Diaphorina citri psyllid: psy17827


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MMPVPIYTVDADKGFNFSNADDAFVCQKKNHFQITCHTQLQGDPQFVKTPEGMRKITSFHLHFYGVKVESLTQTIKVEQSQSDRSKKAFHPVLPVPIYTVDADKGFNFSNADDAFVCQKKNHFQDRIFMESVGAVKELCKVTQNLENRIEDETTSNNMRKKGKPNPDQRYFYLVVGLHAHCSDSNHYPIVSHASERIIVRASNPGQFESDVELCWQRGSSPESVFHSGRVGINTERPDEALVVHGNVKLTGHIIQPSDIRAKQHITKCNTKEQLRNVQQLNVVQFHYTPEFALHFGLAS
cccccEEEEEEccccccccccccEEEEEcccEEEEEEEECcccccEEEcccccCEEEEEEEEEEEEEEccccEEEEEEECccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccEEEEcccccccccccccccccccEEEEEEEEEECccccCEEEEEccccccEEEccccccccccccccccccccccCEEECcEEEEccccccccEEEEEEEEEEEEEEccccHHHHcccccccHHHHHHHccccEEEEEECcHHHHHHccccc
*MPVPIYTVDADKGFNFSNADDAFVCQKKNHFQITCHTQLQGDPQFVKTPEGMRKITSFHLHFYGVKVESLTQTIK***********AFHPVLPVPIYTVDADKGFNFSNADDAFVCQKKNHFQDR******GAVKELCKVTQNLENRIEDE***************QRYFYLVVGLHAHCSDSNHYPIVSHASERIIVRASNPGQFESDVELCWQR*SSPESVFHSGRVGINTERPDEALVVHGNVKLTGHIIQPSDIRAKQHITKCNTKEQLRNVQQLNVVQFHYTPEFALHFGL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMPVPIYTVDADKGFNFSNADDAFVCQKKNHFQITCHTQLQGDPQFVKTPEGMRKITSFHLHFYGVKVESLTQTIKVEQSQSDRSKKAFHPVLPVPIYTVDADKGFNFSNADDAFVCQKKNHFQDRIFMESVGAVKELCKVTQNLENRIEDETTSNNMRKKGKPNPDQRYFYLVVGLHAHCSDSNHYPIVSHASERIIVRASNPGQFESDVELCWQRGSSPESVFHSGRVGINTERPDEALVVHGNVKLTGHIIQPSDIRAKQHITKCNTKEQLRNVQQLNVVQFHYTPEFALHFGLAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Myelin regulatory factor Transcription regulator required for expression of central nervous system (CNS) myelin genes such as MBP and MOG, thereby playing a central role in oligodendrocyte maturation and CNS myelination. Probably acts as a transcription factor that directly binds DNA and activates expression of CNS myelin genes.confidentQ9Y2G1
Myelin regulatory factor Transcription regulator required for expression of CNS myelin genes such as Mbp and Mog, thereby playing a central role in oligodendrocyte maturation and central nervous system (CNS) myelination. Probably acts as a transcription factor that directly binds DNA and activates expression of CNS myelin genes.confidentQ3UR85

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MNN, chain A
Confidence level:very confident
Coverage over the Query: 3-211
View the alignment between query and template
View the model in PyMOL
Template: 3GW6, chain A
Confidence level:probable
Coverage over the Query: 253-294
View the alignment between query and template
View the model in PyMOL