Query         psy17810
Match_columns 62
No_of_seqs    112 out of 191
Neff          3.5 
Searched_HMMs 46136
Date          Fri Aug 16 23:37:46 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17810.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17810hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3558|consensus               99.5 2.6E-15 5.6E-20  121.5   3.1   56    1-57     71-126 (768)
  2 KOG3559|consensus               99.3 5.6E-13 1.2E-17  105.0   2.1   58    1-58     26-87  (598)
  3 KOG3560|consensus               99.2 4.4E-12 9.5E-17  102.0   3.2   60    1-60     50-114 (712)
  4 PF00010 HLH:  Helix-loop-helix  95.2  0.0099 2.1E-07   32.8   1.2   26    1-26     26-52  (55)
  5 cd00083 HLH Helix-loop-helix d  95.1   0.013 2.9E-07   32.0   1.4   26    2-28     30-55  (60)
  6 smart00353 HLH helix loop heli  94.9   0.015 3.3E-07   31.4   1.4   20    8-27     27-46  (53)
  7 KOG3561|consensus               69.8     3.1 6.6E-05   35.3   1.8   27    6-32     50-76  (803)
  8 KOG4029|consensus               54.9     6.9 0.00015   27.2   1.2   23    9-31    142-164 (228)
  9 KOG4304|consensus               48.1      14 0.00031   26.9   2.0   24    9-32     69-92  (250)
 10 TIGR03331 SAM_DCase_Eco S-aden  36.0      13 0.00029   27.9   0.2   13    3-15     98-110 (259)
 11 PRK05462 S-adenosylmethionine   33.8      15 0.00033   27.7   0.2   13    3-15    102-114 (266)
 12 COG5485 Predicted ester cyclas  31.7      15 0.00033   25.2  -0.0   13    7-19    116-128 (131)

No 1  
>KOG3558|consensus
Probab=99.54  E-value=2.6e-15  Score=121.52  Aligned_cols=56  Identities=59%  Similarity=0.895  Sum_probs=43.0

Q ss_pred             CCCCchHHhhccchhhhhHhhHHHHHHHHhhcCCCCCCCCCCCCCCCcccCcccccc
Q psy17810          1 MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWSRDGPSPSKSVKGIPHNLQ   57 (62)
Q Consensus         1 lLPlp~~v~s~LDKaSImRLtisyLr~r~~~~~~~~~w~~~~~~~~~t~~lgshlLQ   57 (62)
                      +||||++|++||||||||||||||||||+|+.+++++ ...++.++.-.-.+.|.||
T Consensus        71 ~lPlp~aisshLDkaSimRLtISyLRlrk~a~~g~~p-~~e~~~~~~e~~l~~~iLq  126 (768)
T KOG3558|consen   71 LLPLPAAISSHLDKASIMRLTISYLRLRKFAGAGDPP-RAEGEPENLEQHLGDHILQ  126 (768)
T ss_pred             hCCCcchhhhhhhhHHHHHHHHHHHHHHHHhhcCCcc-cccCCCcchhhhhhhhHHh
Confidence            5999999999999999999999999999999999765 2233333322235566665


No 2  
>KOG3559|consensus
Probab=99.32  E-value=5.6e-13  Score=105.05  Aligned_cols=58  Identities=50%  Similarity=0.651  Sum_probs=49.6

Q ss_pred             CCCCchHHhhccchhhhhHhhHHHHHHHHhhcCCC-CCCCCC---CCCCCCcccCccccccc
Q psy17810          1 MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGD-PPWSRD---GPSPSKSVKGIPHNLQE   58 (62)
Q Consensus         1 lLPlp~~v~s~LDKaSImRLtisyLr~r~~~~~~~-~~w~~~---~~~~~~t~~lgshlLQe   58 (62)
                      +||||.+|++|||||||+|||.||||||.+|+.|+ ..|+..   .+-......+|+|+||+
T Consensus        26 lLPLa~AItsQlDKasiiRLtTsYlKmr~vFPeGLGeawg~~S~a~~~~g~~~elgshlLqt   87 (598)
T KOG3559|consen   26 LLPLASAITSQLDKASIIRLTTSYLKMRNVFPEGLGEAWGASSRADPLDGVDKELGSHLLQT   87 (598)
T ss_pred             hccchhhhhhccchhhhhhHHHHHHHHHHhcccccchhccCCCccccccchHHHHHHhHHHh
Confidence            69999999999999999999999999999998876 688753   34445566888999986


No 3  
>KOG3560|consensus
Probab=99.23  E-value=4.4e-12  Score=101.97  Aligned_cols=60  Identities=35%  Similarity=0.492  Sum_probs=46.1

Q ss_pred             CCCCchHHhhccchhhhhHhhHHHHHHHHhhcCCCCCC--CCCCCCCCCcc-c-Cc-ccccccCC
Q psy17810          1 MLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPW--SRDGPSPSKSV-K-GI-PHNLQEGQ   60 (62)
Q Consensus         1 lLPlp~~v~s~LDKaSImRLtisyLr~r~~~~~~~~~w--~~~~~~~~~t~-~-lg-shlLQeg~   60 (62)
                      |||||.+|+++|||.||+||++||||.|+||+......  ...+..+++.. . .+ +..|+||.
T Consensus        50 LLPfpqdiisKLDkLSVLRLSVSyLr~KSfFqvvl~~s~~~~~gg~~s~~a~~~yr~gl~llege  114 (712)
T KOG3560|consen   50 LLPFPQDIISKLDKLSVLRLSVSYLRVKSFFQVVLHQSSRQPAGGPPSPHASCPYRNGLALLEGE  114 (712)
T ss_pred             hcCCCHHHHhhhhhhhhhhhhHHHHHHHHHHHHHHhcCccccCCCCCCccccchhhccccccchH
Confidence            69999999999999999999999999999998765433  23455555422 2 33 66788874


No 4  
>PF00010 HLH:  Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt).;  InterPro: IPR011598 The helix-loop-helix (HLH) DNA-binding domain consists of a closed bundle of four helices in a left-handed twist with two crossover connections. The HLH domain directs dimerisation, and is juxtaposed to basic regions to create a DNA interaction interface surface that recognises specific DNA sequences. Basic region/HLH (bHLH) proteins regulate diverse biological pathways []. bHLH proteins include MyoD [], SREBPs (sterol regulatory element binding proteins) [], and yeast Pho4 (phosphatase system) []. In certain proteins the bHLH domain contains a leucine-zipper motif. The bHLH/leucine zipper (bHLHZip) domain specifies dimerisation within a network of proteins and determines sequence-specific DNA binding []. bHLHZip domains occur in the transcription factors Myc, Mad, Max and Usf [, ].  This entry is bHLHZip, which covers the bHLH domain and the leucine zipper motif, when present.; PDB: 1NLW_A 1NKP_D 1A93_A 2A93_A 1AM9_C 3U5V_A 1A0A_B 2QL2_C 1UKL_C 1AN4_B ....
Probab=95.25  E-value=0.0099  Score=32.83  Aligned_cols=26  Identities=42%  Similarity=0.648  Sum_probs=20.3

Q ss_pred             CCCCc-hHHhhccchhhhhHhhHHHHH
Q psy17810          1 MLPLP-AAITSQLDKASIIRLTISYLK   26 (62)
Q Consensus         1 lLPlp-~~v~s~LDKaSImRLtisyLr   26 (62)
                      +||.. ......+||++|+..++.|++
T Consensus        26 llp~~~~~~~~k~~K~~iL~~ai~yI~   52 (55)
T PF00010_consen   26 LLPSCSAGSSRKLSKASILQKAIDYIK   52 (55)
T ss_dssp             CCSSHHCCTTSSSSHHHHHHHHHHHHH
T ss_pred             hccchhccccccCCHHHHHHHHHHHHH
Confidence            35663 135678999999999999986


No 5  
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long. A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and 
Probab=95.07  E-value=0.013  Score=31.97  Aligned_cols=26  Identities=35%  Similarity=0.542  Sum_probs=20.6

Q ss_pred             CCCchHHhhccchhhhhHhhHHHHHHH
Q psy17810          2 LPLPAAITSQLDKASIIRLTISYLKLR   28 (62)
Q Consensus         2 LPlp~~v~s~LDKaSImRLtisyLr~r   28 (62)
                      +|... ...++||++|+..++.|++--
T Consensus        30 lp~~~-~~~k~~k~~iL~~a~~yI~~L   55 (60)
T cd00083          30 LPTLP-PSKKLSKAEILRKAVDYIKSL   55 (60)
T ss_pred             CCCCC-CCCCCCHHHHHHHHHHHHHHH
Confidence            44444 467999999999999998754


No 6  
>smart00353 HLH helix loop helix domain.
Probab=94.94  E-value=0.015  Score=31.39  Aligned_cols=20  Identities=45%  Similarity=0.693  Sum_probs=17.5

Q ss_pred             HhhccchhhhhHhhHHHHHH
Q psy17810          8 ITSQLDKASIIRLTISYLKL   27 (62)
Q Consensus         8 v~s~LDKaSImRLtisyLr~   27 (62)
                      ...++||++|+..+++|++-
T Consensus        27 ~~~k~~k~~iL~~ai~yi~~   46 (53)
T smart00353       27 NNKKLSKAEILRLAIEYIKS   46 (53)
T ss_pred             CCCCCCHHHHHHHHHHHHHH
Confidence            46789999999999999853


No 7  
>KOG3561|consensus
Probab=69.75  E-value=3.1  Score=35.25  Aligned_cols=27  Identities=22%  Similarity=0.429  Sum_probs=22.9

Q ss_pred             hHHhhccchhhhhHhhHHHHHHHHhhc
Q psy17810          6 AAITSQLDKASIIRLTISYLKLRDFSG   32 (62)
Q Consensus         6 ~~v~s~LDKaSImRLtisyLr~r~~~~   32 (62)
                      .+..-++||..|+|-||.+||..+-+.
T Consensus        50 ~~~~RK~DK~tVLr~aV~~lr~~k~~~   76 (803)
T KOG3561|consen   50 ASLSRKPDKLTVLRMAVDHLRLIKEQE   76 (803)
T ss_pred             hhcccCchHHHHHHHHHHHHHHHhhhh
Confidence            344578999999999999999988863


No 8  
>KOG4029|consensus
Probab=54.86  E-value=6.9  Score=27.20  Aligned_cols=23  Identities=26%  Similarity=0.434  Sum_probs=19.4

Q ss_pred             hhccchhhhhHhhHHHHHHHHhh
Q psy17810          9 TSQLDKASIIRLTISYLKLRDFS   31 (62)
Q Consensus         9 ~s~LDKaSImRLtisyLr~r~~~   31 (62)
                      .+.|=|..++|++++|+++-.-+
T Consensus       142 ~kklSKveTLr~A~~YI~~L~~l  164 (228)
T KOG4029|consen  142 SKKLSKVETLRLATSYIRYLTKL  164 (228)
T ss_pred             ccccCcccchHHHHHHHHHHHHH
Confidence            57888999999999999875544


No 9  
>KOG4304|consensus
Probab=48.07  E-value=14  Score=26.88  Aligned_cols=24  Identities=38%  Similarity=0.466  Sum_probs=20.9

Q ss_pred             hhccchhhhhHhhHHHHHHHHhhc
Q psy17810          9 TSQLDKASIIRLTISYLKLRDFSG   32 (62)
Q Consensus         9 ~s~LDKaSImRLtisyLr~r~~~~   32 (62)
                      .++|+||=|+=+|+-|||..+-.+
T Consensus        69 ~sklEKAdILEltV~hL~~l~~~~   92 (250)
T KOG4304|consen   69 HSKLEKADILELTVNHLRQLQRSQ   92 (250)
T ss_pred             hhhhHHHHHHHHHHHHHHHHhccc
Confidence            489999999999999999877654


No 10 
>TIGR03331 SAM_DCase_Eco S-adenosylmethionine decarboxylase proenzyme, Escherichia coli form. Members of this protein family are the single chain precursor of the S-adenosylmethionine decarboxylase as found in Escherichia coli. This form shows a substantially different architecture from the form shared by the Archaea, Bacillus, and many other species (TIGR03330). It shows little or no similarity to the form found in eukaryotes (TIGR00535).
Probab=36.03  E-value=13  Score=27.92  Aligned_cols=13  Identities=54%  Similarity=1.017  Sum_probs=12.1

Q ss_pred             CCchHHhhccchh
Q psy17810          3 PLPAAITSQLDKA   15 (62)
Q Consensus         3 Plp~~v~s~LDKa   15 (62)
                      |+|..|.+||||.
T Consensus        98 p~~~~vvahLdkS  110 (259)
T TIGR03331        98 PLPDAVVAHLDKS  110 (259)
T ss_pred             CCccchhcccccC
Confidence            8899999999996


No 11 
>PRK05462 S-adenosylmethionine decarboxylase; Provisional
Probab=33.82  E-value=15  Score=27.74  Aligned_cols=13  Identities=46%  Similarity=0.979  Sum_probs=12.2

Q ss_pred             CCchHHhhccchh
Q psy17810          3 PLPAAITSQLDKA   15 (62)
Q Consensus         3 Plp~~v~s~LDKa   15 (62)
                      |+|..|.+||||.
T Consensus       102 p~~~~vvahLdkS  114 (266)
T PRK05462        102 PLPETVVAHLDKS  114 (266)
T ss_pred             CCccchhcccccc
Confidence            8999999999996


No 12 
>COG5485 Predicted ester cyclase [General function prediction only]
Probab=31.70  E-value=15  Score=25.19  Aligned_cols=13  Identities=38%  Similarity=0.447  Sum_probs=11.2

Q ss_pred             HHhhccchhhhhH
Q psy17810          7 AITSQLDKASIIR   19 (62)
Q Consensus         7 ~v~s~LDKaSImR   19 (62)
                      ++-+++||++|+|
T Consensus       116 ~vwsv~Dk~ai~r  128 (131)
T COG5485         116 EVWSVIDKMAIER  128 (131)
T ss_pred             eeehhccHHHHHH
Confidence            4568999999998


Done!