Diaphorina citri psyllid: psy17844

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
NQEYIALGENVIEYNPQFRLYLTTKLRNPHYLPEVFNKVTVVNFALTVFGLEDQLLGIVVAKERPDLQTKRDELIVQGASNKKALKEVEDMILHTLSSSTGNILEDPNAVDVLDSSKVHDSKIGGFI
cccEEEEccCEEccccccEEEEEccccccccccHHHHHHHEEccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccc
*QEYIALGENVIEYNPQFRLYLTTKLRNPHYLPEVFNKVTVVNFALTVFGLEDQLLGIVVAKERPDLQTKRDELIVQGASNKKALKEVEDMILHTLSSSTGNILEDPNAVDVLDSSKVHDSKIGGFI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NQEYIALGENVIEYNPQFRLYLTTKLRNPHYLPEVFNKVTVVNFALTVFGLEDQLLGIVVAKERPDLQTKRDELIVQGASNKKALKEVEDMILHTLSSSTGNILEDPNAVDVLDSSKVHDSKIGGFI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dynein heavy chain 7, axonemal Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP.confidentQ8WXX0
Dynein heavy chain 7, axonemal Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP.confidentQ63170

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0017111 [MF]nucleoside-triphosphatase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0016462, GO:0003674
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0035085 [CC]cilium axonemeprobableGO:0005737, GO:0005575, GO:0044463, GO:0043231, GO:0032838, GO:0031514, GO:0044441, GO:0044464, GO:0043229, GO:0005623, GO:0043226, GO:0044446, GO:0044444, GO:0097014, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0005930, GO:0044422, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3vkg, chain A very confident Alignment | Template Structure