and protein
          components of small nuclear ribonucleoproteins
          (snRNPs).
          Length = 72

 Score = 50.4 bits (121), Expect = 2e-09
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 19 KYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAE 70
          K+GEIE + +  +      G  +++F   EDAEKA+  LN +   GR +   
Sbjct: 21 KFGEIESVRIVRDKDGKSKGFAFVEFESPEDAEKALEALNGKELDGRKLKVS 72


>gnl|CDD|240728 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 in HIV
          Tat-specific factor 1 (Tat-SF1) and similar proteins.
          This subfamily corresponds to the RRM2 of Tat-SF1 and
          CUS2. Tat-SF1 is the cofactor for stimulation of
          transcriptional elongation by human immunodeficiency
          virus-type 1 (HIV-1) Tat. It is a substrate of an
          associated cellular kinase. Tat-SF1 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a highly acidic carboxyl-terminal half. The family
          also includes CUS2, a yeast homolog of human Tat-SF1.
          CUS2 interacts with U2 RNA in splicing extracts and
          functions as a splicing factor that aids assembly of
          the splicing-competent U2 snRNP in vivo. CUS2 also
          associates with PRP11 that is a subunit of the
          conserved splicing factor SF3a. Like Tat-SF1, CUS2
          contains two RRMs as well. .
          Length = 91

 Score = 48.0 bits (115), Expect = 2e-08
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 5/69 (7%)

Query: 10 EDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYA 69
          +D+  ECE K+G+++++ V D    H  G   +KF+  E+A++ +  LN RWF GR + A
Sbjct: 27 DDLREECE-KFGQVKKVVVFD---RHPDGVASVKFKEPEEADRCIEALNGRWFAGRQLEA 82

Query: 70 EL-SPVTDF 77
          E     TD+
Sbjct: 83 ERWDGKTDY 91


>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif. (a.k.a. RRM, RBD, or RNP
          domain).  The RRM motif is probably diagnostic of an
          RNA binding protein. RRMs are found in a variety of RNA
          binding proteins, including various hnRNP proteins,
          proteins implicated in regulation of alternative
          splicing, and protein components of snRNPs. The motif
          also appears in a few single stranded DNA binding
          proteins.
          Length = 56

 Score = 46.7 bits (112), Expect = 3e-08
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 19 KYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAELS 72
           +G +E++ +         G  +++F  EE AEKAV  LN   FGGRP+  + S
Sbjct: 7  PFGNVEKIKLLKKKP----GFAFVEFSTEEAAEKAVQYLNGVLFGGRPLRVDYS 56


>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain
          of 45 kDa-splicing factor (SPF45) and similar proteins.
           This subfamily corresponds to the RRM found in UHM
          domain of 45 kDa-splicing factor (SPF45 or RBM17),
          poly(U)-binding-splicing factor PUF60 (FIR or Hfp or
          RoBP1 or Siah-BP1), and similar proteins. SPF45 is an
          RNA-binding protein consisting of an unstructured
          N-terminal region, followed by a G-patch motif and a
          C-terminal U2AF (U2 auxiliary factor) homology motifs
          (UHM) that harbors a RNA recognition motif (RRM), also
          termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain) and an Arg-Xaa-Phe sequence
          motif. SPF45 regulates alternative splicing of the
          apoptosis regulatory gene FAS (also known as CD95). It
          induces exon 6 skipping in FAS pre-mRNA through the UHM
          domain that binds to tryptophan-containing linear
          peptide motifs (UHM ligand motifs, ULMs) present in the
          3' splice site-recognizing factors U2AF65, SF1 and
          SF3b155. PUF60 is an essential splicing factor that
          functions as a poly-U RNA-binding protein required to
          reconstitute splicing in depleted nuclear extracts. Its
          function is enhanced through interaction with U2
          auxiliary factor U2AF65. PUF60 also controls human
          c-myc gene expression by binding and inhibiting the
          transcription factor far upstream sequence element
          (FUSE)-binding-protein (FBP), an activator of c-myc
          promoters. PUF60 contains two central RRMs and a
          C-terminal UHM domain. .
          Length = 85

 Score = 44.5 bits (106), Expect = 4e-07
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 5/71 (7%)

Query: 6  DNFFEDVFVECEDKYGEIEEMNVCDN---LGDHLVGNVYIKFRREEDAEKAVNDLNNRWF 62
          ++  +++  ECE KYG++  + V +      D  V  ++++F   ++A KAV  LN R+F
Sbjct: 17 EDLKDEIEEECE-KYGKVLNVIVHEVASSEADDAV-RIFVEFSDADEAIKAVRALNGRFF 74

Query: 63 GGRPVYAELSP 73
          GGR V A    
Sbjct: 75 GGRKVTARFYD 85


>gnl|CDD|214636 smart00360, RRM, RNA recognition motif. 
          Length = 73

 Score = 43.4 bits (103), Expect = 7e-07
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 19 KYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVY 68
          K+G++E + +  D       G  +++F  EEDAEKA+  LN +   GRP+ 
Sbjct: 22 KFGKVESVRLVRDKETGKSKGFAFVEFESEEDAEKALEALNGKELDGRPLK 72


>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif. (a.k.a. RRM, RBD, or RNP
          domain).  The RRM motif is probably diagnostic of an
          RNA binding protein. RRMs are found in a variety of RNA
          binding proteins, including various hnRNP proteins,
          proteins implicated in regulation of alternative
          splicing, and protein components of snRNPs. The motif
          also appears in a few single stranded DNA binding
          proteins. The RRM structure consists of four strands
          and two helices arranged in an alpha/beta sandwich,
          with a third helix present during RNA binding in some
          cases The C-terminal beta strand (4th strand) and final
          helix are hard to align and have been omitted in the
          SEED alignment The LA proteins have an N terminal rrm
          which is included in the seed. There is a second region
          towards the C terminus that has some features
          characteristic of a rrm but does not appear to have the
          important structural core of a rrm. The LA proteins are
          one of the main autoantigens in Systemic lupus
          erythematosus (SLE), an autoimmune disease.
          Length = 70

 Score = 43.0 bits (102), Expect = 1e-06
 Identities = 18/50 (36%), Positives = 28/50 (56%)

Query: 19 KYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVY 68
          K+G IE + +  +      G  +++F  EEDAEKA+  LN +  GGR + 
Sbjct: 21 KFGPIESIRIVRDETGRSKGFAFVEFEDEEDAEKALEALNGKELGGRELR 70


>gnl|CDD|241091 cd12647, RRM_UHM_SPF45, RNA recognition motif in UHM domain of 45
          kDa-splicing factor (SPF45) and similar proteins.  This
          subgroup corresponds to the RRM of SPF45, also termed
          RNA-binding motif protein 17 (RBM17), an RNA-binding
          protein consisting of an unstructured N-terminal
          region, followed by a G-patch motif and a C-terminal
          U2AF (U2 auxiliary factor) homology motifs (UHM) that
          harbors a RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain)
          and an Arg-Xaa-Phe sequence motif. SPF45 regulates
          alternative splicing of the apoptosis regulatory gene
          FAS (also known as CD95). It induces exon 6 skipping in
          FAS pre-mRNA through the UHM domain that binds to
          tryptophan-containing linear peptide motifs (UHM ligand
          motifs, ULMs) present in the 3' splice site-recognizing
          factors U2AF65, SF1 and SF3b155. .
          Length = 96

 Score = 42.3 bits (100), Expect = 3e-06
 Identities = 26/67 (38%), Positives = 37/67 (55%), Gaps = 4/67 (5%)

Query: 15 ECEDKYGEIEEMNVCDNLG---DHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAEL 71
          EC  KYG++ ++ + +  G   D     ++++F R E A KAV DLN R+FGGR V A  
Sbjct: 27 ECS-KYGKVTKVLIFEIPGASPDDEAVRIFVEFERVESAIKAVVDLNGRFFGGRTVKASF 85

Query: 72 SPVTDFR 78
               FR
Sbjct: 86 YDEERFR 92


>gnl|CDD|241092 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 in UHM domain of
          poly(U)-binding-splicing factor PUF60 and similar
          proteins.  This subgroup corresponds to the RRM3 of
          PUF60, also termed FUSE-binding protein-interacting
          repressor (FBP-interacting repressor or FIR), or
          Ro-binding protein 1 (RoBP1), or Siah-binding protein 1
          (Siah-BP1), an essential splicing factor that functions
          as a poly-U RNA-binding protein required to
          reconstitute splicing in depleted nuclear extracts. Its
          function is enhanced through interaction with U2
          auxiliary factor U2AF65. PUF60 also controls human
          c-myc gene expression by binding and inhibiting the
          transcription factor far upstream sequence element
          (FUSE)-binding-protein (FBP), an activator of c-myc
          promoters. PUF60 contains two central RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a C-terminal
          U2AF (U2 auxiliary factor) homology motifs (UHM) that
          harbors another RRM and binds to tryptophan-containing
          linear peptide motifs (UHM ligand motifs, ULMs) in
          several nuclear proteins. The research indicates that
          PUF60 binds FUSE as a dimer, and only the first two RRM
          domains participate in the single-stranded DNA
          recognition. .
          Length = 98

 Score = 42.0 bits (99), Expect = 4e-06
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 8/74 (10%)

Query: 10 EDVFVECEDKYGEIE------EMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFG 63
           +V  EC  K+G +       E    +   + +V  ++++F    +AEKA+  LN RWFG
Sbjct: 21 GEVTEECG-KFGAVNRVIIYQEKQGEEEDAEIIV-KIFVEFSLPSEAEKAIQALNGRWFG 78

Query: 64 GRPVYAELSPVTDF 77
          GR V AEL   T F
Sbjct: 79 GRKVKAELYDQTKF 92


>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family.  This model
           represents a subfamily of RNA splicing factors including
           the Pad-1 protein (N. crassa), CAPER (M. musculus) and
           CC1.3 (H.sapiens). These proteins are characterized by
           an N-terminal arginine-rich, low complexity domain
           followed by three (or in the case of 4 H. sapiens
           paralogs, two) RNA recognition domains (rrm: pfam00706).
           These splicing factors are closely related to the U2AF
           splicing factor family (TIGR01642). A homologous gene
           from Plasmodium falciparum was identified in the course
           of the analysis of that genome at TIGR and was included
           in the seed.
          Length = 457

 Score = 43.7 bits (103), Expect = 6e-06
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 10  EDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYA 69
           +DV  EC  KYG +  + V         G +Y+KF   + A  A   LN R+FGG+ + A
Sbjct: 387 DDVKEECS-KYGGVVHIYVDTKNSA---GKIYLKFSSVDAALAAFQALNGRYFGGKMITA 442

Query: 70  ELSPVTDFREAC 81
                  +  +C
Sbjct: 443 AFVVNDVYDMSC 454


>gnl|CDD|240884 cd12438, RRM_CNOT4, RNA recognition motif in Eukaryotic CCR4-NOT
          transcription complex subunit 4 (NOT4) and similar
          proteins.  This subfamily corresponds to the RRM of
          NOT4, also termed CCR4-associated factor 4, or E3
          ubiquitin-protein ligase CNOT4, or potential
          transcriptional repressor NOT4Hp, a component of the
          CCR4-NOT complex, a global negative regulator of RNA
          polymerase II transcription. NOT4 functions as an
          ubiquitin-protein ligase (E3). It contains an
          N-terminal C4C4 type RING finger motif, followed by a
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). The
          RING fingers may interact with a subset of
          ubiquitin-conjugating enzymes (E2s), including UbcH5B,
          and mediate protein-protein interactions. T.
          Length = 98

 Score = 38.7 bits (91), Expect = 8e-05
 Identities = 12/55 (21%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 19 KYGEIE--EMNVCDNLGDHLVGN--VYIKFRREEDAEKAVNDLNNRWFGGRPVYA 69
          +YG+I+   +N   +       +   Y+ + R+EDA + +  ++  +  GR + A
Sbjct: 31 QYGKIKKIVINRNTSYNGSQGPSASAYVTYSRKEDALRCIQAVDGFYLDGRLLKA 85


>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a.k.a. RRM, RBD, or RNP
          domain). 
          Length = 69

 Score = 37.1 bits (87), Expect = 2e-04
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 19 KYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVY 68
           YG++E + +  N  D   G  +++F   EDAE A+  LN     GR + 
Sbjct: 21 PYGKVEGVRLVRN-KDRPRGFAFVEFASPEDAEAALKKLNGLVLDGRTLR 69


>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit,
           splicing factor.  These splicing factors consist of an
           N-terminal arginine-rich low complexity domain followed
           by three tandem RNA recognition motifs (pfam00076). The
           well-characterized members of this family are auxilliary
           components of the U2 small nuclear ribonuclearprotein
           splicing factor (U2AF). These proteins are closely
           related to the CC1-like subfamily of splicing factors
           (TIGR01622). Members of this subfamily are found in
           plants, metazoa and fungi.
          Length = 509

 Score = 37.2 bits (86), Expect = 0.001
 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 5/71 (7%)

Query: 3   EHYDNFFEDVFVECEDKYGEIEEMNVCDNLGDHL----VGNVYIKFRREEDAEKAVNDLN 58
           E Y+  +EDV  E   KYG +  + +    GD      VG V++++     AEKA+  +N
Sbjct: 427 EEYEEIYEDVKTEFS-KYGPLINIVIPRPNGDRNSTPGVGKVFLEYADVRSAEKAMEGMN 485

Query: 59  NRWFGGRPVYA 69
            R F  R V A
Sbjct: 486 GRKFNDRVVVA 496


>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint
           family.  The proteins represented by this model contain
           three RNA recognition motifs (rrm: pfam00076) and have
           been characterized as poly-pyrimidine tract binding
           proteins associated with RNA splicing factors. In the
           case of PUF60 (GP|6176532), in complex with p54, and in
           the presence of U2AF, facilitates association of U2
           snRNP with pre-mRNA.
          Length = 612

 Score = 37.4 bits (86), Expect = 0.001
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 40  VYIKFRREEDAEKAVNDLNNRWFGGRPVYAEL 71
           ++++F    + ++A   L+ R+FGGR V AE 
Sbjct: 568 IFVEFSDSMEVDRAKAALDGRFFGGRTVVAEA 599


>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and
          cytoplasmic polyadenylated RNA-binding protein PUB1 and
          similar proteins.  This subgroup corresponds to the
          RRM2 of yeast protein PUB1, also termed ARS
          consensus-binding protein ACBP-60, or poly
          uridylate-binding protein, or poly(U)-binding protein.
          PUB1 has been identified as both, a heterogeneous
          nuclear RNA-binding protein (hnRNP) and a cytoplasmic
          mRNA-binding protein (mRNP), which may be stably bound
          to a translationally inactive subpopulation of mRNAs
          within the cytoplasm. It is distributed in both, the
          nucleus and the cytoplasm, and binds to poly(A)+ RNA
          (mRNA or pre-mRNA). Although it is one of the major
          cellular proteins cross-linked by UV light to
          polyadenylated RNAs in vivo, PUB1 is nonessential for
          cell growth in yeast. PUB1 also binds to T-rich single
          stranded DNA (ssDNA). However, there is no strong
          evidence implicating PUB1 in the mechanism of DNA
          replication. PUB1 contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a GAR motif (glycine
          and arginine rich stretch) that is located between RRM2
          and RRM3. .
          Length = 75

 Score = 35.2 bits (81), Expect = 0.001
 Identities = 12/27 (44%), Positives = 21/27 (77%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPV 67
          ++ FR ++DAE A+N++N +W G RP+
Sbjct: 45 FVSFRSQQDAENAINEMNGKWLGSRPI 71


>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in
          RNA-binding protein 19 (RBM19) and RNA recognition
          motif 2 found in multiple RNA-binding domain-containing
          protein 1 (MRD1).  This subfamily corresponds to the
          RRM3 of RBM19 and RRM2 of MRD1. RBM19, also termed
          RNA-binding domain-1 (RBD-1), is a nucleolar protein
          conserved in eukaryotes involved in ribosome biogenesis
          by processing rRNA and is essential for preimplantation
          development. It has a unique domain organization
          containing 6 conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). MRD1 is encoded by a novel
          yeast gene MRD1 (multiple RNA-binding domain). It is
          well conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RRMs, which may play an important structural
          role in organizing specific rRNA processing events. .
          Length = 74

 Score = 34.6 bits (80), Expect = 0.002
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 10 EDVFVECEDKYGEIEEMNV-CDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVY 68
          E+   E  + +GEI E+++  D       G  ++ F   E A KA ++L+   F GR ++
Sbjct: 13 EEELRELFEAFGEISEVHLPLDKETKRSKGFAFVSFMFPEHAVKAYSELDGSIFQGRLLH 72


>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 76

 Score = 34.5 bits (80), Expect = 0.002
 Identities = 14/49 (28%), Positives = 25/49 (51%)

Query: 19 KYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
           +G + E+ +         G  +++F  + DAEKA+  +N +   GRPV
Sbjct: 22 PFGFVWEVTIPRKPDGKKKGFAFVQFTSKADAEKAIKGVNGKKIKGRPV 70


>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM3 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in the
          regulation of poly(A) tail length during the
          polyadenylation reaction, translation initiation, mRNA
          stabilization by influencing the rate of deadenylation
          and inhibition of mRNA decapping. The family represents
          type I polyadenylate-binding proteins (PABPs),
          including polyadenylate-binding protein 1 (PABP-1 or
          PABPC1), polyadenylate-binding protein 3 (PABP-3 or
          PABPC3), polyadenylate-binding protein 4 (PABP-4 or
          APP-1 or iPABP), polyadenylate-binding protein 5
          (PABP-5 or PABPC5), polyadenylate-binding protein
          1-like (PABP-1-like or PABPC1L), polyadenylate-binding
          protein 1-like 2 (PABPC1L2 or RBM32),
          polyadenylate-binding protein 4-like (PABP-4-like or
          PABPC4L), yeast polyadenylate-binding protein,
          cytoplasmic and nuclear (PABP or ACBP-67), and similar
          proteins. PABP-1 is an ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. PABP-1 possesses an A-rich sequence in its
          5'-UTR and allows binding of PABP and blockage of
          translation of its own mRNA. In contrast, PABP-3 lacks
          the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammalian,
          such as ovary and testis. It may play an important role
          in germ cell development. Moreover, unlike other PABPs,
          PABP-5 contains only four RRMs, but lacks both the
          linker region and the CTD. PABP-1-like and PABP-1-like
          2 are the orthologs of PABP-1. PABP-4-like is the
          ortholog of PABP-5. Their cellular functions remain
          unclear. The family also includes the yeast PABP, a
          conserved poly(A) binding protein containing poly(A)
          tails that can be attached to the 3'-ends of mRNAs. The
          yeast PABP and its homologs may play important roles in
          the initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 80

 Score = 34.5 bits (80), Expect = 0.002
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 4/67 (5%)

Query: 7  NFFEDV----FVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWF 62
          N  ED+      E   KYG+I    V  +      G  ++ F   E A+KAV +LN +  
Sbjct: 8  NLGEDMDDEKLKELFGKYGKITSAKVMKDDEGKSKGFGFVNFENHEAAQKAVEELNGKEV 67

Query: 63 GGRPVYA 69
           G+ +Y 
Sbjct: 68 NGKKLYV 74


>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in
          granule-associated RNA binding proteins p40-TIA-1 and
          TIAR.  This subfamily corresponds to the RRM2 of
          nucleolysin TIA-1 isoform p40 (p40-TIA-1 or TIA-1) and
          nucleolysin TIA-1-related protein (TIAR), both of which
          are granule-associated RNA binding proteins involved in
          inducing apoptosis in cytotoxic lymphocyte (CTL) target
          cells. TIA-1 and TIAR share high sequence similarity.
          They are expressed in a wide variety of cell types.
          TIA-1 can be phosphorylated by a serine/threonine
          kinase that is activated during Fas-mediated apoptosis.
          TIAR is mainly localized in the nucleus of
          hematopoietic and nonhematopoietic cells. It is
          translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. Both,
          TIA-1 and TIAR, bind specifically to poly(A) but not to
          poly(C) homopolymers. They are composed of three
          N-terminal highly homologous RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a glutamine-rich
          C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 and TIAR interact with
          RNAs containing short stretches of uridylates and their
          RRM2 can mediate the specific binding to uridylate-rich
          RNAs. The C-terminal auxiliary domain may be
          responsible for interacting with other proteins. In
          addition, TIA-1 and TIAR share a potential serine
          protease-cleavage site (Phe-Val-Arg) localized at the
          junction between their RNA binding domains and their
          C-terminal auxiliary domains.
          Length = 75

 Score = 33.9 bits (78), Expect = 0.004
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPV 67
          ++ F ++EDAE A+  +N +W GGR +
Sbjct: 45 FVSFVKKEDAENAIQSMNGQWLGGRAI 71


>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 79

 Score = 33.7 bits (78), Expect = 0.004
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAELS 72
          G  Y+ F  EEDA++A+ +     FGGR ++ E +
Sbjct: 42 GFGYVTFALEEDAKRALEEKKKTKFGGRKIHVEFA 76


>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal
          pre-messenger RNA splicing protein 24 (Prp24) and
          similar proteins.  This subfamily corresponds to the
          RRM3 of Prp24, also termed U4/U6
          snRNA-associated-splicing factor PRP24 (U4/U6 snRNP),
          an RNA-binding protein with four well conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It facilitates U6 RNA base-pairing with U4 RNA during
          spliceosome assembly. Prp24 specifically binds free U6
          RNA primarily with RRMs 1 and 2 and facilitates pairing
          of U6 RNA bases with U4 RNA bases. Additionally, it may
          also be involved in dissociation of the U4/U6 complex
          during spliceosome activation. .
          Length = 78

 Score = 33.8 bits (78), Expect = 0.004
 Identities = 17/69 (24%), Positives = 29/69 (42%), Gaps = 9/69 (13%)

Query: 7  NFFEDVFVECEDKYGEIEEMNV----CDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWF 62
          +    +F     K+GE+E + +     +  G    G  ++ F+    AE A+  LN    
Sbjct: 15 DDLRGIFS----KFGEVESIRIPKKQDEKQGRLNNGFAFVTFKDASSAENALQ-LNGTEL 69

Query: 63 GGRPVYAEL 71
          GGR +   L
Sbjct: 70 GGRKISVSL 78


>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger. 
          Length = 27

 Score = 32.2 bits (74), Expect = 0.005
 Identities = 7/25 (28%), Positives = 12/25 (48%)

Query: 76  DFREACCRQYEMGECTRSGFCNFMH 100
            ++   C+ ++ G C R   C F H
Sbjct: 1   KYKTELCKFFKRGYCPRGDRCKFAH 25


>gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and
           similar). 
          Length = 27

 Score = 32.1 bits (74), Expect = 0.006
 Identities = 7/25 (28%), Positives = 7/25 (28%)

Query: 76  DFREACCRQYEMGECTRSGFCNFMH 100
              E C      G C     C F H
Sbjct: 1   YKTELCRFFSRTGTCKYGDRCKFAH 25


>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins
          family.  This subfamily corresponds to the RRM1 of the
          Hu proteins family which represents a group of
          RNA-binding proteins involved in diverse biological
          processes. Since the Hu proteins share high homology
          with the Drosophila embryonic lethal abnormal vision
          (ELAV) protein, the Hu family is sometimes referred to
          as the ELAV family. Drosophila ELAV is exclusively
          expressed in neurons and is required for the correct
          differentiation and survival of neurons in flies. The
          neuronal members of the Hu family include Hu-antigen B
          (HuB or ELAV-2 or Hel-N1), Hu-antigen C (HuC or ELAV-3
          or PLE21), and Hu-antigen D (HuD or ELAV-4), which play
          important roles in neuronal differentiation, plasticity
          and memory. HuB is also expressed in gonads. Hu-antigen
          R (HuR or ELAV-1 or HuA) is the ubiquitously expressed
          Hu family member. It has a variety of biological
          functions mostly related to the regulation of cellular
          response to DNA damage and other types of stress. HuR
          has an anti-apoptotic function during early cell stress
          response. It binds to mRNAs and enhances the expression
          of several anti-apoptotic proteins, such as p21waf1,
          p53, and prothymosin alpha. HuR also has pro-apoptotic
          function by promoting apoptosis when cell death is
          unavoidable. Furthermore, HuR may be important in
          muscle differentiation, adipogenesis, suppression of
          inflammatory response and modulation of gene expression
          in response to chronic ethanol exposure and amino acid
          starvation. Hu proteins perform their cytoplasmic and
          nuclear molecular functions by coordinately regulating
          functionally related mRNAs. In the cytoplasm, Hu
          proteins recognize and bind to AU-rich RNA elements
          (AREs) in the 3' untranslated regions (UTRs) of certain
          target mRNAs, such as GAP-43, vascular epithelial
          growth factor (VEGF), the glucose transporter GLUT1,
          eotaxin and c-fos, and stabilize those ARE-containing
          mRNAs. They also bind and regulate the translation of
          some target mRNAs, such as neurofilament M, GLUT1, and
          p27. In the nucleus, Hu proteins function as regulators
          of polyadenylation and alternative splicing. Each Hu
          protein contains three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an ARE. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 78

 Score = 32.8 bits (75), Expect = 0.008
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 19 KYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLN 58
            GEIE   +  D +    +G  ++ +   EDAEKA+N LN
Sbjct: 24 SIGEIESCKLIRDKVTGQSLGYGFVNYVDPEDAEKAINTLN 64


>gnl|CDD|240911 cd12465, RRM_UHMK1, RNA recognition motif found in U2AF homology
          motif kinase 1 (UHMK1) and similar proteins.  This
          subgroup corresponds to the RRM of UHMK1. UHMK1, also
          termed kinase interacting with stathmin (KIS) or
          P-CIP2, is a serine/threonine protein kinase
          functionally related to RNA metabolism and neurite
          outgrowth. It contains an N-terminal kinase domain and
          a C-terminal RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), with high homology to the corresponding motif
          of the mammalian U2 small nuclear ribonucleoprotein
          auxiliary factor U2AF 65 kDa subunit (U2AF65 or U2AF2).
          UHMK1 targets two key regulators of cell proliferation
          and migration, the cyclin-dependent kinase (CDK)
          inhibitor p27Kip1 and the microtubule-destabilizing
          protein stathmin. It plays a critical role during
          vascular wound repair by preventing excessive vascular
          smooth muscle cell (VSMC) migration into the vascular
          lesion. Moreover, UHMK1 may control cell migration and
          neurite outgrowth by interacting with and
          phosphorylating the splicing factor SF1, thereby
          probably contributing to the control of protein
          expression. Furthermore, UHMK1 may be functionally
          related to microtubule dynamics and axon development.
          It localizes to RNA granules, interacts with three
          proteins found in RNA granules (KIF3A, NonO, and
          eEF1A), and further enhances the local translation.
          UHMK1 is highly expressed in regions of the brain
          implicated in schizophrenia and may play a role in
          susceptibility to schizophrenia.
          Length = 88

 Score = 33.0 bits (75), Expect = 0.008
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 2  QEHYDNFFEDVFVECEDKYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNNR 60
          +E Y++  ED+  EC+ KYG +  + +  +N G    G V++++    D++ A   L  R
Sbjct: 20 EEEYEDIIEDIKEECQ-KYGPVVSLLIPKENPGK---GQVFVEYANAGDSKAAQKLLTGR 75

Query: 61 WFGGRPVYAELSP 73
           F G+ V A   P
Sbjct: 76 IFDGKFVVATFYP 88


>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1,
           2, 3, 4 family.  These eukaryotic proteins recognize the
           poly-A of mRNA and consists of four tandem RNA
           recognition domains at the N-terminus (rrm: pfam00076)
           followed by a PABP-specific domain (pfam00658) at the
           C-terminus. The protein is involved in the transport of
           mRNA's from the nucleus to the cytoplasm. There are four
           paralogs in Homo sapiens which are expressed in testis
           (GP:11610605_PABP3 ), platelets (SP:Q13310_PABP4 ),
           broadly expressed (SP:P11940_PABP1) and of unknown
           tissue range (SP:Q15097_PABP2).
          Length = 562

 Score = 34.0 bits (78), Expect = 0.012
 Identities = 18/55 (32%), Positives = 26/55 (47%)

Query: 10  EDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGG 64
           ED   E   K+GEI    V  +      G  ++ F + EDA KAV ++N +  G 
Sbjct: 192 EDKLRELFAKFGEITSAAVMKDGSGRSRGFAFVNFEKHEDAAKAVEEMNGKKIGL 246



 Score = 30.5 bits (69), Expect = 0.20
 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 10 EDVFVECEDKYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          E    +    +G +  + VC D++    +G  Y+ F+   DAE+A+  +N +  GG+P+
Sbjct: 14 EAKLYDLFKPFGPVLSVRVCRDSVTRRSLGYGYVNFQNPADAERALETMNFKRLGGKPI 72



 Score = 29.8 bits (67), Expect = 0.42
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 41  YIKFRREEDAEKAVNDLNNRWFGGRPVYAELSPVTDFREA 80
           ++ F   E+A +AV +++ R  GG+P+Y  L+   + R A
Sbjct: 330 FVCFSNPEEANRAVTEMHGRMLGGKPLYVALAQRKEQRRA 369


>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar
          protein 4 (Nop4p) and similar proteins.  This subgroup
          corresponds to the RRM2 of Nop4p (also known as
          Nop77p), encoded by YPL043W from Saccharomyces
          cerevisiae. It is an essential nucleolar protein
          involved in processing and maturation of 27S pre-rRNA
          and biogenesis of 60S ribosomal subunits. Nop4p has
          four RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 83

 Score = 32.1 bits (73), Expect = 0.019
 Identities = 14/49 (28%), Positives = 26/49 (53%)

Query: 19 KYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          +YG++ E  +    G  L G  ++  ++ ++AE A+ + N     GRPV
Sbjct: 24 RYGKVREATIPRKRGGKLCGFAFVTMKKRKNAEIALENTNGLEIDGRPV 72


>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding
          protein 34 (RBM34) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM34, a putative
          RNA-binding protein containing two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). Although the
          function of RBM34 remains unclear currently, its RRM
          domains may participate in mRNA processing. RBM34 may
          act as an mRNA processing-related protein. .
          Length = 91

 Score = 31.8 bits (73), Expect = 0.021
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 39 NVYIKFRREEDAEKAVNDLNNRWFGGR 65
          N Y+ F+ EE AEKA+  LN   F G 
Sbjct: 61 NAYVVFKEEESAEKALK-LNGTEFEGH 86


>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding
          protein 45 (RBM45) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM45, also termed
          developmentally-regulated RNA-binding protein 1 (DRB1),
          a new member of RNA recognition motif (RRM)-type neural
          RNA-binding proteins, which expresses under
          spatiotemporal control. It is encoded by gene drb1 that
          is expressed in neurons, not in glial cells. RBM45
          predominantly localizes in cytoplasm of cultured cells
          and specifically binds to poly(C) RNA. It could play an
          important role during neurogenesis. RBM45 carries four
          RRMs, also known as RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 81

 Score = 31.5 bits (72), Expect = 0.025
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 10 EDVFVECEDKYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRP 66
          ED   E    +GEI+++ V  D       G  Y+KF +   A +A+ ++N +  GG  
Sbjct: 16 EDDLREAFAPFGEIQDIWVVKDKQTKESKGVAYVKFAKASSAARAMEEMNGKCLGGDT 73


>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA
          annealing protein YRA1 (Yra1p), yeast mRNA export
          protein mlo3 and similar proteins.  This subfamily
          corresponds to the RRM of Yra1p and mlo3. Yra1p is an
          essential nuclear RNA-binding protein encoded by
          Saccharomyces cerevisiae YRA1 gene. It belongs to the
          evolutionarily conserved REF (RNA and export factor
          binding proteins) family of hnRNP-like proteins. Yra1p
          possesses potent RNA annealing activity and interacts
          with a number of proteins involved in nuclear transport
          and RNA processing. It binds to the mRNA export factor
          Mex67p/TAP and couples transcription to export in
          yeast. Yra1p is associated with Pse1p and Kap123p, two
          members of the beta-importin family, further mediating
          transport of Yra1p into the nucleus. In addition, the
          co-transcriptional loading of Yra1p is required for
          autoregulation. Yra1p consists of two highly conserved
          N- and C-terminal boxes and a central RNA recognition
          motif (RRM), also termed RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain). This subfamily includes
          RNA-annealing protein mlo3, also termed mRNA export
          protein mlo3, which has been identified in fission
          yeast as a protein that causes defects in chromosome
          segregation when overexpressed. It shows high sequence
          similarity with Yra1p. .
          Length = 77

 Score = 31.6 bits (72), Expect = 0.026
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 1/52 (1%)

Query: 21 GEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGG-RPVYAEL 71
          G I+ + +  N G    G   I F+R  DA KA +  N R   G R +  E+
Sbjct: 25 GPIKRVLLSYNEGGKSTGIANITFKRAGDATKAYDKFNGRIDDGNRKMKVEV 76


>gnl|CDD|240958 cd12514, RRM4_RBM12_like, RNA recognition motif 4 in RNA-binding
          protein RBM12, RBM12B and similar proteins.  This
          subfamily corresponds to the RRM4 of RBM12 and RBM12B.
          RBM12, also termed SH3/WW domain anchor protein in the
          nucleus (SWAN), is ubiquitously expressed. It contains
          five distinct RNA binding motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), two proline-rich regions, and several
          putative transmembrane domains. RBM12B show high
          sequence semilarity with RBM12. It contains five
          distinct RRMs as well. The biological roles of both
          RBM12 and RBM12B remain unclear. .
          Length = 73

 Score = 31.1 bits (71), Expect = 0.030
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%)

Query: 30 DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVY 68
          D  G  L G  Y++F  EEDA +A   L+ +   GR + 
Sbjct: 35 DKTGKTL-GEAYVEFVSEEDAMRAE-RLHRKKLKGREIL 71


>gnl|CDD|240750 cd12304, RRM_Set1, RNA recognition motif in the Set1-like family
          of histone-lysine N-methyltransferases.  This subfamily
          corresponds to the RRM of the Set1-like family of
          histone-lysine N-methyltransferases which includes
          Set1A and Set1B that are ubiquitously expressed
          vertebrates histone methyltransferases exhibiting high
          homology to yeast Set1. Set1A and Set1B proteins
          exhibit a largely non-overlapping subnuclear
          distribution in euchromatic nuclear speckles, strongly
          suggesting that they bind to a unique set of target
          genes and thus make non-redundant contributions to the
          epigenetic control of chromatin structure and gene
          expression. With the exception of the catalytic
          component, the subunit composition of the Set1A and
          Set1B histone methyltransferase complexes are
          identical. Each complex contains six human homologs of
          the yeast Set1/COMPASS complex, including Set1A or
          Set1B, Ash2 (homologous to yeast Bre2), CXXC finger
          protein 1 (CFP1; homologous to yeast Spp1), Rbbp5
          (homologous to yeast Swd1), Wdr5 (homologous to yeast
          Swd3), and Wdr82 (homologous to yeast Swd2). The
          genomic targeting of these complexes is determined by
          the identity of the catalytic subunit present in each
          histone methyltransferase complex. Thus, the Set1A and
          Set1B complexes may exhibit both overlapping and
          non-redundant properties. Both Set1A and Set1B contain
          an N-terminal RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), an N- SET domain, and a C-terminal catalytic
          SET domain followed by a post-SET domain. In contrast
          to Set1B, Set1A additionally contains an HCF-1 binding
          motif that interacts with HCF-1 in vivo. .
          Length = 93

 Score = 31.5 bits (72), Expect = 0.030
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 10/82 (12%)

Query: 7  NFFEDVFVECEDKYGEIEEMNVC--DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGG 64
           F +D    C+ KYGE+EE+ +        HL G   + F   + A++ V  LN     G
Sbjct: 17 GFLKD---MCK-KYGEVEEVKIYFHPKTNKHL-GLARVVFDSVKSAKRCVEKLNQTSVMG 71

Query: 65 RPVYAELSPVTDFREACCRQYE 86
          + +   L P     E   R YE
Sbjct: 72 KIIKVFLDP---KGEIRKRLYE 90


>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate
          APOBEC-1 complementation factor (ACF).  This subgroup
          corresponds to the RRM1 of ACF, also termed
          APOBEC-1-stimulating protein, an RNA-binding subunit of
          a core complex that interacts with apoB mRNA to
          facilitate C to U RNA editing. It may also act as an
          apoB mRNA recognition factor and chaperone, and play a
          key role in cell growth and differentiation. ACF
          shuttles between the cytoplasm and nucleus. It contains
          three RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which display high affinity for an 11
          nucleotide AU-rich mooring sequence 3' of the edited
          cytidine in apoB mRNA. All three RRMs may be required
          for complementation of editing activity in living
          cells. RRM2/3 are implicated in ACF interaction with
          APOBEC-1. .
          Length = 78

 Score = 31.1 bits (70), Expect = 0.034
 Identities = 15/53 (28%), Positives = 29/53 (54%)

Query: 7  NFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNN 59
          + FED  +   +K G+I EM +  +   +  G  ++ F  +++A+ A+  LNN
Sbjct: 12 DLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNN 64


>gnl|CDD|240993 cd12549, RRM_Set1B, RNA recognition motif in vertebrate
          histone-lysine N-methyltransferase Setd1B (Set1B).
          This subgroup corresponds to the RRM of Setd1B, also
          termed SET domain-containing protein 1B (Set1B), or
          lysine N-methyltransferase 2G, a ubiquitously expressed
          vertebrates histone methyltransferase that exhibits
          high homology to yeast Set1. Set1B is localized to
          euchromatic nuclear speckles and associates with a
          complex containing six human homologs of the yeast
          Set1/COMPASS complex, including CXXC finger protein 1
          (CFP1; homologous to yeast Spp1), Rbbp5 (homologous to
          yeast Swd1), Ash2 (homologous to yeast Bre2), Wdr5
          (homologous to yeast Swd3), and Wdr82 (homologous to
          yeast Swd2). Set1B complex is a histone
          methyltransferase that produces trimethylated histone
          H3 at Lys4. Set1B contains an N-terminal RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), an N- SET
          domain, and a C-terminal catalytic SET domain followed
          by a post-SET domain. .
          Length = 93

 Score = 31.2 bits (70), Expect = 0.041
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 6/84 (7%)

Query: 6  DNFFEDVFVECEDKYGEIEEMNVCDNLGD--HLVGNVYIKFRREEDAEKAVNDLNNRWFG 63
          DN  E+   +   KYGE+EE+ +  N  +  HL G   + F   + A+ AV  L+N    
Sbjct: 12 DNIRENFLTDMCKKYGEVEEVEILYNPKNKKHL-GIAKVVFATVKGAKDAVQHLHNTSVM 70

Query: 64 GRPVYAELSPVTDFREACCRQYEM 87
          G  ++ EL    + R    R YE+
Sbjct: 71 GNIIHVELDTKGETRM---RFYEL 91


>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor.  This
          model describes the ELAV/HuD subfamily of splicing
          factors found in metazoa. HuD stands for the human
          paraneoplastic encephalomyelitis antigen D of which
          there are 4 variants in human. ELAV stnds for the
          Drosophila Embryonic lethal abnormal visual protein.
          ELAV-like splicing factors are also known in human as
          HuB (ELAV-like protein 2), HuC (ELAV-like protein 3,
          Paraneoplastic cerebellar degeneration-associated
          antigen) and HuR (ELAV-like protein 1). These genes are
          most closely related to the sex-lethal subfamily of
          splicing factors found in Dipteran insects (TIGR01659).
          These proteins contain 3 RNA-recognition motifs (rrm:
          pfam00076).
          Length = 352

 Score = 32.6 bits (74), Expect = 0.042
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 21 GEIEEMN-VCDNLGDHLVGNVYIKFRREEDAEKAVNDLN 58
          GEIE    V D +    +G  ++ + R EDAEKAVN LN
Sbjct: 28 GEIESCKLVRDKVTGQSLGYGFVNYVRPEDAEKAVNSLN 66



 Score = 26.8 bits (59), Expect = 3.6
 Identities = 11/40 (27%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 20  YGEIEEMNV-CDNLGDHLVGNVYIKFRREEDAEKAVNDLN 58
           +G+I    +  DN+     G  +I+F + ++A++A+  LN
Sbjct: 113 FGQIITSRILSDNVTGLSKGVGFIRFDKRDEADRAIKTLN 152


>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic
          RNA-binding protein 18 and similar proteins.  This
          subfamily corresponds to the RRM of RBM18, a putative
          RNA-binding protein containing a well-conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). The
          biological role of RBM18 remains unclear. .
          Length = 80

 Score = 30.7 bits (70), Expect = 0.045
 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 19 KYGEIEEMNVCDNLGDHLVGN----VYIKFRREEDAEKAVNDLNNRWFGGR 65
          KYG+I++ +   +    L G      ++ F  +E+AEKA+  LN +   G+
Sbjct: 22 KYGKIKKFDFLFHKSGPLKGQPRGYCFVTFETKEEAEKALKSLNGKTALGK 72


>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found
          in heterogeneous nuclear ribonucleoprotein (hnRNP) H
          protein family, epithelial splicing regulatory proteins
          (ESRPs), Drosophila RNA-binding protein Fusilli,
          RNA-binding protein 12 (RBM12) and similar proteins.
          The family includes RRM domains in the hnRNP H protein
          family, G-rich sequence factor 1 (GRSF-1), ESRPs (also
          termed RBM35), Drosophila Fusilli, RBM12 (also termed
          SWAN), RBM12B, RBM19 (also termed RBD-1) and similar
          proteins. The hnRNP H protein family includes hnRNP H
          (also termed mcs94-1), hnRNP H2 (also termed FTP-3 or
          hnRNP H'), hnRNP F and hnRNP H3 (also termed hnRNP
          2H9), which represent a group of nuclear RNA binding
          proteins that are involved in pre-mRNA processing.
          GRSF-1 is a cytoplasmic poly(A)+ mRNA binding protein
          which interacts with RNA in a G-rich element-dependent
          manner. It may function in RNA packaging, stabilization
          of RNA secondary structure, or other macromolecular
          interactions. ESRP1 (also termed RBM35A) and ESRP2
          (also termed RBM35B) are epithelial-specific RNA
          binding proteins that promote splicing of the
          epithelial variant of fibroblast growth factor receptor
          2 (FGFR2), ENAH (also termed hMena), CD44 and CTNND1
          (also termed p120-Catenin) transcripts. Fusilli shows
          high sequence homology to ESRPs. It can regulate
          endogenous FGFR2 splicing and functions as a splicing
          factor. The biological roles of both, RBM12 and RBM12B,
          remain unclear. RBM19 is a nucleolar protein conserved
          in eukaryotes. It is involved in ribosome biogenesis by
          processing rRNA. In addition, it is essential for
          preimplantation development. Members in this family
          contain 2~6 conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 73

 Score = 30.6 bits (70), Expect = 0.051
 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGRPVY 68
          G  Y++F   EDA +A+   NN+  GGR + 
Sbjct: 42 GEAYVEFASPEDARRALRKHNNK-MGGRYIE 71


>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM1 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in the
          regulation of poly(A) tail length during the
          polyadenylation reaction, translation initiation, mRNA
          stabilization by influencing the rate of deadenylation
          and inhibition of mRNA decapping. The family represents
          type I polyadenylate-binding proteins (PABPs),
          including polyadenylate-binding protein 1 (PABP-1 or
          PABPC1), polyadenylate-binding protein 3 (PABP-3 or
          PABPC3), polyadenylate-binding protein 4 (PABP-4 or
          APP-1 or iPABP), polyadenylate-binding protein 5
          (PABP-5 or PABPC5), polyadenylate-binding protein
          1-like (PABP-1-like or PABPC1L), polyadenylate-binding
          protein 1-like 2 (PABPC1L2 or RBM32),
          polyadenylate-binding protein 4-like (PABP-4-like or
          PABPC4L), yeast polyadenylate-binding protein,
          cytoplasmic and nuclear (PABP or ACBP-67), and similar
          proteins. PABP-1 is a ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. Moreover, PABP-1 possesses an A-rich sequence
          in its 5'-UTR and allows binding of PABP and blockage
          of translation of its own mRNA. In contrast, PABP-3
          lacks the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammals, such
          as ovary and testis. It may play an important role in
          germ cell development. Moreover, unlike other PABPs,
          PABP-5 contains only four RRMs, but lacks both the
          linker region and the CTD. PABP-1-like and PABP-1-like
          2 are the orthologs of PABP-1. PABP-4-like is the
          ortholog of PABP-5. Their cellular functions remain
          unclear. The family also includes yeast PABP, a
          conserved poly(A) binding protein containing poly(A)
          tails that can be attached to the 3'-ends of mRNAs. The
          yeast PABP and its homologs may play important roles in
          the initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 80

 Score = 30.6 bits (70), Expect = 0.052
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 19 KYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVY 68
            G +  + VC D +    +G  Y+ F+   DAE+A++ LN     G+P+ 
Sbjct: 22 PAGPVLSIRVCRDLITRRSLGYAYVNFQNPADAERALDTLNFDVIKGKPIR 72


>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in
          CELF/Bruno-like family of RNA binding proteins and
          plant flowering time control protein FCA.  This
          subfamily corresponds to the RRM1 and RRM2 domains of
          the CUGBP1 and ETR-3-like factors (CELF) as well as
          plant flowering time control protein FCA. CELF, also
          termed BRUNOL (Bruno-like) proteins, is a family of
          structurally related RNA-binding proteins involved in
          regulation of pre-mRNA splicing in the nucleus, and
          control of mRNA translation and deadenylation in the
          cytoplasm. The family contains six members: CELF-1
          (also known as BRUNOL-2, CUG-BP1, NAPOR, EDEN-BP),
          CELF-2 (also known as BRUNOL-3, ETR-3, CUG-BP2,
          NAPOR-2), CELF-3 (also known as BRUNOL-1, TNRC4, ETR-1,
          CAGH4, ER DA4), CELF-4 (BRUNOL-4), CELF-5 (BRUNOL-5)
          and CELF-6 (BRUNOL-6). They all contain three highly
          conserved RNA recognition motifs (RRMs), also known as
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains): two consecutive RRMs (RRM1 and RRM2) situated
          in the N-terminal region followed by a linker region
          and the third RRM (RRM3) close to the C-terminus of the
          protein. The low sequence conservation of the linker
          region is highly suggestive of a large variety in the
          co-factors that associate with the various CELF family
          members. Based on both, sequence similarity and
          function, the CELF family can be divided into two
          subfamilies, the first containing CELFs 1 and 2, and
          the second containing CELFs 3, 4, 5, and 6. The
          different CELF proteins may act through different sites
          on at least some substrates. Furthermore, CELF proteins
          may interact with each other in varying combinations to
          influence alternative splicing in different contexts.
          This subfamily also includes plant flowering time
          control protein FCA that functions in the
          posttranscriptional regulation of transcripts involved
          in the flowering process. FCA contains two RRMs, and a
          WW protein interaction domain.  .
          Length = 77

 Score = 30.6 bits (70), Expect = 0.059
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 19 KYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNN 59
          +YG IEE+ +  D       G  ++KF   E+A+KA+  L+ 
Sbjct: 22 EYGNIEEVTIIRDKDTGQSKGCAFVKFSSREEAQKAIEALHG 63


>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast
          nucleolar protein 3 (Npl3p) and similar proteins.  This
          subfamily corresponds to the RRM1 of Npl3p, also termed
          mitochondrial targeting suppressor 1 protein, or
          nuclear polyadenylated RNA-binding protein 1. Npl3p is
          a major yeast RNA-binding protein that competes with
          3'-end processing factors, such as Rna15, for binding
          to the nascent RNA, protecting the transcript from
          premature termination and coordinating transcription
          termination and the packaging of the fully processed
          transcript for export. It specifically recognizes a
          class of G/U-rich RNAs. Npl3p is a multi-domain protein
          containing two central RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), separated by a short
          linker and a C-terminal domain rich in glycine,
          arginine and serine residues. .
          Length = 67

 Score = 30.5 bits (69), Expect = 0.060
 Identities = 11/60 (18%), Positives = 26/60 (43%), Gaps = 11/60 (18%)

Query: 9  FEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVY 68
            ++F      YG ++E+ +  N         +++F   E A +A + ++ +     P+Y
Sbjct: 16 IREIF----SPYGAVKEVKMISNFA-------FVEFESLESAIRAKDSVHGKVLNNNPLY 64


>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM4 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in theThe
          CD corresponds to the RRM. regulation of poly(A) tail
          length during the polyadenylation reaction, translation
          initiation, mRNA stabilization by influencing the rate
          of deadenylation and inhibition of mRNA decapping. The
          family represents type I polyadenylate-binding proteins
          (PABPs), including polyadenylate-binding protein 1
          (PABP-1 or PABPC1), polyadenylate-binding protein 3
          (PABP-3 or PABPC3), polyadenylate-binding protein 4
          (PABP-4 or APP-1 or iPABP), polyadenylate-binding
          protein 5 (PABP-5 or PABPC5), polyadenylate-binding
          protein 1-like (PABP-1-like or PABPC1L),
          polyadenylate-binding protein 1-like 2 (PABPC1L2 or
          RBM32), polyadenylate-binding protein 4-like
          (PABP-4-like or PABPC4L), yeast polyadenylate-binding
          protein, cytoplasmic and nuclear (PABP or ACBP-67), and
          similar proteins. PABP-1 is an ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. Moreover, PABP-1 possesses an A-rich sequence
          in its 5'-UTR and allows binding of PABP and blockage
          of translation of its own mRNA. In contrast, PABP-3
          lacks the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammalian,
          such as ovary and testis. It may play an important role
          in germ cell development. Moreover, unlike other PABPs,
          PABP-5 contains only four RRMs, but lacks both the
          linker region and the CTD. PABP-1-like and PABP-1-like
          2 are the orthologs of PABP-1. PABP-4-like is the
          ortholog of PABP-5. Their cellular functions remain
          unclear. The family also includes the yeast PABP, a
          conserved poly(A) binding protein containing poly(A)
          tails that can be attached to the 3'-ends of mRNAs. The
          yeast PABP and its homologs may play important roles in
          the initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 79

 Score = 30.3 bits (69), Expect = 0.069
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 44 FRREEDAEKAVNDLNNRWFGGRPVYAEL 71
          F   E+A KAV ++N R  GG+P+Y  L
Sbjct: 49 FSSPEEATKAVTEMNGRIIGGKPLYVAL 76


>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila
          sex-lethal (SXL) and similar proteins.  This subfamily
          corresponds to the RRM2 of the sex-lethal protein (SXL)
          which governs sexual differentiation and X chromosome
          dosage compensation in Drosophila melanogaster. It
          induces female-specific alternative splicing of the
          transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds also to its own
          pre-mRNA and promotes female-specific alternative
          splicing. SXL contains an N-terminal Gly/Asn-rich
          domain that may be responsible for the protein-protein
          interaction, and tandem RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 79

 Score = 30.2 bits (68), Expect = 0.071
 Identities = 14/57 (24%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 10 EDVFVECEDKYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGR 65
          ED   +  + YG I + N+  D       G  ++++ + E+A+ A++ LN     G 
Sbjct: 14 EDELRKIFEAYGNIVQCNLLRDKSTGLPRGVAFVRYDKREEAQAAISSLNGTIPPGS 70


>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF
          family.  This subfamily corresponds to the RRM of
          Aly/REF family which includes THO complex subunit 4
          (THOC4, also termed Aly/REF), S6K1 Aly/REF-like target
          (SKAR, also termed PDIP3 or PDIP46) and similar
          proteins. THOC4 is an mRNA transporter protein with a
          well conserved RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). It is involved in RNA transportation from the
          nucleus, and was initially identified as a
          transcription coactivator of LEF-1 and AML-1 for the
          TCRalpha enhancer function. In addition, THOC4
          specifically binds to rhesus (RH) promoter in
          erythroid, and might be a novel transcription cofactor
          for erythroid-specific genes. SKAR shows high sequence
          homology with THOC4 and possesses one RRM as well. SKAR
          is widely expressed and localizes to the nucleus. It
          may be a critical player in the function of S6K1 in
          cell and organism growth control by binding the
          activated, hyperphosphorylated form of S6K1 but not
          S6K2. Furthermore, SKAR functions as a protein partner
          of the p50 subunit of DNA polymerase delta. In
          addition, SKAR may have particular importance in
          pancreatic beta cell size determination and insulin
          secretion. .
          Length = 75

 Score = 29.9 bits (68), Expect = 0.092
 Identities = 10/30 (33%), Positives = 15/30 (50%)

Query: 37 VGNVYIKFRREEDAEKAVNDLNNRWFGGRP 66
           G   + F + EDAE+A+   N     G+P
Sbjct: 41 EGTADVVFEKREDAERAIKQFNGVLLDGQP 70


>gnl|CDD|240732 cd12286, RRM_Man1, RNA recognition motif in inner nuclear
          membrane protein Man1 (Man1) and similar proteins.
          This subfamily corresponds to the RRM of Man1, also
          termed LEM domain-containing protein 3 (LEMD3), an
          integral protein of the inner nuclear membrane that
          binds to nuclear lamins and emerin, thus playing a role
          in nuclear organization. It is part of a protein
          complex essential for chromatin organization and cell
          division. It also functions as an important negative
          regulator for the transforming growth factor (TGF)
          beta/activin/Nodal signaling pathway by directly
          interacting with chromatin-associated proteins and
          transcriptional regulators, including the R-Smads,
          Smad1, Smad2, and Smad3. Moreover, Man1 is a unique
          type of left-right (LR) signaling regulator that acts
          on the inner nuclear membrane. Man1 plays a crucial
          role in angiogenesis. The vascular remodeling can be
          regulated at the inner nuclear membrane through the
          interaction between Man1 and Smads. Man1 contains an
          N-terminal LEM domain, two putative transmembrane
          domains, a MAN1-Src1p C-terminal (MSC) domain, and a
          C-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain).
          The LEM domain interacts with the DNA and
          chromatin-binding protein Barrier-to-Autointegration
          Factor, and is also necessary for efficient
          localization of MAN1 in the inner nuclear membrane.
          Research has indicated that C-terminal nucleoplasmic
          region of Man1 exhibits a DNA binding winged helix
          domain and is responsible for both DNA- and
          Smad-binding. .
          Length = 92

 Score = 30.0 bits (68), Expect = 0.12
 Identities = 16/33 (48%), Positives = 18/33 (54%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAE 70
          G VYIK    EDA KA   L+  WF GR V  +
Sbjct: 48 GCVYIKCSSPEDAGKAFKALHGWWFDGRLVTVK 80


>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor.  This
           model describes the sex-lethal family of splicing
           factors found in Dipteran insects. The sex-lethal
           phenotype, however, may be limited to the Melanogasters
           and closely related species. In Drosophila the protein
           acts as an inhibitor of splicing. This subfamily is most
           closely related to the ELAV/HUD subfamily of splicing
           factors (TIGR01661).
          Length = 346

 Score = 30.8 bits (69), Expect = 0.15
 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 19  KYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNN 59
           KYG+I + N+  D L     G  +++F + E+A++A++ LNN
Sbjct: 216 KYGQIVQKNILRDKLTGTPRGVAFVRFNKREEAQEAISALNN 257


>gnl|CDD|240810 cd12364, RRM_RDM1, RNA recognition motif of RAD52
          motif-containing protein 1 (RDM1) and similar proteins.
           This subfamily corresponds to the RRM of RDM1, also
          termed RAD52 homolog B, a novel factor involved in the
          cellular response to the anti-cancer drug cisplatin in
          vertebrates. RDM1 contains a small RD motif that shares
          with the recombination and repair protein RAD52, and an
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). The
          RD motif is responsible for the acidic pH-dependent
          DNA-binding properties of RDM1. It interacts with ss-
          and dsDNA, and may act as a DNA-damage recognition
          factor by recognizing the distortions of the double
          helix caused by cisplatin-DNA adducts in vitro. In
          addition, due to the presence of RRM, RDM1 can bind to
          RNA as well as DNA. .
          Length = 81

 Score = 29.3 bits (66), Expect = 0.16
 Identities = 13/52 (25%), Positives = 21/52 (40%), Gaps = 4/52 (7%)

Query: 19 KYGEIEEMNVCDNLGDHLVGNVY--IKFRREEDAEKAVNDLNNRW-FGGRPV 67
          ++G +  + V  N         Y  +KF     A +A    N +W F G P+
Sbjct: 27 QFGLLYSVKVFPNAA-VATPGFYAFVKFYSARAASRAQKACNGKWLFQGSPL 77


>gnl|CDD|240878 cd12432, RRM_ACINU, RNA recognition motif in apoptotic chromatin
          condensation inducer in the nucleus (acinus) and
          similar proteins.  This subfamily corresponds to the
          RRM of Acinus, a caspase-3-activated nuclear factor
          that induces apoptotic chromatin condensation after
          cleavage by caspase-3 without inducing DNA
          fragmentation. It is essential for apoptotic chromatin
          condensation and may also participate in nuclear
          structural changes occurring in normal cells. Acinus
          contains a P-loop motif and an RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), which indicates Acinus
          might have ATPase and DNA/RNA-binding activity. .
          Length = 90

 Score = 29.5 bits (67), Expect = 0.16
 Identities = 8/43 (18%), Positives = 17/43 (39%), Gaps = 3/43 (6%)

Query: 41 YIKFRREEDAEKAVNDLNN-RW--FGGRPVYAELSPVTDFREA 80
          Y+ +   E+A      L+  +W     + +  +  P  +  EA
Sbjct: 43 YVTYSTVEEAVATREALHGLQWPSSNPKRLKVDFVPQEELEEA 85


>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of
          rDNA transcription protein 5 (RRT5) and similar
          proteins.  This subfamily corresponds to the RRM1 of
          the lineage specific family containing a group of
          uncharacterized yeast regulators of rDNA transcription
          protein 5 (RRT5), which may play roles in the
          modulation of rDNA transcription. RRT5 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 84

 Score = 29.7 bits (67), Expect = 0.16
 Identities = 13/28 (46%), Positives = 15/28 (53%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGR 65
          G  Y +F   E AEK V DLN + F  R
Sbjct: 47 GIAYAEFSSPEQAEKVVKDLNGKVFKNR 74


>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in
          RRM-containing coactivator activator/modulator (CoAA)
          and similar proteins.  This subfamily corresponds to
          the RRM in CoAA (also known as RBM14 or PSP2) and
          RNA-binding protein 4 (RBM4). CoAA is a heterogeneous
          nuclear ribonucleoprotein (hnRNP)-like protein
          identified as a nuclear receptor coactivator. It
          mediates transcriptional coactivation and RNA splicing
          effects in a promoter-preferential manner, and is
          enhanced by thyroid hormone receptor-binding protein
          (TRBP). CoAA contains two N-terminal RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a
          TRBP-interacting domain. RBM4 is a ubiquitously
          expressed splicing factor with two isoforms, RBM4A
          (also known as Lark homolog) and RBM4B (also known as
          RBM30), which are very similar in structure and
          sequence. RBM4 may also function as a translational
          regulator of stress-associated mRNAs as well as play a
          role in micro-RNA-mediated gene regulation. RBM4
          contains two N-terminal RRMs, a CCHC-type zinc finger,
          and three alanine-rich regions within their C-terminal
          regions. This family also includes Drosophila
          RNA-binding protein lark (Dlark), a homolog of human
          RBM4. It plays an important role in embryonic
          development and in the circadian regulation of adult
          eclosion. Dlark shares high sequence similarity with
          RBM4 at the N-terminal region. However, Dlark has three
          proline-rich segments instead of three alanine-rich
          segments within the C-terminal region. .
          Length = 66

 Score = 29.1 bits (66), Expect = 0.17
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 7/52 (13%)

Query: 19 KYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAE 70
          KYG + E +V  N G       ++    EEDAE A+  LN   F G+ +  E
Sbjct: 22 KYGTVTECDVVKNYG-------FVHMEEEEDAEDAIKALNGYEFMGKRINVE 66


>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple
          RNA-binding domain-containing protein 1 (MRD1) and
          similar proteins.  This subgroup corresponds to the
          RRM2 of MRD1 which is encoded by a novel yeast gene
          MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which may play an important structural role
          in organizing specific rRNA processing events. .
          Length = 79

 Score = 29.3 bits (66), Expect = 0.20
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 19 KYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGR 65
          K+GE+ E++V  D       G  Y+ F   EDA KA  +L+ + F GR
Sbjct: 25 KFGELSEVHVAIDKKSGKSKGFAYVLFLDPEDAVKAYKELDGKVFQGR 72


>gnl|CDD|240795 cd12349, RRM2_SHARP, RNA recognition motif 2 in
          SMART/HDAC1-associated repressor protein (SHARP) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of SHARP, also termed Msx2-interacting protein
          (MINT), or SPEN homolog, an estrogen-inducible
          transcriptional repressor that interacts directly with
          the nuclear receptor corepressor SMRT, histone
          deacetylases (HDACs) and components of the NuRD
          complex. SHARP recruits HDAC activity and binds to the
          steroid receptor RNA coactivator SRA through four
          conserved N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), further suppressing
          SRA-potentiated steroid receptor transcription
          activity. Thus, SHARP has the capacity to modulate both
          liganded and nonliganded nuclear receptors. SHARP also
          has been identified as a component of transcriptional
          repression complexes in Notch/RBP-Jkappa signaling
          pathways. In addition to the N-terminal RRMs, SHARP
          possesses a C-terminal SPOC domain (Spen paralog and
          ortholog C-terminal domain), which is highly conserved
          among Spen proteins. .
          Length = 74

 Score = 28.8 bits (65), Expect = 0.21
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 42 IKFRREEDAEKAVNDLNNRWFGGRPV 67
          + FR+ EDAEKA+     + F G  +
Sbjct: 46 VFFRKPEDAEKALEVSKGKLFFGAEI 71


>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like
          target (SKAR) and similar proteins.  This subgroup
          corresponds to the RRM of SKAR, also termed polymerase
          delta-interacting protein 3 (PDIP3), 46 kDa DNA
          polymerase delta interaction protein (PDIP46),
          belonging to the Aly/REF family of RNA binding proteins
          that have been implicated in coupling transcription
          with pre-mRNA splicing and nucleo-cytoplasmic mRNA
          transport. SKAR is widely expressed and localizes to
          the nucleus. It may be a critical player in the
          function of S6K1 in cell and organism growth control by
          binding the activated, hyperphosphorylated form of S6K1
          but not S6K2. Furthermore, SKAR functions as a protein
          partner of the p50 subunit of DNA polymerase delta. In
          addition, SKAR may have particular importance in
          pancreatic beta cell size determination and insulin
          secretion. SKAR contains a well conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain).
          Length = 69

 Score = 28.8 bits (65), Expect = 0.25
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 44 FRREEDAEKAVNDLNNRWFGGRPVYAEL 71
          + R++DA  A++  NNR   G+P+  +L
Sbjct: 42 YVRKDDALTAIDKYNNRELDGQPMKCKL 69


>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous
          nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA
          recognition motif 1 (hRBMY), testis-specific
          heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T)
          and similar proteins.  This subfamily corresponds to
          the RRM domain of hnRNP G, also termed glycoprotein p43
          or RBMX, an RNA-binding motif protein located on the X
          chromosome. It is expressed ubiquitously and has been
          implicated in the splicing control of several
          pre-mRNAs. Moreover, hnRNP G may function as a
          regulator of transcription for SREBP-1c and GnRH1.
          Research has shown that hnRNP G may also act as a
          tumor-suppressor since it upregulates the Txnip gene
          and promotes the fidelity of DNA end-joining activity.
          In addition, hnRNP G appears to play a critical role in
          proper neural development of zebrafish and frog
          embryos. The family also includes several paralogs of
          hnRNP G, such as hRBMY and hnRNP G-T (also termed
          RNA-binding motif protein, X-linked-like-2). Both,
          hRBMY and hnRNP G-T, are exclusively expressed in
          testis and critical for male fertility. Like hnRNP G,
          hRBMY and hnRNP G-T interact with factors implicated in
          the regulation of pre-mRNA splicing, such as
          hTra2-beta1 and T-STAR. Although members in this family
          share a high conserved N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), they appear to recognize
          different RNA targets. For instance, hRBMY interacts
          specifically with a stem-loop structure in which the
          loop is formed by the sequence CA/UCAA. In contrast,
          hnRNP G associates with single stranded RNA sequences
          containing a CCA/C motif. In addition to the RRM, hnRNP
          G contains a nascent transcripts targeting domain (NTD)
          in the middle region and a novel auxiliary RNA-binding
          domain (RBD) in its C-terminal region. The C-terminal
          RBD exhibits distinct RNA binding specificity, and
          would play a critical role in the regulation of
          alternative splicing by hnRNP G. .
          Length = 80

 Score = 28.7 bits (65), Expect = 0.29
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 5/62 (8%)

Query: 10 EDVFVECEDKYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVY 68
          E +F     K+G +EE+ +  D       G  ++ F   EDA+ A+ DLN +   GR + 
Sbjct: 19 EALF----SKFGRVEEVLLMKDPETGESRGFGFVTFESVEDADAAIRDLNGKELEGRVIK 74

Query: 69 AE 70
           E
Sbjct: 75 VE 76


>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate
          Hu-antigen B (HuB).  This subgroup corresponds to the
          RRM1 of HuB, also termed ELAV-like protein 2 (ELAV-2),
          or ELAV-like neuronal protein 1, or nervous
          system-specific RNA-binding protein Hel-N1 (Hel-N1),
          one of the neuronal members of the Hu family. The
          neuronal Hu proteins play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads and is up-regulated during neuronal
          differentiation of embryonic carcinoma P19 cells. Like
          other Hu proteins, HuB contains three RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an AU-rich RNA element (ARE).
          RRM3 may help to maintain the stability of the
          RNA-protein complex, and might also bind to poly(A)
          tails or be involved in protein-protein interactions. .
          Length = 83

 Score = 28.9 bits (64), Expect = 0.29
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 15 ECEDKYGEIEEMNVCDNLGDHLVGNV----YIKFRREEDAEKAVNDLN 58
          E +  +G I E+  C  + D + G      ++ +   +DAEKA+N LN
Sbjct: 20 ELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLN 67


>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1
          isoform p40 (p40-TIA-1) and similar proteins.  This
          subgroup corresponds to the RRM2 of p40-TIA-1, the
          40-kDa isoform of T-cell-restricted intracellular
          antigen-1 (TIA-1), and a cytotoxic granule-associated
          RNA-binding protein mainly found in the granules of
          cytotoxic lymphocytes. TIA-1 can be phosphorylated by a
          serine/threonine kinase that is activated during
          Fas-mediated apoptosis, and function as the granule
          component responsible for inducing apoptosis in
          cytolytic lymphocyte (CTL) targets. It is composed of
          three N-terminal highly homologous RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a
          glutamine-rich C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 interacts with RNAs
          containing short stretches of uridylates and its RRM2
          can mediate the specific binding to uridylate-rich
          RNAs. .
          Length = 80

 Score = 28.9 bits (64), Expect = 0.31
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          G  ++ F  + DAE A+  +  +W GGR +
Sbjct: 44 GYGFVSFFNKWDAENAIQQMGGQWLGGRQI 73


>gnl|CDD|177566 PHA03242, PHA03242, envelope glycoprotein M; Provisional.
          Length = 428

 Score = 29.8 bits (67), Expect = 0.33
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 4/45 (8%)

Query: 81  CCRQYEMGECTRSGFCNFMHLKPISRELRRYLYSRRKRSSRRSSR 125
             R Y      RS F  + H++      R Y+  RR RSS R+SR
Sbjct: 344 LVRAYLYHRRHRSRF--YGHVRDARHRARSYI--RRVRSSMRNSR 384


>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein
          with serine-rich domain 1 (RNPS1) and similar proteins.
           This subfamily corresponds to the RRM of RNPS1 and its
          eukaryotic homologs. RNPS1, also termed RNA-binding
          protein prevalent during the S phase, or SR-related
          protein LDC2, was originally characterized as a general
          pre-mRNA splicing activator, which activates both
          constitutive and alternative splicing of pre-mRNA in
          vitro.It has been identified as a protein component of
          the splicing-dependent mRNP complex, or exon-exon
          junction complex (EJC), and is directly involved in
          mRNA surveillance. Furthermore, RNPS1 is a splicing
          regulator whose activator function is controlled in
          part by CK2 (casein kinase II) protein kinase
          phosphorylation. It can also function as a
          squamous-cell carcinoma antigen recognized by T cells-3
          (SART3)-binding protein, and is involved in the
          regulation of mRNA splicing. RNPS1 contains an
          N-terminal serine-rich (S) domain, a central RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and the
          C-terminal arginine/serine/proline-rich (RS/P) domain.
          .
          Length = 73

 Score = 28.3 bits (64), Expect = 0.36
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 20 YGEIEEMNVCDNLGDHL-VGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAE 70
          YG ++++++  +   +L  G  Y++F   EDAEKA+  ++     G+ V  E
Sbjct: 22 YGTVKDVDLPIDREVNLPRGYAYVEFESPEDAEKAIKHMDGGQIDGQEVTVE 73


>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM3 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 82

 Score = 28.3 bits (64), Expect = 0.37
 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 19 KYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGG 64
          ++GE++   +  D L  H  G  ++KF+ +E A+K +   +N    G
Sbjct: 23 QFGEVKYARIVKDKLTGHSKGTAFVKFKTKESAQKCLEAADNAEDSG 69


>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell
          carcinoma antigen recognized by T-cells 3 (SART3) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of SART3, also termed Tat-interacting protein of
          110 kDa (Tip110), is an RNA-binding protein expressed
          in the nucleus of the majority of proliferating cells,
          including normal cells and malignant cells, but not in
          normal tissues except for the testes and fetal liver.
          It is involved in the regulation of mRNA splicing
          probably via its complex formation with RNA-binding
          protein with a serine-rich domain (RNPS1), a
          pre-mRNA-splicing factor. SART3 has also been
          identified as a nuclear Tat-interacting protein that
          regulates Tat transactivation activity through direct
          interaction and functions as an important cellular
          factor for HIV-1 gene expression and viral replication.
          In addition, SART3 is required for U6 snRNP targeting
          to Cajal bodies. It binds specifically and directly to
          the U6 snRNA, interacts transiently with the U6 and
          U4/U6 snRNPs, and promotes the reassembly of U4/U6
          snRNPs after splicing in vitro. SART3 contains an
          N-terminal half-a-tetratricopeptide repeat (HAT)-rich
          domain, a nuclearlocalization signal (NLS) domain, and
          two C-terminal RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 81

 Score = 28.1 bits (63), Expect = 0.43
 Identities = 12/63 (19%), Positives = 27/63 (42%), Gaps = 4/63 (6%)

Query: 10 EDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYA 69
          E +F     K+G ++ + +  N      G  Y+++  E  A +AV  ++      + +  
Sbjct: 20 EKLF----KKHGVVKSVRLVTNRSGKPKGLAYVEYENESSASQAVLKMDGTEIKEKTISV 75

Query: 70 ELS 72
           +S
Sbjct: 76 AIS 78


>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate
          RRM-containing coactivator activator/modulator (CoAA). 
          This subgroup corresponds to the RRM1 of CoAA, also
          termed RNA-binding protein 14 (RBM14), or paraspeckle
          protein 2 (PSP2), or synaptotagmin-interacting protein
          (SYT-interacting protein), a heterogeneous nuclear
          ribonucleoprotein (hnRNP)-like protein identified as a
          nuclear receptor coactivator. It mediates
          transcriptional coactivation and RNA splicing effects
          in a promoter-preferential manner and is enhanced by
          thyroid hormone receptor-binding protein (TRBP). CoAA
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a TRBP-interacting
          domain. It stimulates transcription through its
          interactions with coactivators, such as TRBP and
          CREB-binding protein CBP/p300, via the TRBP-interacting
          domain and interaction with an RNA-containing complex,
          such as DNA-dependent protein kinase-poly(ADP-ribose)
          polymerase complexes, via the RRMs. .
          Length = 69

 Score = 27.9 bits (62), Expect = 0.48
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPVYAELS 72
          ++  R E  A++A+ +LN R   GR +  E S
Sbjct: 38 FVHLRGEAAADRAIEELNGRELHGRKLVVEHS 69


>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate
          RRM-containing coactivator activator/modulator (CoAA). 
          This subgroup corresponds to the RRM2 of CoAA, also
          termed RNA-binding protein 14 (RBM14), or paraspeckle
          protein 2 (PSP2), or synaptotagmin-interacting protein
          (SYT-interacting protein), a heterogeneous nuclear
          ribonucleoprotein (hnRNP)-like protein identified as a
          nuclear receptor coactivator. It mediates
          transcriptional coactivation and RNA splicing effects
          in a promoter-preferential manner and is enhanced by
          thyroid hormone receptor-binding protein (TRBP). CoAA
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a TRBP-interacting
          domain. It stimulates transcription through its
          interactions with coactivators, such as TRBP and
          CREB-binding protein CBP/p300, via the TRBP-interacting
          domain and interaction with an RNA-containing complex,
          such as DNA-dependent protein kinase-poly(ADP-ribose)
          polymerase complexes, via the RRMs. .
          Length = 68

 Score = 27.9 bits (62), Expect = 0.49
 Identities = 12/38 (31%), Positives = 19/38 (50%)

Query: 34 DHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAEL 71
          D +    ++   REE+A  A+  LN +   GR +  EL
Sbjct: 31 DKVKDYAFVHMEREEEALAAIEALNGKEVKGRRINVEL 68


>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage
          stimulation factor subunit 2 (CSTF2), yeast ortholog
          mRNA 3'-end-processing protein RNA15 and similar
          proteins.  This subfamily corresponds to the RRM domain
          of CSTF2, its tau variant and eukaryotic homologs.
          CSTF2, also termed cleavage stimulation factor 64 kDa
          subunit (CstF64), is the vertebrate conterpart of yeast
          mRNA 3'-end-processing protein RNA15. It is expressed
          in all somatic tissues and is one of three cleavage
          stimulatory factor (CstF) subunits required for
          polyadenylation. CstF64 contains an N-terminal RNA
          recognition motif (RRM), also known as RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), a
          CstF77-binding domain, a repeated MEARA helical region
          and a conserved C-terminal domain reported to bind the
          transcription factor PC-4. During polyadenylation, CstF
          interacts with the pre-mRNA through the RRM of CstF64
          at U- or GU-rich sequences within 10 to 30 nucleotides
          downstream of the cleavage site. CSTF2T, also termed
          tauCstF64, is a paralog of the X-linked cleavage
          stimulation factor CstF64 protein that supports
          polyadenylation in most somatic cells. It is expressed
          during meiosis and subsequent haploid differentiation
          in a more limited set of tissues and cell types,
          largely in meiotic and postmeiotic male germ cells, and
          to a lesser extent in brain. The loss of CSTF2T will
          cause male infertility, as it is necessary for
          spermatogenesis and fertilization. Moreover, CSTF2T is
          required for expression of genes involved in
          morphological differentiation of spermatids, as well as
          for genes having products that function during
          interaction of motile spermatozoa with eggs. It
          promotes germ cell-specific patterns of polyadenylation
          by using its RRM to bind to different sequence elements
          downstream of polyadenylation sites than does CstF64.
          The family also includes yeast ortholog mRNA
          3'-end-processing protein RNA15 and similar proteins.
          RNA15 is a core subunit of cleavage factor IA (CFIA),
          an essential transcriptional 3'-end processing factor
          from Saccharomyces cerevisiae. RNA recognition by CFIA
          is mediated by an N-terminal RRM, which is contained in
          the RNA15 subunit of the complex. The RRM of RNA15 has
          a strong preference for GU-rich RNAs, mediated by a
          binding pocket that is entirely conserved in both yeast
          and vertebrate RNA15 orthologs.
          Length = 75

 Score = 28.0 bits (63), Expect = 0.50
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRP 66
          + +F   E A  A+ +LN   F GR 
Sbjct: 44 FCEFEDIETAASAIRNLNGYEFNGRA 69


>gnl|CDD|241101 cd12657, RRM1_hnRNPM, RNA recognition motif 1 in vertebrate
          heterogeneous nuclear ribonucleoprotein M (hnRNP M).
          This subgroup corresponds to the RRM1 of hnRNP M, a
          pre-mRNA binding protein that may play an important
          role in the pre-mRNA processing. It also preferentially
          binds to poly(G) and poly(U) RNA homopolymers.
          Moreover, hnRNP M is able to interact with early
          spliceosomes, further influencing splicing patterns of
          specific pre-mRNAs. hnRNP M functions as the receptor
          of carcinoembryonic antigen (CEA) that contains the
          penta-peptide sequence PELPK signaling motif. In
          addition, hnRNP M and another splicing factor Nova-1
          work together as dopamine D2 receptor (D2R)
          pre-mRNA-binding proteins. They regulate alternative
          splicing of D2R pre-mRNA in an antagonistic manner.
          hnRNP M contains three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an unusual
          hexapeptide-repeat region rich in methionine and
          arginine residues (MR repeat motif). .
          Length = 76

 Score = 28.1 bits (62), Expect = 0.53
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          G   ++F+ EE  +KAV  LN     GRP+
Sbjct: 42 GCAVVEFKMEESMKKAVEVLNKHVLNGRPL 71


>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q
           family.  Sequences in this subfamily include the human
           heterogeneous nuclear ribonucleoproteins (hnRNP) R , Q
           and APOBEC-1 complementation factor (aka APOBEC-1
           stimulating protein). These proteins contain three RNA
           recognition domains (rrm: pfam00076) and a somewhat
           variable C-terminal domain.
          Length = 578

 Score = 29.2 bits (65), Expect = 0.57
 Identities = 16/53 (30%), Positives = 28/53 (52%)

Query: 7   NFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNN 59
           + +ED  V   +K G I E+ +  +      G  ++ F  +E+A++AV  LNN
Sbjct: 69  DLYEDELVPLFEKAGPIYELRLMMDFSGQNRGYAFVTFCGKEEAKEAVKLLNN 121


>gnl|CDD|240885 cd12439, RRM_TRMT2A, RNA recognition motif in tRNA
          (uracil-5-)-methyltransferase homolog A (TRMT2A) and
          similar proteins.  This subfamily corresponds to the
          RRM of TRMT2A, also known as HpaII tiny fragments locus
          9c protein (HTF9C), a novel cell cycle regulated
          protein. It is an independent biologic factor expressed
          in tumors associated with clinical outcome in HER2
          expressing breast cancer. The function of TRMT2A
          remains unclear although by sequence homology it has a
          RNA recognition motif (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain),
          related to RNA methyltransferases. .
          Length = 79

 Score = 28.0 bits (63), Expect = 0.57
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 40 VYIKFRREEDAEKAVNDLNNRWFGGRPVYAELS 72
           ++ FR EE+ +KA+  L+   + GR + A L+
Sbjct: 45 AFVTFRSEEERQKALEILDGFKWKGRVLSARLA 77


>gnl|CDD|240785 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 2 in
          serine/arginine-rich splicing factor SRSF1, SRSF4 and
          similar proteins.  This subfamily corresponds to the
          RRM2 of several serine/arginine (SR) proteins that have
          been classified into two subgroups. The first subgroup
          consists of serine/arginine-rich splicing factor 4
          (SRSF4 or SRp75 or SFRS4), serine/arginine-rich
          splicing factor 5 (SRSF5 or SRp40 or SFRS5 or HRS) and
          serine/arginine-rich splicing factor 6 (SRSF6 or
          SRp55). The second subgroup is composed of
          serine/arginine-rich splicing factor 1 (SRSF1 or
          ASF-1), serine/arginine-rich splicing factor 9 (SRSF9
          or SRp30C) and plant pre-mRNA-splicing factor SF2
          (SR1). These SR proteins are mainly involved in
          regulating constitutive and alternative pre-mRNA
          splicing. They also have been implicated in
          transcription, genomic stability, mRNA export and
          translation. All SR proteins in this family, except
          SRSF5, undergo nucleocytoplasmic shuttling, suggesting
          their widespread roles in gene expression. These SR
          proteins share a common domain architecture comprising
          two N-terminal RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), followed by a C-terminal
          RS domains rich in serine-arginine dipeptides. Both
          domains can directly contact with RNA. The RRMs appear
          to determine the binding specificity and the SR domain
          also mediates protein-protein interactions. In
          addition, this subfamily includes the yeast nucleolar
          protein 3 (Npl3p), also termed mitochondrial targeting
          suppressor 1 protein, or nuclear polyadenylated
          RNA-binding protein 1. It is a major yeast RNA-binding
          protein that competes with 3'-end processing factors,
          such as Rna15, for binding to the nascent RNA,
          protecting the transcript from premature termination
          and coordinating transcription termination and the
          packaging of the fully processed transcript for export.
          It specifically recognizes a class of G/U-rich RNAs.
          Npl3p is a multi-domain protein with two RRMs,
          separated by a short linker and a C-terminal domain
          rich in glycine, arginine and serine residues. .
          Length = 71

 Score = 27.6 bits (62), Expect = 0.58
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 42 IKFRREEDAEKAVNDLNNRWFGGRPV 67
          ++F  +ED E+A+  L+   F GR V
Sbjct: 42 VEFTSQEDMERALRKLDGTEFRGRRV 67


>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in
          RNA-binding protein 19 (RBM19) and RNA recognition
          motif 3 in multiple RNA-binding domain-containing
          protein 1 (MRD1).  This subfamily corresponds to the
          RRM4 of RBM19 and the RRM3 of MRD1. RBM19, also termed
          RNA-binding domain-1 (RBD-1), is a nucleolar protein
          conserved in eukaryotes involved in ribosome biogenesis
          by processing rRNA and is essential for preimplantation
          development. It has a unique domain organization
          containing 6 conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). MRD1 is encoded by a novel
          yeast gene MRD1 (multiple RNA-binding domain). It is
          well conserved in yeast and its homologues exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). MRD1
          is essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RRMs, which may play an important structural
          role in organizing specific rRNA processing events. .
          Length = 72

 Score = 27.6 bits (62), Expect = 0.60
 Identities = 11/32 (34%), Positives = 16/32 (50%)

Query: 42 IKFRREEDAEKAVNDLNNRWFGGRPVYAELSP 73
          ++F    DA KA   L  + F   P+Y E +P
Sbjct: 41 VEFLEPSDARKAFKSLAYKRFKHVPLYLEWAP 72


>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in
          polypyrimidine tract-binding protein 1 (PTB or hnRNP
          I), heterogeneous nuclear ribonucleoprotein L
          (hnRNP-L), and similar proteins.  This subfamily
          corresponds to the RRM2 of polypyrimidine tract-binding
          protein 1 (PTB or hnRNP I), polypyrimidine
          tract-binding protein 2 (PTBP2 or nPTB), regulator of
          differentiation 1 (Rod1), heterogeneous nuclear
          ribonucleoprotein L (hnRNP-L), heterogeneous nuclear
          ribonucleoprotein L-like (hnRNP-LL), polypyrimidine
          tract-binding protein homolog 3 (PTBPH3),
          polypyrimidine tract-binding protein homolog 1 and 2
          (PTBPH1 and PTBPH2), and similar proteins, and RRM3 of
          PTBPH1 and PTBPH2. PTB is an important negative
          regulator of alternative splicing in mammalian cells
          and also functions at several other aspects of mRNA
          metabolism, including mRNA localization, stabilization,
          polyadenylation, and translation. PTBP2 is highly
          homologous to PTB and is perhaps specific to the
          vertebrates. Unlike PTB, PTBP2 is enriched in the brain
          and in some neural cell lines. It binds more stably to
          the downstream control sequence (DCS) RNA than PTB does
          but is a weaker repressor of splicing in vitro. PTBP2
          also greatly enhances the binding of two other
          proteins, heterogeneous nuclear ribonucleoprotein
          (hnRNP) H and KH-type splicing-regulatory protein
          (KSRP), to the DCS RNA. The binding properties of PTBP2
          and its reduced inhibitory activity on splicing imply
          roles in controlling the assembly of other
          splicing-regulatory proteins. Rod1 is a mammalian
          polypyrimidine tract binding protein (PTB) homolog of a
          regulator of differentiation in the fission yeast
          Schizosaccharomyces pombe, where the nrd1 gene encodes
          an RNA binding protein negatively regulates the onset
          of differentiation. ROD1 is predominantly expressed in
          hematopoietic cells or organs. It might play a role
          controlling differentiation in mammals. hnRNP-L is a
          higher eukaryotic specific subunit of human KMT3a (also
          known as HYPB or hSet2) complex required for histone H3
          Lys-36 trimethylation activity. It plays both, nuclear
          and cytoplasmic, roles in mRNA export of intronless
          genes, IRES-mediated translation, mRNA stability, and
          splicing. hnRNP-LL protein plays a critical and unique
          role in the signal-induced regulation of CD45 and acts
          as a global regulator of alternative splicing in
          activated T cells. This family also includes
          polypyrimidine tract binding protein homolog 3 (PTBPH3)
          found in plant. Although its biological roles remain
          unclear, PTBPH3 shows significant sequence similarity
          to other family members, all of which contain four RNA
          recognition motifs (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain).
          Although their biological roles remain unclear, both
          PTBPH1 and PTBPH2 show significant sequence similarity
          to PTB. However, in contrast to PTB, they have three
          RRMs. .
          Length = 85

 Score = 27.9 bits (63), Expect = 0.66
 Identities = 11/43 (25%), Positives = 18/43 (41%), Gaps = 3/43 (6%)

Query: 18 DKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNR 60
            YG +E++ +       +     ++F   E AE A   LN R
Sbjct: 23 SPYGAVEKI-LIFEKNTGV--QALVQFDSVESAENAKKALNGR 62


>gnl|CDD|220003 pfam08752, Gamma-COP, Coatomer gamma subunit appendage domain.
           COPI-coated vesicles function in retrograde transport
           from the Golgi to the ER, and in intra-Golgi transport.
           This domain corresponds to the coatomer gamma subunit
           appendage domain. It contains a protein-protein
           interaction site and a second proposed binding site that
           interacts with the alpha, beta,epsilon COPI subcomplex.
          Length = 269

 Score = 28.8 bits (65), Expect = 0.69
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 9   FEDVFVECEDKYGEIEEMNV--CDNLGDHLVGNVYIKFRREEDAE 51
            E+V VE E    E EE+ +   D L  +  G+VY+   + E  +
Sbjct: 65  LENVSVELEPSEEEYEELFIIPIDKLPYNQPGSVYVLLEKPEGED 109


>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene
          single-strand binding proteins (MSSP) family.  This
          subfamily corresponds to the RRM1 of c-myc gene
          single-strand binding proteins (MSSP) family, including
          single-stranded DNA-binding protein MSSP-1 (also termed
          RBMS1 or SCR2) and MSSP-2 (also termed RBMS2 or SCR3).
          All MSSP family members contain two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), both of which are
          responsible for the specific DNA binding activity.
          Both, MSSP-1 and -2, have been identified as protein
          factors binding to a putative DNA replication
          origin/transcriptional enhancer sequence present
          upstream from the human c-myc gene in both single- and
          double-stranded forms. Thus, they have been implied in
          regulating DNA replication, transcription, apoptosis
          induction, and cell-cycle movement, via the interaction
          with c-MYC, the product of protooncogene c-myc.
          Moreover, the family includes a new member termed
          RNA-binding motif, single-stranded-interacting protein
          3 (RBMS3), which is not a transcriptional regulator.
          RBMS3 binds with high affinity to A/U-rich stretches of
          RNA, and to A/T-rich DNA sequences, and functions as a
          regulator of cytoplasmic activity. In addition, a
          putative meiosis-specific RNA-binding protein termed
          sporulation-specific protein 5 (SPO5, or meiotic
          RNA-binding protein 1, or meiotically up-regulated gene
          12 protein), encoded by Schizosaccharomyces pombe
          Spo5/Mug12 gene, is also included in this family. SPO5
          is a novel meiosis I regulator that may function in the
          vicinity of the Mei2 dot. .
          Length = 71

 Score = 27.6 bits (62), Expect = 0.71
 Identities = 11/43 (25%), Positives = 18/43 (41%), Gaps = 1/43 (2%)

Query: 19 KYGEIEEMNVCDNLGDHLV-GNVYIKFRREEDAEKAVNDLNNR 60
           +G+I       +   +   G  ++ F   E A KA+  LN R
Sbjct: 23 PFGKIISTKAILDKKTNKCKGYGFVDFDSPEAALKAIEGLNGR 65


>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR
          and similar proteins.  This subgroup corresponds to the
          RRM2 of nucleolysin TIAR, also termed TIA-1-related
          protein, a cytotoxic granule-associated RNA-binding
          protein that shows high sequence similarity with 40-kDa
          isoform of T-cell-restricted intracellular antigen-1
          (p40-TIA-1). TIAR is mainly localized in the nucleus of
          hematopoietic and nonhematopoietic cells. It is
          translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. TIAR
          possesses nucleolytic activity against cytolytic
          lymphocyte (CTL) target cells. It can trigger DNA
          fragmentation in permeabilized thymocytes, and thus may
          function as an effector responsible for inducing
          apoptosis. TIAR is composed of three N-terminal, highly
          homologous RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a glutamine-rich C-terminal auxiliary
          domain containing a lysosome-targeting motif. It
          interacts with RNAs containing short stretches of
          uridylates and its RRM2 can mediate the specific
          binding to uridylate-rich RNAs. .
          Length = 80

 Score = 27.7 bits (61), Expect = 0.74
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          G  ++ F  + DAE A+  +  +W GGR +
Sbjct: 44 GYGFVSFYNKLDAENAIVHMGGQWLGGRQI 73


>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate
          Hu-antigen D (HuD).  This subgroup corresponds to the
          RRM1 of HuD, also termed ELAV-like protein 4 (ELAV-4),
          or paraneoplastic encephalomyelitis antigen HuD, one of
          the neuronal members of the Hu family. The neuronal Hu
          proteins play important roles in neuronal
          differentiation, plasticity and memory. HuD has been
          implicated in various aspects of neuronal function,
          such as the commitment and differentiation of neuronal
          precursors as well as synaptic remodeling in mature
          neurons. HuD also functions as an important regulator
          of mRNA expression in neurons by interacting with
          AU-rich RNA element (ARE) and stabilizing multiple
          transcripts. Moreover, HuD regulates the nuclear
          processing/stability of N-myc pre-mRNA in neuroblastoma
          cells, as well as the neurite elongation and
          morphological differentiation. HuD specifically binds
          poly(A) RNA. Like other Hu proteins, HuD contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. .
          Length = 83

 Score = 27.8 bits (61), Expect = 0.76
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 4/43 (9%)

Query: 20 YGEIEEMNVCDNLGDHLVGNV----YIKFRREEDAEKAVNDLN 58
          +G I E+  C  + D + G      ++ +   +DAEKA+N LN
Sbjct: 23 FGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLN 65


>gnl|CDD|225494 COG2943, MdoH, Membrane glycosyltransferase [Cell envelope
           biogenesis, outer membrane].
          Length = 736

 Score = 29.0 bits (65), Expect = 0.81
 Identities = 18/70 (25%), Positives = 27/70 (38%), Gaps = 15/70 (21%)

Query: 3   EHYDNFF------EDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVN- 55
           EH+D F        D+ +  +  +       +C  LG    GN++ + RR     KA N 
Sbjct: 178 EHFDFFVLSDSRDPDIALAEQKAW-----AELCRELGGE--GNIFYRRRRRNVKRKAGNI 230

Query: 56  -DLNNRWFGG 64
            D   RW   
Sbjct: 231 ADFCRRWGSA 240


>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate
          nucleolin.  This subfamily corresponds to the RRM3 of
          ubiquitously expressed protein nucleolin, also termed
          protein C23, is a multifunctional major nucleolar
          phosphoprotein that has been implicated in various
          metabolic processes, such as ribosome biogenesis,
          cytokinesis, nucleogenesis, cell proliferation and
          growth, cytoplasmic-nucleolar transport of ribosomal
          components, transcriptional repression, replication,
          signal transduction, inducing chromatin decondensation,
          etc. Nucleolin exhibits intrinsic self-cleaving, DNA
          helicase, RNA helicase and DNA-dependent ATPase
          activities. It can be phosphorylated by many protein
          kinases, such as the major mitotic kinase Cdc2, casein
          kinase 2 (CK2), and protein kinase C-zeta. Nucleolin
          shares similar domain architecture with gar2 from
          Schizosaccharomyces pombe and NSR1 from Saccharomyces
          cerevisiae. The highly phosphorylated N-terminal domain
          of nucleolin is made up of highly acidic regions
          separated from each other by basic sequences, and
          contains multiple phosphorylation sites. The central
          domain of nucleolin contains four closely adjacent
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which suggests that nucleolin is potentially
          able to interact with multiple RNA targets. The
          C-terminal RGG (or GAR) domain of nucleolin is rich in
          glycine, arginine and phenylalanine residues, and
          contains high levels of NG,NG-dimethylarginines. .
          Length = 72

 Score = 27.2 bits (60), Expect = 0.82
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAEL 71
          G  +++F   EDA++A+N  NN    GR +  E 
Sbjct: 39 GYAFVEFESAEDAKEALNSCNNTEIEGRSIRLEF 72


>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1
          complementation factor (ACF).  This subgroup
          corresponds to the RRM3 of ACF, also termed
          APOBEC-1-stimulating protein, an RNA-binding subunit of
          a core complex that interacts with apoB mRNA to
          facilitate C to U RNA editing. It may also act as an
          apoB mRNA recognition factor and chaperone and play a
          key role in cell growth and differentiation. ACF
          shuttles between the cytoplasm and nucleus. ACF
          contains three RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), which display high
          affinity for an 11 nucleotide AU-rich mooring sequence
          3' of the edited cytidine in apoB mRNA. All three RRMs
          may be required for complementation of editing activity
          in living cells. RRM2/3 are implicated in ACF
          interaction with APOBEC-1. .
          Length = 83

 Score = 27.7 bits (61), Expect = 0.85
 Identities = 12/36 (33%), Positives = 18/36 (50%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPVYAELSPVTD 76
          ++ F   EDA  A+N LN +   G P+   L+   D
Sbjct: 48 FVHFSNREDAVDAMNALNGKVIDGSPIEVTLAKPVD 83


>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins
          family, Drosophila sex-lethal (SXL), and similar
          proteins.  This subfamily corresponds to the RRM2 of Hu
          proteins and SXL. The Hu proteins family represents a
          group of RNA-binding proteins involved in diverse
          biological processes. Since the Hu proteins share high
          homology with the Drosophila embryonic lethal abnormal
          vision (ELAV) protein, the Hu family is sometimes
          referred to as the ELAV family. Drosophila ELAV is
          exclusively expressed in neurons and is required for
          the correct differentiation and survival of neurons in
          flies. The neuronal members of the Hu family include
          Hu-antigen B (HuB or ELAV-2 or Hel-N1), Hu-antigen C
          (HuC or ELAV-3 or PLE21), and Hu-antigen D (HuD or
          ELAV-4), which play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads. Hu-antigen R (HuR or ELAV-1 or
          HuA) is the ubiquitously expressed Hu family member. It
          has a variety of biological functions mostly related to
          the regulation of cellular response to DNA damage and
          other types of stress. Hu proteins perform their
          cytoplasmic and nuclear molecular functions by
          coordinately regulating functionally related mRNAs. In
          the cytoplasm, Hu proteins recognize and bind to
          AU-rich RNA elements (AREs) in the 3' untranslated
          regions (UTRs) of certain target mRNAs, such as GAP-43,
          vascular epithelial growth factor (VEGF), the glucose
          transporter GLUT1, eotaxin and c-fos, and stabilize
          those ARE-containing mRNAs. They also bind and regulate
          the translation of some target mRNAs, such as
          neurofilament M, GLUT1, and p27. In the nucleus, Hu
          proteins function as regulators of polyadenylation and
          alternative splicing. Each Hu protein contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. Also included
          in this subfamily is the sex-lethal protein (SXL) from
          Drosophila melanogaster. SXL governs sexual
          differentiation and X chromosome dosage compensation in
          flies. It induces female-specific alternative splicing
          of the transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds also to its own
          pre-mRNA and promotes female-specific alternative
          splicing. SXL contains an N-terminal Gly/Asn-rich
          domain that may be responsible for the protein-protein
          interaction, and tandem RRMs that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 79

 Score = 27.6 bits (61), Expect = 0.87
 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 19 KYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNN 59
          +YG I    +  D L     G  +I+F +  +AE+A+  LN 
Sbjct: 23 QYGRIITSRILRDQLTGVSRGVGFIRFDKRIEAEEAIKGLNG 64


>gnl|CDD|217006 pfam02382, RTX, RTX N-terminal domain.  The RTX family of bacterial
           toxins are a group of cytolysins and cytotoxins. This
           Pfam family represents the N-terminal domain which is
           found in association with a glycine-rich repeat domain
           and hemolysinCabind pfam00353.
          Length = 653

 Score = 28.6 bits (64), Expect = 0.90
 Identities = 19/66 (28%), Positives = 25/66 (37%), Gaps = 7/66 (10%)

Query: 1   MQEHYDNFFEDVFVECEDKYGEIEEMNVCD-----NLGDHLVGNVYIKFRREEDAEKAVN 55
           M EH  N   D  VE E K+G+    N  D      L D+    +     +E   E+ V 
Sbjct: 414 MFEHVANKIADKIVEWEKKHGKNYFENGYDARHLAFLEDNF--KLLSNLNKEYQVERVVA 471

Query: 56  DLNNRW 61
               RW
Sbjct: 472 ITQQRW 477


>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in
          serine/arginine-rich splicing factor 12 (SRSF12) and
          similar proteins.  This subgroup corresponds to the RRM
          of SRSF12, also termed 35 kDa SR repressor protein
          (SRrp35), or splicing factor, arginine/serine-rich 13B
          (SFRS13B), or splicing factor, arginine/serine-rich 19
          (SFRS19). SRSF12 is a serine/arginine (SR) protein-like
          alternative splicing regulator that antagonizes
          authentic SR proteins in the modulation of alternative
          5' splice site choice. For instance, it activates
          distal alternative 5' splice site of the adenovirus E1A
          pre-mRNA in vivo. SRSF12 contains a single N-terminal
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain),
          followed by a C-terminal RS domain rich in
          serine-arginine dipeptides. .
          Length = 84

 Score = 27.3 bits (60), Expect = 0.91
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          G  YI+F    DAE A+ +LN +W  GR +
Sbjct: 43 GFAYIQFEDVRDAEDALYNLNRKWVCGRQI 72


>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate
          Hu-antigen R (HuR).  This subgroup corresponds to the
          RRM1 of HuR, also termed ELAV-like protein 1 (ELAV-1),
          a ubiquitously expressed Hu family member. It has a
          variety of biological functions mostly related to the
          regulation of cellular response to DNA damage and other
          types of stress. HuR has an anti-apoptotic function
          during early cell stress response; it binds to mRNAs
          and enhances the expression of several anti-apoptotic
          proteins, such as p21waf1, p53, and prothymosin alpha.
          Meanwhile, HuR also has pro-apoptotic function by
          promoting apoptosis when cell death is unavoidable.
          Furthermore, HuR may be important in muscle
          differentiation, adipogenesis, suppression of
          inflammatory response and modulation of gene expression
          in response to chronic ethanol exposure and amino acid
          starvation. Like other Hu proteins, HuR contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an AU-rich
          RNA element (ARE). RRM3 may help to maintain the
          stability of the RNA-protein complex, and might also
          bind to poly(A) tails or be involved in protein-protein
          interactions. .
          Length = 81

 Score = 27.4 bits (60), Expect = 0.95
 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 21 GEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLN 58
          GE+E   +  D +  H +G  ++ +   +DAE+A+N LN
Sbjct: 26 GEVESAKLIRDKVAGHSLGYGFVNYVNAKDAERAINTLN 64


>gnl|CDD|238560 cd01140, FatB, Siderophore binding protein FatB.  These proteins
           have been shown to function as ABC-type initial
           receptors in the siderophore-mediated iron uptake in
           some eubacterial species.  They belong to the TroA
           superfamily of periplasmic metal binding proteins that
           share a distinct fold and ligand binding mechanism. A
           typical TroA protein is comprised of two globular
           subdomains connected by a single helix and can bind
           their ligands in the cleft between these domains.
          Length = 270

 Score = 28.4 bits (64), Expect = 1.0
 Identities = 14/64 (21%), Positives = 28/64 (43%), Gaps = 15/64 (23%)

Query: 1   MQEHYDNFFE-----DVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVN 55
           + E YD   +     D+  +    Y E  + N+ + LG          F +EE+A++ V 
Sbjct: 82  LAEKYDELKKIAPTIDLGAD-LKNYLESVKQNI-ETLGK--------IFGKEEEAKELVA 131

Query: 56  DLNN 59
           +++ 
Sbjct: 132 EIDA 135


>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal
          pre-messenger RNA splicing protein 24 (Prp24) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of Prp24, also termed U4/U6
          snRNA-associated-splicing factor PRP24 (U4/U6 snRNP),
          an RNA-binding protein with four well conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It facilitates U6 RNA base-pairing with U4 RNA during
          spliceosome assembly. Prp24 specifically binds free U6
          RNA primarily with RRMs 1 and 2 and facilitates pairing
          of U6 RNA bases with U4 RNA bases. Additionally, it may
          also be involved in dissociation of the U4/U6 complex
          during spliceosome activation. .
          Length = 78

 Score = 27.1 bits (61), Expect = 1.1
 Identities = 10/32 (31%), Positives = 16/32 (50%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPVYAELS 72
          Y++F   E A  AV  LN +   G  +  ++S
Sbjct: 45 YVQFTSPESAAAAVALLNGKLGEGYKLVVKIS 76


>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible
          RNA binding protein (CIRBP), RNA binding motif protein
          3 (RBM3) and similar proteins.  This subfamily
          corresponds to the RRM domain of two structurally
          related heterogenous nuclear ribonucleoproteins, CIRBP
          (also termed CIRP or A18 hnRNP) and RBM3 (also termed
          RNPL), both of which belong to a highly conserved cold
          shock proteins family. The cold shock proteins can be
          induced after exposure to a moderate cold-shock and
          other cellular stresses such as UV radiation and
          hypoxia. CIRBP and RBM3 may function in
          posttranscriptional regulation of gene expression by
          binding to different transcripts, thus allowing the
          cell to response rapidly to environmental signals.
          However, the kinetics and degree of cold induction are
          different between CIRBP and RBM3. Tissue distribution
          of their expression is different. CIRBP and RBM3 may be
          differentially regulated under physiological and stress
          conditions and may play distinct roles in cold
          responses of cells. CIRBP, also termed glycine-rich
          RNA-binding protein CIRP, is localized in the nucleus
          and mediates the cold-induced suppression of cell cycle
          progression. CIRBP also binds DNA and possibly serves
          as a chaperone that assists in the folding/unfolding,
          assembly/disassembly and transport of various proteins.
          RBM3 may enhance global protein synthesis and the
          formation of active polysomes while reducing the levels
          of ribonucleoprotein complexes containing microRNAs.
          RBM3 may also serve to prevent the loss of muscle mass
          by its ability to decrease cell death. Furthermore,
          RBM3 may be essential for cell proliferation and
          mitosis. Both, CIRBP and RBM3, contain an N-terminal
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), that
          is involved in RNA binding, and C-terminal glycine-rich
          domain (RGG motif) that probably enhances RNA-binding
          via protein-protein and/or protein-RNA interactions.
          Like CIRBP, RBM3 can also bind to both RNA and DNA via
          its RRM domain. .
          Length = 80

 Score = 27.1 bits (60), Expect = 1.2
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 1/57 (1%)

Query: 10 EDVFVECEDKYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGR 65
          E    +   KYG+I E+ V  D       G  ++ F   +DA+ A+  +N +   GR
Sbjct: 14 EQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENPDDAKDAMMAMNGKSVDGR 70


>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General
           function prediction only].
          Length = 306

 Score = 28.4 bits (62), Expect = 1.2
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 41  YIKFRREEDAEKAVNDLNNRWFGGRPV 67
           +++F  EE AEKA+ +LN +   GRP+
Sbjct: 161 FVEFESEESAEKAIEELNGKELEGRPL 187


>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2
          and similar proteins.  This subfamily corresponds to
          the RRM2 of yeast protein gar2, a novel nucleolar
          protein required for 18S rRNA and 40S ribosomal subunit
          accumulation. It shares similar domain architecture
          with nucleolin from vertebrates and NSR1 from
          Saccharomyces cerevisiae. The highly phosphorylated
          N-terminal domain of gar2 is made up of highly acidic
          regions separated from each other by basic sequences,
          and contains multiple phosphorylation sites. The
          central domain of gar2 contains two closely adjacent
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RGG (or GAR) domain of gar2 is
          rich in glycine, arginine and phenylalanine residues. .
          Length = 73

 Score = 27.0 bits (60), Expect = 1.3
 Identities = 10/27 (37%), Positives = 16/27 (59%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPV 67
          Y++F  +E A+ A++ L      GRPV
Sbjct: 44 YVEFSSQEAAQAALDALGGTDLLGRPV 70


>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins
          family, Drosophila sex-lethal (SXL), and similar
          proteins.  This subfamily corresponds to the RRM1 of Hu
          proteins and SXL. The Hu proteins family represents a
          group of RNA-binding proteins involved in diverse
          biological processes. Since the Hu proteins share high
          homology with the Drosophila embryonic lethal abnormal
          vision (ELAV) protein, the Hu family is sometimes
          referred to as the ELAV family. Drosophila ELAV is
          exclusively expressed in neurons and is required for
          the correct differentiation and survival of neurons in
          flies. The neuronal members of the Hu family include
          Hu-antigen B (HuB or ELAV-2 or Hel-N1), Hu-antigen C
          (HuC or ELAV-3 or PLE21), and Hu-antigen D (HuD or
          ELAV-4), which play important roles in neuronal
          differentiation, plasticity and memory. HuB is also
          expressed in gonads. Hu-antigen R (HuR or ELAV-1 or
          HuA) is ubiquitously expressed Hu family member. It has
          a variety of biological functions mostly related to the
          regulation of cellular response to DNA damage and other
          types of stress. Hu proteins perform their cytoplasmic
          and nuclear molecular functions by coordinately
          regulating functionally related mRNAs. In the
          cytoplasm, Hu proteins recognize and bind to AU-rich
          RNA elements (AREs) in the 3' untranslated regions
          (UTRs) of certain target mRNAs, such as GAP-43,
          vascular epithelial growth factor (VEGF), the glucose
          transporter GLUT1, eotaxin and c-fos, and stabilize
          those ARE-containing mRNAs. They also bind and regulate
          the translation of some target mRNAs, such as
          neurofilament M, GLUT1, and p27. In the nucleus, Hu
          proteins function as regulators of polyadenylation and
          alternative splicing. Each Hu protein contains three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an ARE. RRM3
          may help to maintain the stability of the RNA-protein
          complex, and might also bind to poly(A) tails or be
          involved in protein-protein interactions. This family
          also includes the sex-lethal protein (SXL) from
          Drosophila melanogaster. SXL governs sexual
          differentiation and X chromosome dosage compensation in
          flies. It induces female-specific alternative splicing
          of the transformer (tra) pre-mRNA by binding to the tra
          uridine-rich polypyrimidine tract at the
          non-sex-specific 3' splice site during the
          sex-determination process. SXL binds to its own
          pre-mRNA and promotes female-specific alternative
          splicing. It contains an N-terminal Gly/Asn-rich domain
          that may be responsible for the protein-protein
          interaction, and tandem RRMs that show high preference
          to bind single-stranded, uridine-rich target RNA
          transcripts. .
          Length = 77

 Score = 26.9 bits (60), Expect = 1.3
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%)

Query: 19 KYGEIEEMN-VCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNR 60
            G IE    V D +    +G  ++ +  E DA+KA+N LN  
Sbjct: 23 AIGPIESCKIVRDRITGQSLGYGFVDYVDENDAQKAINTLNGF 65


>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in
          serine/arginine-rich splicing factor 10 (SRSF10) and
          similar proteins.  This subgroup corresponds to the RRM
          of SRSF10, also termed 40 kDa SR-repressor protein
          (SRrp40), or FUS-interacting serine-arginine-rich
          protein 1 (FUSIP1), or splicing factor SRp38, or
          splicing factor, arginine/serine-rich 13A (SFRS13A), or
          TLS-associated protein with Ser-Arg repeats (TASR).
          SRSF10 is a serine-arginine (SR) protein that acts as a
          potent and general splicing repressor when
          dephosphorylated. It mediates global inhibition of
          splicing both in M phase of the cell cycle and in
          response to heat shock. SRSF10 emerges as a modulator
          of cholesterol homeostasis through the regulation of
          low-density lipoprotein receptor (LDLR) splicing
          efficiency. It also regulates cardiac-specific
          alternative splicing of triadin pre-mRNA and is
          required for proper Ca2+ handling during embryonic
          heart development. In contrast, the phosphorylated
          SRSF10 functions as a sequence-specific splicing
          activator in the presence of a nuclear cofactor. It
          activates distal alternative 5' splice site of
          adenovirus E1A pre-mRNA in vivo. Moreover, SRSF10
          strengthens pre-mRNA recognition by U1 and U2 snRNPs.
          SRSF10 localizes to the nuclear speckles and can
          shuttle between nucleus and cytoplasm. It contains a
          single N-terminal RNA recognition motif (RRM), also
          termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by a C-terminal RS
          domain rich in serine-arginine dipeptides. .
          Length = 84

 Score = 27.2 bits (60), Expect = 1.3
 Identities = 11/30 (36%), Positives = 19/30 (63%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          G  Y++F    DAE A+++L+ +W  GR +
Sbjct: 43 GFAYVQFEDVRDAEDALHNLDRKWICGRQI 72


>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple
          RNA-binding domain-containing protein 1 (MRD1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 of MRD1 which is encoded by a novel yeast gene
          MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). MRD1
          is essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. It contains 5
          conserved RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which may play an important structural role
          in organizing specific rRNA processing events. .
          Length = 76

 Score = 26.8 bits (60), Expect = 1.4
 Identities = 8/23 (34%), Positives = 14/23 (60%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFG 63
          ++ F+ EEDA++AV   N  +  
Sbjct: 45 FVGFKSEEDAQQAVKYFNKTFID 67


>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM2 of type I poly(A)-binding
          proteins (PABPs), highly conserved proteins that bind
          to the poly(A) tail present at the 3' ends of most
          eukaryotic mRNAs. They have been implicated in the
          regulation of poly(A) tail length during the
          polyadenylation reaction, translation initiation, mRNA
          stabilization by influencing the rate of deadenylation
          and inhibition of mRNA decapping. The family represents
          type I polyadenylate-binding proteins (PABPs),
          including polyadenylate-binding protein 1 (PABP-1 or
          PABPC1), polyadenylate-binding protein 3 (PABP-3 or
          PABPC3), polyadenylate-binding protein 4 (PABP-4 or
          APP-1 or iPABP), polyadenylate-binding protein 5
          (PABP-5 or PABPC5), polyadenylate-binding protein
          1-like (PABP-1-like or PABPC1L), polyadenylate-binding
          protein 1-like 2 (PABPC1L2 or RBM32),
          polyadenylate-binding protein 4-like (PABP-4-like or
          PABPC4L), yeast polyadenylate-binding protein,
          cytoplasmic and nuclear (PABP or ACBP-67), and similar
          proteins. PABP-1 is a ubiquitously expressed
          multifunctional protein that may play a role in 3' end
          formation of mRNA, translation initiation, mRNA
          stabilization, protection of poly(A) from nuclease
          activity, mRNA deadenylation, inhibition of mRNA
          decapping, and mRNP maturation. Although PABP-1 is
          thought to be a cytoplasmic protein, it is also found
          in the nucleus. PABP-1 may be involved in
          nucleocytoplasmic trafficking and utilization of mRNP
          particles. PABP-1 contains four copies of RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains), a
          less well conserved linker region, and a proline-rich
          C-terminal conserved domain (CTD). PABP-3 is a
          testis-specific poly(A)-binding protein specifically
          expressed in round spermatids. It is mainly found in
          mammalian and may play an important role in the
          testis-specific regulation of mRNA homeostasis. PABP-3
          shows significant sequence similarity to PABP-1.
          However, it binds to poly(A) with a lower affinity than
          PABP-1. Moreover, PABP-1 possesses an A-rich sequence
          in its 5'-UTR and allows binding of PABP and blockage
          of translation of its own mRNA. In contrast, PABP-3
          lacks the A-rich sequence in its 5'-UTR. PABP-4 is an
          inducible poly(A)-binding protein (iPABP) that is
          primarily localized to the cytoplasm. It shows
          significant sequence similarity to PABP-1 as well. The
          RNA binding properties of PABP-1 and PABP-4 appear to
          be identical. PABP-5 is encoded by PABPC5 gene within
          the X-specific subinterval, and expressed in fetal
          brain and in a range of adult tissues in mammalian,
          such as ovary and testis. It may play an important role
          in germ cell development. Unlike other PABPs, PABP-5
          contains only four RRMs, but lacks both the linker
          region and the CTD. PABP-1-like and PABP-1-like 2 are
          the orthologs of PABP-1. PABP-4-like is the ortholog of
          PABP-5. Their cellular functions remain unclear. The
          family also includes the yeast PABP, a conserved
          poly(A) binding protein containing poly(A) tails that
          can be attached to the 3'-ends of mRNAs. The yeast PABP
          and its homologs may play important roles in the
          initiation of translation and in mRNA decay. Like
          vertebrate PABP-1, the yeast PABP contains four RRMs, a
          linker region, and a proline-rich CTD as well. The
          first two RRMs are mainly responsible for specific
          binding to poly(A). The proline-rich region may be
          involved in protein-protein interactions. .
          Length = 77

 Score = 26.7 bits (60), Expect = 1.4
 Identities = 7/28 (25%), Positives = 14/28 (50%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPVY 68
          ++ F  EE A +A+  +N      + V+
Sbjct: 47 FVHFETEEAAVRAIEKVNGMLLNDKKVF 74


>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and
          CTD-associated factor 4 (SCAF4), SR-related and
          CTD-associated factor 8 (SCAF8) and similar proteins.
          This subfamily corresponds to the RRM in a new class of
          SCAFs (SR-like CTD-associated factors), including
          SCAF4, SCAF8 and similar proteins. The biological role
          of SCAF4 remains unclear, but it shows high sequence
          similarity to SCAF8 (also termed CDC5L
          complex-associated protein 7, or RNA-binding motif
          protein 16, or CTD-binding SR-like protein RA8). SCAF8
          is a nuclear matrix protein that interacts specifically
          with a highly serine-phosphorylated form of the
          carboxy-terminal domain (CTD) of the largest subunit of
          RNA polymerase II (pol II). The pol II CTD plays a role
          in coupling transcription and pre-mRNA processing. In
          addition, SCAF8 co-localizes primarily with
          transcription sites that are enriched in nuclear matrix
          fraction, which is known to contain proteins involved
          in pre-mRNA processing. Thus, SCAF8 may play a direct
          role in coupling with both, transcription and pre-mRNA
          processing, processes. SCAF8 and SCAF4 both contain a
          conserved N-terminal CTD-interacting domain (CID), an
          atypical RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNPs (ribonucleoprotein
          domain), and serine/arginine-rich motifs.
          Length = 77

 Score = 26.5 bits (59), Expect = 1.7
 Identities = 12/49 (24%), Positives = 23/49 (46%), Gaps = 5/49 (10%)

Query: 19 KYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          +YGEI+ +++    G       Y+     +DA +A+  L N    G+ +
Sbjct: 25 EYGEIQSIDMIPPRG-----CAYVCMETRQDAHRALQKLRNVKLAGKKI 68


>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in
          serine/arginine-rich splicing factor 3 (SRSF3) and
          similar proteins.  This subfamily corresponds to the
          RRM of two serine/arginine (SR) proteins,
          serine/arginine-rich splicing factor 3 (SRSF3) and
          serine/arginine-rich splicing factor 7 (SRSF7). SRSF3,
          also termed pre-mRNA-splicing factor SRp20, modulates
          alternative splicing by interacting with RNA
          cis-elements in a concentration- and cell
          differentiation-dependent manner. It is also involved
          in termination of transcription, alternative RNA
          polyadenylation, RNA export, and protein translation.
          SRSF3 is critical for cell proliferation, and tumor
          induction and maintenance. It can shuttle between the
          nucleus and cytoplasm. SRSF7, also termed splicing
          factor 9G8, plays a crucial role in both constitutive
          splicing and alternative splicing of many pre-mRNAs.
          Its localization and functions are tightly regulated by
          phosphorylation. SRSF7 is predominantly present in the
          nuclear and can shuttle between nucleus and cytoplasm.
          It cooperates with the export protein, Tap/NXF1, helps
          mRNA export to the cytoplasm, and enhances the
          expression of unspliced mRNA. Moreover, SRSF7 inhibits
          tau E10 inclusion through directly interacting with the
          proximal downstream intron of E10, a clustering region
          for frontotemporal dementia with Parkinsonism (FTDP)
          mutations. Both SRSF3 and SRSF7 contain a single
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and a C-terminal RS domain rich in serine-arginine
          dipeptides. The RRM domain is involved in RNA binding,
          and the RS domain has been implicated in protein
          shuttling and protein-protein interactions. .
          Length = 73

 Score = 26.4 bits (59), Expect = 1.7
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 8/63 (12%)

Query: 10 EDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYA 69
          ED F    +KYG +  + V  N      G  +++F    DAE AV  L+ R   G  V  
Sbjct: 17 EDEF----EKYGPLRSVWVARNPP----GFAFVEFEDPRDAEDAVRALDGRRICGNRVRV 68

Query: 70 ELS 72
          ELS
Sbjct: 69 ELS 71


>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous
          nuclear ribonucleoprotein C (hnRNP C)-related proteins.
           This subfamily corresponds to the RRM in the hnRNP
          C-related protein family, including hnRNP C proteins,
          Raly, and Raly-like protein (RALYL). hnRNP C proteins,
          C1 and C2, are produced by a single coding sequence.
          They are the major constituents of the heterogeneous
          nuclear RNA (hnRNA) ribonucleoprotein (hnRNP) complex
          in vertebrates. They bind hnRNA tightly, suggesting a
          central role in the formation of the ubiquitous hnRNP
          complex; they are involved in the packaging of the
          hnRNA in the nucleus and in processing of pre-mRNA such
          as splicing and 3'-end formation. Raly, also termed
          autoantigen p542, is an RNA-binding protein that may
          play a critical role in embryonic development. The
          biological role of RALYL remains unclear. It shows high
          sequence homology with hnRNP C proteins and Raly.
          Members of this family are characterized by an
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and a C-terminal auxiliary domain. The Raly proteins
          contain a glycine/serine-rich stretch within the
          C-terminal regions, which is absent in the hnRNP C
          proteins. Thus, the Raly proteins represent a newly
          identified class of evolutionarily conserved
          autoepitopes. .
          Length = 68

 Score = 26.4 bits (59), Expect = 1.7
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 19 KYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          KYG+I  +++    G       +++F  EEDA  AV   N R   G+ +
Sbjct: 24 KYGKILGISLHKGYG-------FVQFDNEEDARAAVAGENGREIAGQKL 65


>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the
          U1A/U2B"/SNF protein family.  This subfamily
          corresponds to the RRM1 of U1A/U2B"/SNF protein family
          which contains Drosophila sex determination protein SNF
          and its two mammalian counterparts, U1 small nuclear
          ribonucleoprotein A (U1 snRNP A or U1-A or U1A) and U2
          small nuclear ribonucleoprotein B" (U2 snRNP B" or
          U2B"), all of which consist of two RNA recognition
          motifs (RRMs), connected by a variable, flexible
          linker. SNF is an RNA-binding protein found in the U1
          and U2 snRNPs of Drosophila where it is essential in
          sex determination and possesses a novel dual RNA
          binding specificity. SNF binds with high affinity to
          both Drosophila U1 snRNA stem-loop II (SLII) and U2
          snRNA stem-loop IV (SLIV). It can also bind to poly(U)
          RNA tracts flanking the alternatively spliced
          Sex-lethal (Sxl) exon, as does Drosophila Sex-lethal
          protein (SXL). U1A is an RNA-binding protein associated
          with the U1 snRNP, a small RNA-protein complex involved
          in pre-mRNA splicing. U1A binds with high affinity and
          specificity to stem-loop II (SLII) of U1 snRNA. It is
          predominantly a nuclear protein that shuttles between
          the nucleus and the cytoplasm independently of
          interactions with U1 snRNA. Moreover, U1A may be
          involved in RNA 3'-end processing, specifically
          cleavage, splicing and polyadenylation, through
          interacting with a large number of non-snRNP proteins.
          U2B", initially identified to bind to stem-loop IV
          (SLIV) at the 3' end of U2 snRNA, is a unique protein
          that comprises of the U2 snRNP. Additional research
          indicates U2B" binds to U1 snRNA stem-loop II (SLII) as
          well and shows no preference for SLIV or SLII on the
          basis of binding affinity. Moreover, U2B" does not
          require an auxiliary protein for binding to RNA, and
          its nuclear transport is independent of U2 snRNA
          binding. .
          Length = 78

 Score = 26.3 bits (59), Expect = 1.9
 Identities = 12/53 (22%), Positives = 23/53 (43%), Gaps = 5/53 (9%)

Query: 20 YGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPV---YA 69
          +G + ++     L   + G  ++ F+  E A  A+  L    F  +P+   YA
Sbjct: 27 FGPVLDIVASKTLK--MRGQAFVVFKDVESATNALRALQGFPFYDKPMRIQYA 77


>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger
          CCHC-type and RNA-binding motif-containing protein 1
          (ZCRB1) and similar proteins.  This subfamily
          corresponds to the RRM of ZCRB1, also termed MADP-1, or
          U11/U12 small nuclear ribonucleoprotein 31 kDa protein
          (U11/U12 snRNP 31 or U11/U12-31K), a novel
          multi-functional nuclear factor, which may be involved
          in morphine dependence, cold/heat stress, and
          hepatocarcinoma. It is located in the nucleoplasm, but
          outside the nucleolus. ZCRB1 is one of the components
          of U11/U12 snRNPs that bind to U12-type pre-mRNAs and
          form a di-snRNP complex, simultaneously recognizing the
          5' splice site and branchpoint sequence. ZCRB1 is
          characterized by an RNA recognition motif (RRM), also
          termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a CCHC-type Zinc finger
          motif. In addition, it contains core nucleocapsid
          motifs, and Lys- and Glu-rich domains.  .
          Length = 78

 Score = 26.5 bits (59), Expect = 1.9
 Identities = 13/28 (46%), Positives = 15/28 (53%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGR 65
          G  +I F   EDA K V  LNN+   GR
Sbjct: 44 GVAFILFLDREDAHKCVKALNNKELFGR 71


>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in
          eukaryotic RNA-binding protein RBM24, RBM38 and similar
          proteins.  This subfamily corresponds to the RRM of
          RBM24 and RBM38 from vertebrate, SUPpressor family
          member SUP-12 from Caenorhabditis elegans and similar
          proteins. Both, RBM24 and RBM38, are preferentially
          expressed in cardiac and skeletal muscle tissues. They
          regulate myogenic differentiation by controlling the
          cell cycle in a p21-dependent or -independent manner.
          RBM24, also termed RNA-binding region-containing
          protein 6, interacts with the 3'-untranslated region
          (UTR) of myogenin mRNA and regulates its stability in
          C2C12 cells. RBM38, also termed CLL-associated antigen
          KW-5, or HSRNASEB, or RNA-binding region-containing
          protein 1(RNPC1), or ssDNA-binding protein SEB4, is a
          direct target of the p53 family. It is required for
          maintaining the stability of the basal and
          stress-induced p21 mRNA by binding to their 3'-UTRs. It
          also binds the AU-/U-rich elements in p63 3'-UTR and
          regulates p63 mRNA stability and activity. SUP-12 is a
          novel tissue-specific splicing factor that controls
          muscle-specific splicing of the ADF/cofilin pre-mRNA in
          C. elegans. All family members contain a conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). .
          Length = 76

 Score = 26.4 bits (59), Expect = 1.9
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 18 DKYGEIEEMNV-CDNLGDHLVGNVYIKFRREEDAEKAVNDLN 58
           ++GEIEE  V  D       G  ++ F+ +E AE+A  D N
Sbjct: 22 SQFGEIEEAVVITDRQTGKSRGYGFVTFKDKESAERACKDPN 63


>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding
          protein 19 (RBM19), yeast multiple RNA-binding
          domain-containing protein 1 (MRD1) and similar
          proteins.  This subfamily corresponds to the RRM1 of
          RBM19 and MRD1. RBM19, also termed RNA-binding domain-1
          (RBD-1), is a nucleolar protein conserved in
          eukaryotes. It is involved in ribosome biogenesis by
          processing rRNA and is essential for preimplantation
          development. It has a unique domain organization
          containing 6 conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). MRD1 is encoded by a novel
          yeast gene MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RRMs, which may play an important structural
          role in organizing specific rRNA processing events. .
          Length = 77

 Score = 26.5 bits (59), Expect = 2.0
 Identities = 8/27 (29%), Positives = 16/27 (59%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPV 67
          +I ++ EE+A+KA +  NN +     +
Sbjct: 46 FIGYKTEEEAQKAKDYFNNTYINTSKI 72


>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in
          serine/arginine-rich splicing factor 1 (SRSF1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 in three serine/arginine (SR) proteins:
          serine/arginine-rich splicing factor 1 (SRSF1 or
          ASF-1), serine/arginine-rich splicing factor 9 (SRSF9
          or SRp30C), and plant pre-mRNA-splicing factor SF2
          (SR1). SRSF1 is a shuttling SR protein involved in
          constitutive and alternative splicing,
          nonsense-mediated mRNA decay (NMD), mRNA export and
          translation. It also functions as a splicing-factor
          oncoprotein that regulates apoptosis and proliferation
          to promote mammary epithelial cell transformation.
          SRSF9 has been implicated in the activity of many
          elements that control splice site selection, the
          alternative splicing of the glucocorticoid receptor
          beta in neutrophils and in the gonadotropin-releasing
          hormone pre-mRNA. It can also interact with other
          proteins implicated in alternative splicing, including
          YB-1, rSLM-1, rSLM-2, E4-ORF4, Nop30, and p32. Both,
          SRSF1 and SRSF9, contain two N-terminal RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a C-terminal
          RS domains rich in serine-arginine dipeptides. In
          contrast, SF2 contains two N-terminal RRMs and a
          C-terminal PSK domain rich in proline, serine and
          lysine residues.  .
          Length = 72

 Score = 26.2 bits (58), Expect = 2.0
 Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 6/62 (9%)

Query: 10 EDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYA 69
          ED+F     KYG I+ +++ +          +++F    DAE AV   +   F G  +  
Sbjct: 17 EDLF----YKYGPIKAIDLKNRRRG--PPFAFVEFEDPRDAEDAVRGRDGYDFDGYRLRV 70

Query: 70 EL 71
          E 
Sbjct: 71 EF 72


>gnl|CDD|220751 pfam10433, MMS1_N, Mono-functional DNA-alkylating methyl
           methanesulfonate N-term.  MMS1 is a protein that
           protects against replication-dependent DNA damage in
           Saccharomyces cerevisiae. MMS1 belongs to the DDB1
           family of cullin 4 adaptors and the two proteins are
           homologous. MMS1 bridges the interaction of MMS22 and
           Crt10 with Cul8/Rtt101. Cul8/Rtt101 is a cullin protein
           involved in the regulation of DNA replication subsequent
           to DNA damage. The N-terminal region of MMS1 and the
           C-terminal of MMS22 are required for the the MMS1-MMS22
           interaction. The human HIV-1 virion-associated protein
           Vpr assembles with DDB1 through interaction with DCAF1
           (chromatin assembly factor) to form an E3 ubiquitin
           ligase that targets cellular substrates for
           proteasome-mediated degradation and subsequent G2
           arrest.
          Length = 513

 Score = 27.7 bits (62), Expect = 2.2
 Identities = 9/36 (25%), Positives = 13/36 (36%)

Query: 90  CTRSGFCNFMHLKPISRELRRYLYSRRKRSSRRSSR 125
              SG   F++     R+L    Y  R+      SR
Sbjct: 6   SLDSGELLFLYYDEEPRQLFPEFYHSRRDLPSDVSR 41


>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate
          Hu-antigen C (HuC).  This subgroup corresponds to the
          RRM1 of HuC, also termed ELAV-like protein 3 (ELAV-3),
          or paraneoplastic cerebellar degeneration-associated
          antigen, or paraneoplastic limbic encephalitis antigen
          21 (PLE21), one of the neuronal members of the Hu
          family. The neuronal Hu proteins play important roles
          in neuronal differentiation, plasticity and memory.
          Like other Hu proteins, HuC contains three RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          RRM1 and RRM2 may cooperate in binding to an AU-rich
          RNA element (ARE). The AU-rich element binding of HuC
          can be inhibited by flavonoids. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 84

 Score = 26.6 bits (58), Expect = 2.2
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query: 7  NFFEDVFVECEDKYGEIEEMN-VCDNLGDHLVGNVYIKFRREEDAEKAVNDLN 58
          N  ++ F       GEIE    V D +    +G  ++ +    DA+KA+N LN
Sbjct: 14 NMTQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDADKAINTLN 66


>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate
          RNA-binding protein 47 (RBM47).  This subgroup
          corresponds to the RRM1 of RBM47, a putative
          RNA-binding protein that shows high sequence homology
          with heterogeneous nuclear ribonucleoprotein R (hnRNP
          R) and heterogeneous nuclear ribonucleoprotein Q (hnRNP
          Q). Its biological function remains unclear. Like hnRNP
          R and hnRNP Q, RBM47 contains two well-defined and one
          degenerated RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 78

 Score = 26.1 bits (57), Expect = 2.6
 Identities = 14/53 (26%), Positives = 28/53 (52%)

Query: 7  NFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNN 59
          + +ED  V   +  G I EM +  +      G  ++ + ++ +A++AV +LNN
Sbjct: 12 DVYEDELVPVFESVGRIYEMRLMMDFDGKNRGYAFVMYTQKHEAKRAVRELNN 64


>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA
          selenocysteine-associated protein 1 (SECp43) and
          similar proteins.  This subfamily corresponds to the
          RRM2 in tRNA selenocysteine-associated protein 1
          (SECp43), yeast negative growth regulatory protein NGR1
          (RBP1), yeast protein NAM8, and similar proteins.
          SECp43 is an RNA-binding protein associated
          specifically with eukaryotic selenocysteine tRNA
          [tRNA(Sec)]. It may play an adaptor role in the
          mechanism of selenocysteine insertion. SECp43 is
          located primarily in the nucleus and contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a C-terminal polar/acidic region. Yeast
          proteins, NGR1 and NAM8, show high sequence similarity
          with SECp43. NGR1 is a putative glucose-repressible
          protein that binds both RNA and single-stranded DNA
          (ssDNA). It may function in regulating cell growth in
          early log phase, possibly through its participation in
          RNA metabolism. NGR1 contains three RRMs, two of which
          are followed by a glutamine-rich stretch that may be
          involved in transcriptional activity. In addition, NGR1
          has an asparagine-rich region near the C-terminus which
          also harbors a methionine-rich region. NAM8 is a
          putative RNA-binding protein that acts as a suppressor
          of mitochondrial splicing deficiencies when
          overexpressed in yeast. It may be a non-essential
          component of the mitochondrial splicing machinery. NAM8
          also contains three RRMs.  .
          Length = 80

 Score = 26.1 bits (58), Expect = 2.7
 Identities = 9/35 (25%), Positives = 22/35 (62%), Gaps = 2/35 (5%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPVYAELSPVT 75
          +++F  E++ ++A+ ++N  +   RP+   +SP T
Sbjct: 48 FVRFGDEDERDRALTEMNGVYCSSRPM--RVSPAT 80


>gnl|CDD|240876 cd12430, RRM_LARP4_5_like, RNA recognition motif in La-related
          protein 4 (LARP4), La-related protein 5 (LARP5 or
          LARP4B) and similar proteins.  This subfamily
          corresponds to the RRM of LARP4 and LARP5. LARP4 is a
          cytoplasmic factor that can bind poly(A) RNA and
          interact with poly(A) binding protein (PABP). It may
          play a role in promoting translation by stabilizing
          mRNA. LARP5 is a cytosolic protein that co-sediments
          with polysomes and accumulates upon stress induction in
          cellular stress granules. It can interact with the
          cytosolic poly(A) binding protein 1 (PABPC1) and the
          receptor for activated C Kinase (RACK1), a component of
          the 40S ribosomal subunit. LARP5 may function as a
          stimulatory factor of translation through bridging mRNA
          factors of the 3' end with initiating ribosomes. Both,
          LARP4 and LARP5, are structurally related to the La
          autoantigen. Like other La-related proteins (LARPs)
          family members, LARP4 and LARP5 contain a La motif
          (LAM) and an RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). .
          Length = 76

 Score = 26.1 bits (58), Expect = 2.7
 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 2/31 (6%)

Query: 41 YIKFRREEDAEKAVNDLNNRW--FGGRPVYA 69
          ++ F  EEDA++A   L      F G+P+ A
Sbjct: 41 FVTFETEEDAQEAYRYLREEVKTFQGKPIMA 71


>gnl|CDD|240881 cd12435, RRM_GW182_like, RNA recognition motif in the GW182
          family proteins.  This subfamily corresponds to the RRM
          of the GW182 family which includes three paralogs of
          TNRC6 (GW182-related) proteins comprising GW182/TNGW1,
          TNRC6B (containing three isoforms) and TNRC6C in
          mammal, a single Drosophila ortholog (dGW182, also
          called Gawky) and two Caenorhabditis elegans orthologs
          AIN-1 and AIN-2, which contain multiple miRNA-binding
          sites and have important functions in miRNA-mediated
          translational repression, as well as mRNA degradation
          in Metazoa. The GW182 family proteins directly interact
          with Argonaute (Ago) proteins, and thus function as
          downstream effectors in the miRNA pathway, responsible
          for inhibition of translation and acceleration of mRNA
          decay. Members in this family are characterized by an
          abnormally high content of glycine/tryptophan (G/W)
          repeats, one or more glutamine (Q)-rich motifs, and a
          C-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain).
          The only exception is the worm protein that does not
          contain a recognizable RRM domain. The GW182 family
          proteins are recruited to miRNA targets through an
          interaction between their N-terminal domain and an
          Argonaute protein. Then they promote translational
          repression and/or degradation of miRNA targets through
          their C-terminal silencing domain.  .
          Length = 71

 Score = 25.8 bits (57), Expect = 2.7
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAEL 71
          GN  I++  +E+A KA + LNN   G   + AE 
Sbjct: 38 GNALIRYSSKEEAAKAQSALNNCVLGNTTLLAEF 71


>gnl|CDD|241193 cd12749, RRM4_RBM12, RNA recognition motif 4 in RNA-binding
          protein 12 (RBM12) and similar proteins.  This subgroup
          corresponds to the RRM4 of RBM12, also termed SH3/WW
          domain anchor protein in the nucleus (SWAN), which is
          ubiquitously expressed. It contains five distinct RNA
          binding motifs (RRMs), also termed RBDs (RNA binding
          domains) or RNPs (ribonucleoprotein domains), two
          proline-rich regions, and several putative
          transmembrane domains. The biological role of RBM12
          remains unclear. .
          Length = 88

 Score = 26.3 bits (58), Expect = 2.8
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 30 DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAELSPVTDFRE 79
          DN G  L G   ++F+ E+DA K+   L+ +   GR V+  L    + R+
Sbjct: 35 DNNGQGL-GQALVQFKSEDDARKS-ERLHRKKLNGRDVFLHLVTAEEMRD 82


>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic
          activator RIM4 and similar proteins.  This subfamily
          corresponds to the RRM2 of RIM4, also termed regulator
          of IME2 protein 4, a putative RNA binding protein that
          is expressed at elevated levels early in meiosis. It
          functions as a meiotic activator required for both the
          IME1- and IME2-dependent pathways of meiotic gene
          expression, as well as early events of meiosis, such as
          meiotic division and recombination, in Saccharomyces
          cerevisiae. RIM4 contains two RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). The family also includes a
          putative RNA-binding protein termed multicopy
          suppressor of sporulation protein Msa1. It is a
          putative RNA-binding protein encoded by a novel gene,
          msa1, from the fission yeast Schizosaccharomyces pombe.
          Msa1 may be involved in the inhibition of sexual
          differentiation by controlling the expression of
          Ste11-regulated genes, possibly through the
          pheromone-signaling pathway. Like RIM4, Msa1 also
          contains two RRMs, both of which are essential for the
          function of Msa1. .
          Length = 80

 Score = 26.1 bits (58), Expect = 2.8
 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 19 KYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAEL 71
          ++G+I E+N+     +H     +IKF RE+ A +AV   N+     + ++ + 
Sbjct: 26 RHGKILEVNLIKR-ANHTNAFAFIKFEREQAAARAVESENHSMLKNKTMHVQY 77


>gnl|CDD|240959 cd12515, RRM5_RBM12_like, RNA recognition motif 5 in RNA-binding
          protein RBM12, RBM12B and similar proteins.  This
          subfamily corresponds to the RRM5 of RBM12 and RBM12B.
          RBM12, also termed SH3/WW domain anchor protein in the
          nucleus (SWAN), is ubiquitously expressed. It contains
          five distinct RNA binding motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), two proline-rich regions, and several
          putative transmembrane domains. RBM12B show high
          sequence semilarity with RBM12. It contains five
          distinct RRMs as well. The biological roles of both
          RBM12 and RBM12B remain unclear. .
          Length = 75

 Score = 25.9 bits (57), Expect = 2.8
 Identities = 11/30 (36%), Positives = 14/30 (46%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          G   + F    +A  AV +LN R  G R V
Sbjct: 43 GEATVAFDTHREAMAAVRELNGRPIGTRKV 72


>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in
          serine/arginine-rich splicing factor SRSF10, SRSF12 and
          similar proteins.  This subfamily corresponds to the
          RRM of SRSF10 and SRSF12. SRSF10, also termed 40 kDa
          SR-repressor protein (SRrp40), or FUS-interacting
          serine-arginine-rich protein 1 (FUSIP1), or splicing
          factor SRp38, or splicing factor, arginine/serine-rich
          13A (SFRS13A), or TLS-associated protein with Ser-Arg
          repeats (TASR). It is a serine-arginine (SR) protein
          that acts as a potent and general splicing repressor
          when dephosphorylated. It mediates global inhibition of
          splicing both in M phase of the cell cycle and in
          response to heat shock. SRSF10 emerges as a modulator
          of cholesterol homeostasis through the regulation of
          low-density lipoprotein receptor (LDLR) splicing
          efficiency. It also regulates cardiac-specific
          alternative splicing of triadin pre-mRNA and is
          required for proper Ca2+ handling during embryonic
          heart development. In contrast, the phosphorylated
          SRSF10 functions as a sequence-specific splicing
          activator in the presence of a nuclear cofactor. It
          activates distal alternative 5' splice site of
          adenovirus E1A pre-mRNA in vivo. Moreover, SRSF10
          strengthens pre-mRNA recognition by U1 and U2 snRNPs.
          SRSF10 localizes to the nuclear speckles and can
          shuttle between nucleus and cytoplasm. SRSF12, also
          termed 35 kDa SR repressor protein (SRrp35), or
          splicing factor, arginine/serine-rich 13B (SFRS13B), or
          splicing factor, arginine/serine-rich 19 (SFRS19), is a
          serine/arginine (SR) protein-like alternative splicing
          regulator that antagonizes authentic SR proteins in the
          modulation of alternative 5' splice site choice. For
          instance, it activates distal alternative 5' splice
          site of the adenovirus E1A pre-mRNA in vivo. Both,
          SRSF10 and SRSF12, contain a single N-terminal RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), followed by
          a C-terminal RS domain rich in serine-arginine
          dipeptides. .
          Length = 84

 Score = 26.2 bits (58), Expect = 2.9
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 19 KYGEIEEMNV-CDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          KYG I ++ +  D       G  Y++F    DAE A+  L+   F GR +
Sbjct: 23 KYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAEDALYYLDRTRFLGREI 72


>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate
          RNA-binding protein RBM23, RBM39 and similar proteins. 
          This subfamily corresponds to the RRM2 of RBM39 (also
          termed HCC1), a nuclear autoantigen that contains an
          N-terminal arginine/serine rich (RS) motif and three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          An octapeptide sequence called the RS-ERK motif is
          repeated six times in the RS region of RBM39. Although
          the cellular function of RBM23 remains unclear, it
          shows high sequence homology to RBM39 and contains two
          RRMs. It may possibly function as a pre-mRNA splicing
          factor. .
          Length = 73

 Score = 25.7 bits (57), Expect = 2.9
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPV 67
          +I+F   EDA+KA+  LN     GRP+
Sbjct: 44 FIQFADAEDAKKALEQLNGFELAGRPI 70


>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor
          3B subunit 4 (SF3B4) and similar proteins.  This
          subfamily corresponds to the RRM1 of SF3B4, also termed
          pre-mRNA-splicing factor SF3b 49 kDa (SF3b50), or
          spliceosome-associated protein 49 (SAP 49). SF3B4 a
          component of the multiprotein complex splicing factor
          3b (SF3B), an integral part of the U2 small nuclear
          ribonucleoprotein (snRNP) and the U11/U12 di-snRNP.
          SF3B is essential for the accurate excision of introns
          from pre-messenger RNA, and is involved in the
          recognition of the pre-mRNA's branch site within the
          major and minor spliceosomes. SF3B4 functions to tether
          U2 snRNP with pre-mRNA at the branch site during
          spliceosome assembly. It is an evolutionarily highly
          conserved protein with orthologs across diverse
          species. SF3B4 contains two closely adjacent N-terminal
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It binds directly to pre-mRNA and also interacts
          directly and highly specifically with another SF3B
          subunit called SAP 145. .
          Length = 74

 Score = 25.6 bits (57), Expect = 3.2
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPV 67
          +++F  EEDA+ A+  +N     G+P+
Sbjct: 44 FVEFLSEEDADYAIKIMNMIKLYGKPI 70


>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold
          attachment factor (SAFB) family.  This subfamily
          corresponds to the RRM domain of the SAFB family,
          including scaffold attachment factor B1 (SAFB1),
          scaffold attachment factor B2 (SAFB2), SAFB-like
          transcriptional modulator (SLTM), and similar proteins,
          which are ubiquitously expressed. SAFB1, SAFB2 and SLTM
          have been implicated in many diverse cellular processes
          including cell growth and transformation, stress
          response, and apoptosis. They share high sequence
          similarities and all contain a scaffold attachment
          factor-box (SAF-box, also known as SAP domain)
          DNA-binding motif, an RNA recognition motif (RRM), also
          known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a region rich in
          glutamine and arginine residues. SAFB1 is a nuclear
          protein with a distribution similar to that of SLTM,
          but unlike that of SAFB2, which is also found in the
          cytoplasm. To a large extent, SAFB1 and SLTM might
          share similar functions, such as the inhibition of an
          oestrogen reporter gene. The additional cytoplasmic
          localization of SAFB2 implies that it could play
          additional roles in the cytoplasmic compartment which
          are distinct from the nuclear functions shared with
          SAFB1 and SLTM. .
          Length = 74

 Score = 25.8 bits (57), Expect = 3.2
 Identities = 7/30 (23%), Positives = 13/30 (43%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPVYAE 70
          ++     E+A K +  L+     GR +  E
Sbjct: 45 FVTMASVEEAAKCIQHLHRTELHGRVISVE 74


>gnl|CDD|241195 cd12751, RRM5_RBM12, RNA recognition motif 5 in RNA-binding
          protein 12 (RBM12) and similar proteins.  This subgroup
          corresponds to the RRM5 of RBM12, also termed SH3/WW
          domain anchor protein in the nucleus (SWAN), which is
          ubiquitously expressed. It contains five distinct RNA
          binding motifs (RBMs), also termed RBDs (RNA binding
          domains) or RNPs (ribonucleoprotein domains), two
          proline-rich regions, and several putative
          transmembrane domains. The biological role of RBM12
          remains unclear. .
          Length = 76

 Score = 25.7 bits (56), Expect = 3.2
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          G   + F   ++A  AV DLN+R  G R V
Sbjct: 44 GEAMVAFESRDEAMAAVVDLNDRPIGSRKV 73


>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins
          family.  This subfamily corresponds to the RRM2 of Hu
          proteins family which represents a group of RNA-binding
          proteins involved in diverse biological processes.
          Since the Hu proteins share high homology with the
          Drosophila embryonic lethal abnormal vision (ELAV)
          protein, the Hu family is sometimes referred to as the
          ELAV family. Drosophila ELAV is exclusively expressed
          in neurons and is required for the correct
          differentiation and survival of neurons in flies. The
          neuronal members of the Hu family include Hu-antigen B
          (HuB or ELAV-2 or Hel-N1), Hu-antigen C (HuC or ELAV-3
          or PLE21), and Hu-antigen D (HuD or ELAV-4), which play
          important roles in neuronal differentiation, plasticity
          and memory. HuB is also expressed in gonads. Hu-antigen
          R (HuR or ELAV-1 or HuA) is the ubiquitously expressed
          Hu family member. It has a variety of biological
          functions mostly related to the regulation of cellular
          response to DNA damage and other types of stress.
          Moreover, HuR has an anti-apoptotic function during
          early cell stress response. It binds to mRNAs and
          enhances the expression of several anti-apoptotic
          proteins, such as p21waf1, p53, and prothymosin alpha.
          HuR also has pro-apoptotic function by promoting
          apoptosis when cell death is unavoidable. Furthermore,
          HuR may be important in muscle differentiation,
          adipogenesis, suppression of inflammatory response and
          modulation of gene expression in response to chronic
          ethanol exposure and amino acid starvation. Hu proteins
          perform their cytoplasmic and nuclear molecular
          functions by coordinately regulating functionally
          related mRNAs. In the cytoplasm, Hu proteins recognize
          and bind to AU-rich RNA elements (AREs) in the 3'
          untranslated regions (UTRs) of certain target mRNAs,
          such as GAP-43, vascular epithelial growth factor
          (VEGF), the glucose transporter GLUT1, eotaxin and
          c-fos, and stabilize those ARE-containing mRNAs. They
          also bind and regulate the translation of some target
          mRNAs, such as neurofilament M, GLUT1, and p27. In the
          nucleus, Hu proteins function as regulators of
          polyadenylation and alternative splicing. Each Hu
          protein contains three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). RRM1 and RRM2 may
          cooperate in binding to an ARE. RRM3 may help to
          maintain the stability of the RNA-protein complex, and
          might also bind to poly(A) tails or be involved in
          protein-protein interactions. .
          Length = 79

 Score = 25.7 bits (57), Expect = 3.4
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 29 CDNLGDHLVGNVYIKFRREEDAEKAVNDLNN 59
          CDN+     G  +I+F +  +AE+A+  LN 
Sbjct: 34 CDNVTGLSRGVGFIRFDKRIEAERAIKALNG 64


>gnl|CDD|216205 pfam00937, Corona_nucleoca, Coronavirus nucleocapsid protein. 
          Length = 346

 Score = 27.0 bits (60), Expect = 3.4
 Identities = 10/16 (62%), Positives = 11/16 (68%)

Query: 115 RRKRSSRRSSRSRSRD 130
           R + SSR SSRS SR 
Sbjct: 155 RSRSSSRSSSRSNSRG 170


>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter
          pylori HP0827 protein and similar proteins.  This
          subfamily corresponds to the RRM of H. pylori HP0827, a
          putative ssDNA-binding protein 12rnp2 precursor,
          containing one RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). The ssDNA binding may be important in
          activation of HP0827. .
          Length = 78

 Score = 25.7 bits (57), Expect = 3.4
 Identities = 9/27 (33%), Positives = 15/27 (55%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPV 67
          +++    E+A  A+  LN   FGGR +
Sbjct: 45 FVEMETAEEANAAIEKLNGTDFGGRTL 71


>gnl|CDD|241102 cd12658, RRM1_MYEF2, RNA recognition motif 1 in vertebrate myelin
          expression factor 2 (MEF-2).  This subgroup corresponds
          to the RRM1 of MEF-2, also termed MyEF-2 or MST156, a
          sequence-specific single-stranded DNA (ssDNA) binding
          protein that binds specifically to ssDNA derived from
          the proximal (MB1) element of the myelin basic protein
          (MBP) promoter and represses transcription of the MBP
          gene. MEF-2 contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), which may be responsible
          for its ssDNA binding activity. .
          Length = 76

 Score = 25.7 bits (56), Expect = 3.6
 Identities = 13/50 (26%), Positives = 25/50 (50%)

Query: 18 DKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          +K GE+  + +  +      G   ++F+ EE  +KA+  +N     GRP+
Sbjct: 22 EKVGEVTYVELFKDAEGKSRGCGVVEFKDEEFVKKALEVMNKYDLNGRPL 71


>gnl|CDD|193577 cd09888, NGN_Euk, Eukaryotic N-Utilization Substance G (NusG)
          N-terminal (NGN) domain, including plant KTF1 (KOW
          domain-containing Transcription Factor 1).  The
          N-Utilization Substance G (NusG) protein and its
          eukaryotic homolog, Spt5, are involved in transcription
          elongation and termination. NusG contains an NGN domain
          at its N-terminus and Kyrpides Ouzounis and Woese (KOW)
          repeats at its C-terminus. Spt5 forms an Spt4-Spt5
          complex that is an essential RNA polymerase II
          elongation factor. NusG was originally discovered as an
          N-dependent antitermination enhancing activity in
          Escherichia coli, and has a variety of functions such
          as its involvement in RNA polymerase elongation and
          Rho-termination in bacteria. Orthologs of the NusG gene
          exist in all bacteria, but their functions and
          requirements are different. Spt5-like is homologous to
          the Spt5 proteins present in all eukaryotes, which is
          unique as it encodes a protein with an additional long
          carboxy-terminal extension that contains WG/GW motifs.
          Spt5-like, or KTF1 (KOW domain-containing Transcription
          Factor 1), is a RNA-directed DNA methylation (RdDM)
          pathway effector in plants.
          Length = 86

 Score = 25.6 bits (57), Expect = 3.6
 Identities = 9/26 (34%), Positives = 14/26 (53%)

Query: 34 DHLVGNVYIKFRREEDAEKAVNDLNN 59
          D L G +YI+ R+E   + A+  L  
Sbjct: 42 DGLKGYIYIEARKEAHVKDAIEGLRG 67


>gnl|CDD|234925 PRK01233, glyS, glycyl-tRNA synthetase subunit beta; Validated.
          Length = 682

 Score = 26.6 bits (60), Expect = 3.9
 Identities = 7/14 (50%), Positives = 10/14 (71%)

Query: 6   DNFFEDVFVECEDK 19
           D FF++V V  ED+
Sbjct: 641 DAFFDNVMVMAEDE 654


>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in
          heterogeneous nuclear ribonucleoprotein R (hnRNP R) and
          similar proteins.  This subfamily corresponds to the
          RRM3 in hnRNP R, hnRNP Q, and APOBEC-1 complementation
          factor (ACF). hnRNP R is a ubiquitously expressed
          nuclear RNA-binding protein that specifically bind
          mRNAs with a preference for poly(U) stretches and has
          been implicated in mRNA processing and mRNA transport,
          and also acts as a regulator to modify binding to
          ribosomes and RNA translation. hnRNP Q is also a
          ubiquitously expressed nuclear RNA-binding protein. It
          has been identified as a component of the spliceosome
          complex, as well as a component of the apobec-1
          editosome, and has been implicated in the regulation of
          specific mRNA transport. ACF is an RNA-binding subunit
          of a core complex that interacts with apoB mRNA to
          facilitate C to U RNA editing. It may also act as an
          apoB mRNA recognition factor and chaperone and play a
          key role in cell growth and differentiation. This
          family also includes two functionally unknown
          RNA-binding proteins, RBM46 and RBM47. All members
          contain three conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains).
          Length = 72

 Score = 25.3 bits (56), Expect = 3.9
 Identities = 8/27 (29%), Positives = 16/27 (59%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPV 67
          ++ F   +DA KA+ ++N +   G P+
Sbjct: 39 FVHFEERDDAVKAMEEMNGKELEGSPI 65


>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar
          protein 4 (Nop4p) and similar proteins.  This subgroup
          corresponds to the RRM1 of Nop4p (also known as
          Nop77p), encoded by YPL043W from Saccharomyces
          cerevisiae. It is an essential nucleolar protein
          involved in processing and maturation of 27S pre-rRNA
          and biogenesis of 60S ribosomal subunits. Nop4p has
          four RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 79

 Score = 25.6 bits (56), Expect = 3.9
 Identities = 9/25 (36%), Positives = 15/25 (60%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGR 65
          ++ F   EDA++A+  L N+   GR
Sbjct: 45 FVTFAMLEDAQEALAKLKNKKLHGR 69


>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in
          serine/arginine-rich splicing factor 4 (SRSF4) and
          similar proteins.  This subfamily corresponds to the
          RRM1 in three serine/arginine (SR) proteins:
          serine/arginine-rich splicing factor 4 (SRSF4 or SRp75
          or SFRS4), serine/arginine-rich splicing factor 5
          (SRSF5 or SRp40 or SFRS5 or HRS), serine/arginine-rich
          splicing factor 6 (SRSF6 or SRp55). SRSF4 plays an
          important role in both, constitutive  and alternative,
          splicing of many pre-mRNAs. It can shuttle between the
          nucleus and cytoplasm. SRSF5 regulates both alternative
          splicing and basal splicing. It is the only SR protein
          efficiently selected from nuclear extracts (NE) by the
          splicing enhancer (ESE) and essential for enhancer
          activation. SRSF6 preferentially interacts with a
          number of purine-rich splicing enhancers (ESEs) to
          activate splicing of the ESE-containing exon. It is the
          only protein from HeLa nuclear extract or purified SR
          proteins that specifically binds B element RNA after UV
          irradiation. SRSF6 may also recognize different types
          of RNA sites. Members in this family contain two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a C-terminal RS domains rich in
          serine-arginine dipeptides. .
          Length = 70

 Score = 25.4 bits (56), Expect = 4.0
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 7/54 (12%)

Query: 19 KYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAELS 72
           YG I E+N+ +  G       +++F    DA+ AV +LN +   G  V  E +
Sbjct: 22 GYGRIREINLKNGFG-------FVEFEDPRDADDAVYELNGKELCGERVIVEHA 68


>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering
          time control protein FCA and similar proteins.  This
          subgroup corresponds to the RRM1 of FCA, a gene
          controlling flowering time in Arabidopsis, encoding a
          flowering time control protein that functions in the
          posttranscriptional regulation of transcripts involved
          in the flowering process. FCA contains two RNA
          recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNP (ribonucleoprotein domains),
          and a WW protein interaction domain. .
          Length = 80

 Score = 25.7 bits (56), Expect = 4.2
 Identities = 10/44 (22%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 18 DKYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNNR 60
          +++G + E+ +  D    H  G  ++K+   ++A++A+  L+N+
Sbjct: 21 EEHGNVLEVAIIKDKRTGHQQGCCFVKYSTRDEADRAIRALHNQ 64


>gnl|CDD|240992 cd12548, RRM_Set1A, RNA recognition motif in vertebrate
          histone-lysine N-methyltransferase Setd1A (Set1A).
          This subgroup corresponds to the RRM of Setd1A, also
          termed SET domain-containing protein 1A (Set1A), or
          lysine N-methyltransferase 2F, or Set1/Ash2 histone
          methyltransferase complex subunit Set1, a ubiquitously
          expressed vertebrates histone methyltransferase that
          exhibits high homology to yeast Set1. Set1A is
          localized to euchromatic nuclear speckles and
          associates with a complex containing six human homologs
          of the yeast Set1/COMPASS complex, including CXXC
          finger protein 1 (CFP1; homologous to yeast Spp1),
          Rbbp5 (homologous to yeast Swd1), Ash2 (homologous to
          yeast Bre2), Wdr5 (homologous to yeast Swd3), and Wdr82
          (homologous to yeast Swd2). Set1A contains an
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          an N- SET domain, and a C-terminal catalytic SET domain
          followed by a post-SET domain. In contrast to Set1B,
          Set1A additionally contains an HCF-1 binding motif that
          interacts with HCF-1 in vivo. .
          Length = 95

 Score = 25.7 bits (56), Expect = 4.3
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 3/68 (4%)

Query: 6  DNFFEDVFVECEDKYGEIEEMNVC--DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFG 63
          DN  E    +   K+GE+EE+ +        HL G   + F     A+  V  L+N    
Sbjct: 12 DNVREPFLADMCRKFGEVEEVEILLHPKTRKHL-GLARVLFTSTRGAKDTVKHLHNTSVM 70

Query: 64 GRPVYAEL 71
          G  ++A+L
Sbjct: 71 GNIIHAQL 78


>gnl|CDD|240888 cd12442, RRM_RBM48, RNA recognition motif in RNA-binding protein
          48 (RBM48) and similar proteins.  This subfamily
          corresponds to the RRM of RBM48, a putative RNA-binding
          protein of unknown function. It contains one RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). .
          Length = 100

 Score = 25.7 bits (57), Expect = 4.4
 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 20 YGEIEEMNVCDNLGDHLVGNVY-IKFRREEDAEKAVNDLNNR-WFGGR 65
          YG IEE  + D         VY IKF   + A  A   L+ R +FGG 
Sbjct: 34 YGTIEEYRLLDEYPCEEFTEVYLIKFETIQSARFAKRKLDERSFFGGL 81


>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast
          negative growth regulatory protein NGR1 (RBP1), yeast
          protein NAM8 and similar proteins.  This subfamily
          corresponds to the RRM3 of NGR1 and NAM8. NGR1, also
          termed RNA-binding protein RBP1, is a putative
          glucose-repressible protein that binds both RNA and
          single-stranded DNA (ssDNA) in yeast. It may function
          in regulating cell growth in early log phase, possibly
          through its participation in RNA metabolism. NGR1
          contains two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a glutamine-rich stretch that may
          be involved in transcriptional activity. In addition,
          NGR1 has an asparagine-rich region near the carboxyl
          terminus which also harbors a methionine-rich region.
          The family also includes protein NAM8, which is a
          putative RNA-binding protein that acts as a suppressor
          of mitochondrial splicing deficiencies when
          overexpressed in yeast. It may be a non-essential
          component of the mitochondrial splicing machinery. Like
          NGR1, NAM8 contains two RRMs. .
          Length = 72

 Score = 25.3 bits (56), Expect = 4.5
 Identities = 7/28 (25%), Positives = 12/28 (42%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPVY 68
          +++F     AE A+  L     GG  + 
Sbjct: 41 FVQFVHRAAAEAAIQQLQGTIIGGSRIR 68


>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in
          Mei2-like proteins and terminal EAR1-like proteins.
          This subfamily corresponds to the RRM2 of Mei2-like
          proteins from plant and fungi, terminal EAR1-like
          proteins from plant, and other eukaryotic homologs.
          Mei2-like proteins represent an ancient eukaryotic
          RNA-binding proteins family whose corresponding
          Mei2-like genes appear to have arisen early in
          eukaryote evolution, been lost from some lineages such
          as Saccharomyces cerevisiae and metazoans, and
          diversified in the plant lineage. The plant Mei2-like
          genes may function in cell fate specification during
          development, rather than as stimulators of meiosis. In
          the fission yeast Schizosaccharomyces pombe, the Mei2
          protein is an essential component of the switch from
          mitotic to meiotic growth. S. pombe Mei2 stimulates
          meiosis in the nucleus upon binding a specific
          non-coding RNA. The terminal EAR1-like protein 1 and 2
          (TEL1 and TEL2) are mainly found in land plants. They
          may play a role in the regulation of leaf initiation.
          All members in this family are putative RNA-binding
          proteins carrying three RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). In addition to the RRMs,
          the terminal EAR1-like proteins also contain TEL
          characteristic motifs that allow sequence and putative
          functional discrimination between them and Mei2-like
          proteins. .
          Length = 71

 Score = 25.3 bits (56), Expect = 4.9
 Identities = 11/50 (22%), Positives = 23/50 (46%), Gaps = 4/50 (8%)

Query: 18 DKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
           ++GE++++              +++F     AE A++ LN R F G  +
Sbjct: 23 SQFGEVKDIRETPLRPSQ----KFVEFYDIRAAEAALDALNGRPFLGGRL 68


>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in
          granule-associated RNA binding proteins (p40-TIA-1 and
          TIAR), and yeast nuclear and cytoplasmic polyadenylated
          RNA-binding protein PUB1.  This subfamily corresponds
          to the RRM3 of TIA-1, TIAR, and PUB1. Nucleolysin TIA-1
          isoform p40 (p40-TIA-1 or TIA-1) and nucleolysin
          TIA-1-related protein (TIAR) are granule-associated RNA
          binding proteins involved in inducing apoptosis in
          cytotoxic lymphocyte (CTL) target cells. They share
          high sequence similarity and are expressed in a wide
          variety of cell types. TIA-1 can be phosphorylated by a
          serine/threonine kinase that is activated during
          Fas-mediated apoptosis.TIAR is mainly localized in the
          nucleus of hematopoietic and nonhematopoietic cells. It
          is translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. Both TIA-1
          and TIAR bind specifically to poly(A) but not to
          poly(C) homopolymers. They are composed of three
          N-terminal highly homologous RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a glutamine-rich
          C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 and TIAR interact with
          RNAs containing short stretches of uridylates and their
          RRM2 can mediate the specific binding to uridylate-rich
          RNAs. The C-terminal auxiliary domain may be
          responsible for interacting with other proteins. In
          addition, TIA-1 and TIAR share a potential serine
          protease-cleavage site (Phe-Val-Arg) localized at the
          junction between their RNA binding domains and their
          C-terminal auxiliary domains. This subfamily also
          includes a yeast nuclear and cytoplasmic polyadenylated
          RNA-binding protein PUB1, termed ARS consensus-binding
          protein ACBP-60, or poly uridylate-binding protein, or
          poly(U)-binding protein, which has been identified as
          both a heterogeneous nuclear RNA-binding protein
          (hnRNP) and a cytoplasmic mRNA-binding protein (mRNP).
          It may be stably bound to a translationally inactive
          subpopulation of mRNAs within the cytoplasm. PUB1 is
          distributed in both, the nucleus and the cytoplasm, and
          binds to poly(A)+ RNA (mRNA or pre-mRNA). Although it
          is one of the major cellular proteins cross-linked by
          UV light to polyadenylated RNAs in vivo, PUB1 is
          nonessential for cell growth in yeast. PUB1 also binds
          to T-rich single stranded DNA (ssDNA); however, there
          is no strong evidence implicating PUB1 in the mechanism
          of DNA replication. PUB1 contains three RRMs, and a GAR
          motif (glycine and arginine rich stretch) that is
          located between RRM2 and RRM3. .
          Length = 73

 Score = 24.9 bits (55), Expect = 5.5
 Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 5/48 (10%)

Query: 20 YGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGRPV 67
          +G IEE+ V  +      G  +++F   E A  A+  +N     G+ V
Sbjct: 24 FGAIEEVRVFKD-----KGYAFVRFDTHEAAATAIVAVNGTSINGQTV 66


>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in
          heterogeneous nuclear ribonucleoprotein R (hnRNP R) and
          similar proteins.  This subfamily corresponds to the
          RRM1 in hnRNP R, hnRNP Q, APOBEC-1 complementation
          factor (ACF), and dead end protein homolog 1 (DND1).
          hnRNP R is a ubiquitously expressed nuclear RNA-binding
          protein that specifically binds mRNAs with a preference
          for poly(U) stretches. It has been implicated in mRNA
          processing and mRNA transport, and also acts as a
          regulator to modify binding to ribosomes and RNA
          translation. hnRNP Q is also a ubiquitously expressed
          nuclear RNA-binding protein. It has been identified as
          a component of the spliceosome complex, as well as a
          component of the apobec-1 editosome, and has been
          implicated in the regulation of specific mRNA
          transport. ACF is an RNA-binding subunit of a core
          complex that interacts with apoB mRNA to facilitate C
          to U RNA editing. It may also act as an apoB mRNA
          recognition factor and chaperone, and play a key role
          in cell growth and differentiation. DND1 is essential
          for maintaining viable germ cells in vertebrates. It
          interacts with the 3'-untranslated region (3'-UTR) of
          multiple messenger RNAs (mRNAs) and prevents micro-RNA
          (miRNA) mediated repression of mRNA. This family also
          includes two functionally unknown RNA-binding proteins,
          RBM46 and RBM47. All members in this family, except for
          DND1, contain three conserved RNA recognition motifs
          (RRMs); DND1 harbors only two RRMs. .
          Length = 78

 Score = 24.8 bits (55), Expect = 6.1
 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 7  NFFEDVFVECEDKYGEIEEMNVCDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWF-GGR 65
          + FED  V   +K G I E+ +  +      G  ++ +  +E A++AV  L+N     G+
Sbjct: 12 DLFEDELVPLFEKAGPIYELRLMMDFSGLNRGYAFVTYTNKEAAQRAVKQLHNYEIRPGK 71

Query: 66 PVYAELS 72
           +   +S
Sbjct: 72 RLGVCIS 78


>gnl|CDD|225131 COG2221, DsrA, Dissimilatory sulfite reductase (desulfoviridin),
          alpha and beta subunits [Energy production and
          conversion].
          Length = 317

 Score = 26.2 bits (58), Expect = 6.2
 Identities = 9/38 (23%), Positives = 16/38 (42%), Gaps = 5/38 (13%)

Query: 27 NVCDNLGDHLV-----GNVYIKFRREEDAEKAVNDLNN 59
          ++ +  GD L+       + I     EDA+  V +L  
Sbjct: 52 DIAEKYGDGLIHITSRQGLEIPGISPEDADDVVEELRE 89


>gnl|CDD|238755 cd01478, Sec23-like, Sec23-like: Protein and membrane traffic in
           eukaryotes is mediated by at least in part by the
           budding and fusion of intracellular transport vesicles
           that selectively carry cargo proteins and lipids from
           donor to acceptor organelles. The two main classes of
           vesicular carriers within the endocytic and the
           biosynthetic pathways are COP- and clathrin-coated
           vesicles. Formation of COPII vesicles requires the
           ordered assembly of the coat built from several
           cytosolic components GTPase Sar1, complexes of
           Sec23-Sec24 and Sec13-Sec31. The process is initiated by
           the conversion of GDP to GTP by the GTPase Sar1 which
           then recruits the heterodimeric complex of Sec23 and
           Sec24. This heterodimeric complex generates the
           pre-budding complex. The final step leading to membrane
           deformation and budding of COPII-coated vesicles is
           carried by the heterodimeric complex Sec13-Sec31. The
           members of this CD belong to the Sec23-like family. Sec
           23 is very similar to Sec24. The Sec23 and Sec24
           polypeptides fold into five distinct domains: a
           beta-barrel, a zinc finger, a vWA or trunk, an all
           helical region and a carboxy Gelsolin domain. The
           members of this subgroup lack the consensus MIDAS motif
           but have the overall Para-Rossmann type fold that is
           characteristic of this superfamily.
          Length = 267

 Score = 26.2 bits (58), Expect = 6.2
 Identities = 11/44 (25%), Positives = 21/44 (47%), Gaps = 9/44 (20%)

Query: 3   EHYDNFFE---------DVFVECEDKYGEIEEMNVCDNLGDHLV 37
           + YD+  +         D+F  C D+ G +E   + ++ G H+V
Sbjct: 208 KFYDSLAKRLAANGHAVDIFAGCLDQVGLLEMKVLVNSTGGHVV 251


>gnl|CDD|163713 cd08157, catalase_fungal, Fungal catalases similar to yeast
           catalases A and T.  Catalase is a ubiquitous enzyme
           found in both prokaryotes and eukaryotes, which is
           involved in the protection of cells from the toxic
           effects of peroxides. It catalyzes the conversion of
           hydrogen peroxide to water and molecular oxygen.
           Catalases also utilize hydrogen peroxide to oxidize
           various substrates such as alcohol or phenols. This
           family of fungal catalases has a relatively small
           subunit size, and binds a protoheme IX (heme b) group
           buried deep inside the structure. Fungal catalases also
           bind NADPH as a second redox-active cofactor. They form
           tetramers; in eukaryotic cells, catalases are typically
           located in peroxisomes. Saccharomyces cerevisiae
           catalase T is found in the cytoplasm, though.
          Length = 451

 Score = 26.2 bits (58), Expect = 6.7
 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 7/42 (16%)

Query: 33  GDHLVGNVYIKFRREEDAEK---AVNDLNNRW----FGGRPV 67
           GD+    VY++    E AEK    + DL   W    F  RPV
Sbjct: 221 GDYPSWTVYVQVMTPEQAEKLRFNIFDLTKVWPHKDFPLRPV 262


>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast
          negative growth regulatory protein NGR1, yeast protein
          NAM8 and similar proteins.  This subgroup corresponds
          to the RRM2 of NGR1 and NAM8. NGR1, also termed
          RNA-binding protein RBP1, is a putative
          glucose-repressible protein that binds both, RNA and
          single-stranded DNA (ssDNA), in yeast. It may function
          in regulating cell growth in early log phase, possibly
          through its participation in RNA metabolism. NGR1
          contains two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a glutamine-rich stretch that may
          be involved in transcriptional activity. In addition,
          NGR1 has an asparagine-rich region near the carboxyl
          terminus which also harbors a methionine-rich region.
          The family also includes protein NAM8, which is a
          putative RNA-binding protein that acts as a suppressor
          of mitochondrial splicing deficiencies when
          overexpressed in yeast. It may be a non-essential
          component of the mitochondrial splicing machinery. Like
          NGR1, NAM8 contains two RRMs. .
          Length = 80

 Score = 24.8 bits (54), Expect = 6.9
 Identities = 8/27 (29%), Positives = 18/27 (66%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPV 67
          +++F  E D ++A+ ++   + GGRP+
Sbjct: 48 FVRFSDENDQQRALIEMQGVYCGGRPM 74


>gnl|CDD|240699 cd12253, RRM_PIN4_like, RNA recognition motif in yeast
          RNA-binding protein PIN4, fission yeast RNA-binding
          post-transcriptional regulators cip1, cip2 and similar
          proteins.  This subfamily corresponds to the RRM in
          PIN4, also termed psi inducibility protein 4 or
          modifier of damage tolerance Mdt1, a novel
          phosphothreonine (pThr)-containing protein that
          specifically interacts with the pThr-binding site of
          the Rad53 FHA1 domain. It is encoded by gene MDT1
          (YBL051C) from yeast Saccharomyces cerevisiae. PIN4 is
          involved in normal G2/M cell cycle progression in the
          absence of DNA damage and functions as a novel target
          of checkpoint-dependent cell cycle arrest pathways. It
          contains an N-terminal RRM, a nuclear localization
          signal, a coiled coil, and a total of 15 SQ/TQ motifs.
          cip1 (Csx1-interacting protein 1) and cip2
          (Csx1-interacting protein 2) are novel cytoplasmic
          RRM-containing proteins that counteract Csx1 function
          during oxidative stress. They are not essential for
          viability in fission yeast Schizosaccharomyces pombe.
          Both cip1 and cip2 contain one RRM. Like PIN4, Cip2
          also possesses an R3H motif that may function in
          sequence-specific binding to single-stranded nucleic
          acids. .
          Length = 79

 Score = 24.7 bits (54), Expect = 7.1
 Identities = 11/33 (33%), Positives = 15/33 (45%)

Query: 38 GNVYIKFRREEDAEKAVNDLNNRWFGGRPVYAE 70
          G  +  FR  E+A+  V  LN     GR +  E
Sbjct: 44 GLAFANFRSPEEAQTVVEALNGYEISGRRLRVE 76


>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic
          translation initiation factor 3 subunit G (eIF-3G) and
          similar proteins.  This subfamily corresponds to the
          RRM of eIF-3G and similar proteins. eIF-3G, also termed
          eIF-3 subunit 4, or eIF-3-delta, or eIF3-p42, or
          eIF3-p44, is the RNA-binding subunit of eIF3, a large
          multisubunit complex that plays a central role in the
          initiation of translation by binding to the 40 S
          ribosomal subunit and promoting the binding of
          methionyl-tRNAi and mRNA. eIF-3G binds 18 S rRNA and
          beta-globin mRNA, and therefore appears to be a
          nonspecific RNA-binding protein. eIF-3G is one of the
          cytosolic targets and interacts with mature
          apoptosis-inducing factor (AIF). eIF-3G contains one
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). This
          family also includes yeast eIF3-p33, a homolog of
          vertebrate eIF-3G, plays an important role in the
          initiation phase of protein synthesis in yeast. It
          binds both, mRNA and rRNA, fragments due to an RRM near
          its C-terminus. .
          Length = 77

 Score = 24.8 bits (55), Expect = 7.5
 Identities = 8/18 (44%), Positives = 12/18 (66%)

Query: 41 YIKFRREEDAEKAVNDLN 58
          ++ F   EDAE+A+  LN
Sbjct: 45 FVTFHTREDAERAIEKLN 62


>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2
          and similar proteins.  This subfamily corresponds to
          the RRM1 of yeast protein gar2, a novel nucleolar
          protein required for 18S rRNA and 40S ribosomal subunit
          accumulation. It shares similar domain architecture
          with nucleolin from vertebrates and NSR1 from
          Saccharomyces cerevisiae. The highly phosphorylated
          N-terminal domain of gar2 is made up of highly acidic
          regions separated from each other by basic sequences,
          and contains multiple phosphorylation sites. The
          central domain of gar2 contains two closely adjacent
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RGG (or GAR) domain of gar2 is
          rich in glycine, arginine and phenylalanine residues. .
          Length = 76

 Score = 24.7 bits (54), Expect = 7.9
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 41 YIKFRREEDAEKAVNDLNNRWFGGRPVYAELS 72
          Y+ F   EDA+KA+  ++ +   GRP+  + S
Sbjct: 45 YVDFESPEDAKKAIEAMDGKELDGRPINVDFS 76


>gnl|CDD|148918 pfam07566, DUF1543, Domain of Unknown Function (DUF1543).  This
          domain is found as 1-2 copies in a small family of
          proteins of unknown function.
          Length = 52

 Score = 24.1 bits (53), Expect = 8.1
 Identities = 7/18 (38%), Positives = 10/18 (55%)

Query: 48 EDAEKAVNDLNNRWFGGR 65
          +  E+A   L  RWFG +
Sbjct: 14 DSIEEAKPRLRRRWFGDK 31


>gnl|CDD|216236 pfam01003, Flavi_capsid, Flavivirus capsid protein C.  Flaviviruses
           are small enveloped viruses with virions comprised of 3
           proteins called C, M and E. Multiple copies of the C
           protein form the nucleocapsid, which contains the ssRNA
           molecule.
          Length = 117

 Score = 25.0 bits (55), Expect = 8.3
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 100 HLKPISRELRRYLYSRRKRSSRRSSR 125
           HL+   +E+   L    +R  RRS R
Sbjct: 74  HLRKFKKEVGTLLDGLNRRGKRRSKR 99


>gnl|CDD|221931 pfam13136, DUF3984, Protein of unknown function (DUF3984).  This
           family of proteins is functionally uncharacterized. This
           family of proteins is found in eukaryotes. Proteins in
           this family are typically between 393 and 442 amino
           acids in length.
          Length = 301

 Score = 25.8 bits (57), Expect = 8.4
 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 9/34 (26%)

Query: 105 SRELRRYLYSRRKRS---------SRRSSRSRSR 129
            RE      SRR RS         SRR SRS SR
Sbjct: 172 EREHSSRRASRRGRSGYSTPSAALSRRGSRSASR 205


>gnl|CDD|227502 COG5175, MOT2, Transcriptional repressor [Transcription].
          Length = 480

 Score = 25.8 bits (56), Expect = 8.8
 Identities = 14/61 (22%), Positives = 26/61 (42%), Gaps = 5/61 (8%)

Query: 40  VYIKFRREEDAEKAVNDLNNRWFGGRPVYAELSPVTDFREACCRQYEMGECTRSGFCNFM 99
           VYI +  +EDA + + +++     GR + A     T +    C  Y       +  C ++
Sbjct: 168 VYITYSTKEDAARCIAEVDGSLLDGRVLKATYG-TTKY----CTSYLRNAVCPNPDCMYL 222

Query: 100 H 100
           H
Sbjct: 223 H 223


>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in
          serine/arginine-rich splicing factor SRSF2, SRSF8 and
          similar proteins.  This subfamily corresponds to the
          RRM of SRSF2 and SRSF8. SRSF2, also termed protein
          PR264, or splicing component, 35 kDa (splicing factor
          SC35 or SC-35), is a prototypical SR protein that plays
          important roles in the alternative splicing of
          pre-mRNA. It is also involved in transcription
          elongation by directly or indirectly mediating the
          recruitment of elongation factors to the C-terminal
          domain of polymerase II. SRSF2 is exclusively localized
          in the nucleus and is restricted to nuclear processes.
          It contains a single N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by a C-terminal RS
          domain rich in serine-arginine dipeptides. The RRM is
          responsible for the specific recognition of 5'-SSNG-3'
          (S=C/G) RNA. In the regulation of alternative splicing
          events, it specifically binds to cis-regulatory
          elements on the pre-mRNA. The RS domain modulates SRSF2
          activity through phosphorylation, directly contacts
          RNA, and promotes protein-protein interactions with the
          spliceosome. SRSF8, also termed SRP46 or SFRS2B, is a
          novel mammalian SR splicing factor encoded by a
          PR264/SC35 functional retropseudogene. SRSF8 is
          localized in the nucleus and does not display the same
          activity as PR264/SC35. It functions as an essential
          splicing factor in complementing a HeLa cell S100
          extract deficient in SR proteins. Like SRSF2, SRSF8
          contains a single N-terminal RRM and a C-terminal RS
          domain. .
          Length = 73

 Score = 24.6 bits (54), Expect = 8.9
 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 15 ECEDKYGEIEEMNVC-DNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGR 65
             +KYGE+ ++ +  D       G  +++F  + DAE A++ ++ +   GR
Sbjct: 17 RVFEKYGEVGDVYIPRDRYTRESRGFAFVRFYDKRDAEDAMDAMDGKELDGR 68


>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding
          protein 19 (RBM19) and similar proteins.  This subgroup
          corresponds to the RRM3 of RBM19, also termed
          RNA-binding domain-1 (RBD-1), which is a nucleolar
          protein conserved in eukaryotes. It is involved in
          ribosome biogenesis by processing rRNA. In addition, it
          is essential for preimplantation development. RBM19 has
          a unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 79

 Score = 24.7 bits (54), Expect = 9.7
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 19 KYGEIEEMNV-CDNLGDHLVGNVYIKFRREEDAEKAVNDLNNRWFGGR 65
          KYG + E+++  D L     G  ++ +   E A KA  +L+   F GR
Sbjct: 25 KYGPLSEVHLPIDKLTKKPKGFAFVTYMIPEHAVKAFAELDGTVFQGR 72


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.323    0.138    0.430 

Gapped
Lambda     K      H
   0.267   0.0683    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 6,779,604
Number of extensions: 597834
Number of successful extensions: 1070
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1029
Number of HSP's successfully gapped: 197
Length of query: 130
Length of database: 10,937,602
Length adjustment: 86
Effective length of query: 44
Effective length of database: 7,123,158
Effective search space: 313418952
Effective search space used: 313418952
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.3 bits)