Query         psy17851
Match_columns 60
No_of_seqs    133 out of 1004
Neff          7.1 
Searched_HMMs 46136
Date          Sat Aug 17 00:41:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17851.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17851hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PTZ00014 myosin-A; Provisional  99.7 5.8E-18 1.3E-22  122.9   6.1   58    1-58    402-459 (821)
  2 cd01381 MYSc_type_VII Myosin m  99.7 8.7E-18 1.9E-22  119.9   6.2   56    1-56    301-356 (671)
  3 cd01385 MYSc_type_IX Myosin mo  99.7 8.4E-18 1.8E-22  120.3   6.1   58    1-58    313-370 (692)
  4 COG5022 Myosin heavy chain [Cy  99.7 4.8E-18   1E-22  127.3   4.8   58    1-58    368-425 (1463)
  5 cd01379 MYSc_type_III Myosin m  99.7 9.8E-18 2.1E-22  119.4   6.0   57    1-57    308-364 (653)
  6 cd01383 MYSc_type_VIII Myosin   99.7   1E-17 2.2E-22  119.7   5.9   57    1-57    304-360 (677)
  7 cd01380 MYSc_type_V Myosin mot  99.7   1E-17 2.3E-22  119.8   5.9   56    1-56    305-360 (691)
  8 cd01377 MYSc_type_II Myosin mo  99.7 1.4E-17   3E-22  119.2   6.4   57    1-57    314-370 (693)
  9 cd01387 MYSc_type_XV Myosin mo  99.7 1.6E-17 3.5E-22  118.7   6.2   58    1-58    302-359 (677)
 10 cd01384 MYSc_type_XI Myosin mo  99.7 2.2E-17 4.8E-22  117.9   6.3   57    1-57    307-363 (674)
 11 KOG0164|consensus               99.7 6.1E-18 1.3E-22  121.7   2.1   56    1-56    310-365 (1001)
 12 cd00124 MYSc Myosin motor doma  99.7 5.3E-17 1.2E-21  115.8   6.2   56    1-56    302-357 (679)
 13 cd01378 MYSc_type_I Myosin mot  99.7 6.8E-17 1.5E-21  115.4   6.1   56    1-56    301-360 (674)
 14 PF00063 Myosin_head:  Myosin h  99.7 4.3E-17 9.3E-22  115.8   4.8   57    1-57    303-359 (689)
 15 smart00242 MYSc Myosin. Large   99.7 9.3E-17   2E-21  114.6   6.1   57    1-57    309-365 (677)
 16 cd01382 MYSc_type_VI Myosin mo  99.6 2.3E-16 5.1E-21  113.3   6.0   56    1-56    333-393 (717)
 17 KOG0162|consensus               99.6 9.9E-16 2.1E-20  110.8   3.8   54    2-55    319-376 (1106)
 18 cd01386 MYSc_type_XVIII Myosin  99.5 1.7E-14 3.8E-19  104.4   5.8   58    1-58    300-370 (767)
 19 KOG0163|consensus               99.4 1.3E-13 2.7E-18  100.5   5.3   47   13-59    404-450 (1259)
 20 KOG0160|consensus               99.4 2.7E-13 5.8E-18   99.1   3.7   56    2-57    308-363 (862)
 21 KOG4229|consensus               99.2 4.2E-12 9.1E-17   94.5   2.2   58    1-58    365-422 (1062)
 22 KOG0161|consensus               99.2 7.6E-12 1.6E-16   96.8   3.5   56    1-56    388-443 (1930)
 23 PF02376 CUT:  CUT domain;  Int  77.1     2.4 5.3E-05   23.6   2.0   15   33-47     60-74  (87)
 24 PF11758 Bacteriocin_IIi:  Aure  72.7     2.8 6.2E-05   21.4   1.4   13   40-52     36-48  (51)
 25 PF11310 DUF3113:  Protein of u  62.7      18  0.0004   18.9   3.3   35    6-40      7-41  (60)
 26 PF05600 DUF773:  Protein of un  58.9     5.9 0.00013   28.5   1.4   11   38-48     13-23  (507)
 27 COG3324 Predicted enzyme relat  58.5     5.2 0.00011   23.9   0.9   17   33-49     22-38  (127)
 28 PF13105 DUF3959:  Protein of u  52.1      14 0.00031   23.9   2.1   18   32-49     36-53  (239)
 29 PF15026 FAM74:  FAM74 protein   49.8      52  0.0011   19.3   4.3   26   30-55     86-111 (127)
 30 PF14730 DUF4468:  Domain of un  48.8      21 0.00046   19.5   2.3   19   34-52     12-30  (91)
 31 PF08998 Epsilon_antitox:  Bact  48.5      46 0.00099   18.8   3.6   20   28-47     11-30  (89)
 32 PF00349 Hexokinase_1:  Hexokin  48.3      11 0.00024   23.8   1.3   17   39-55    107-123 (206)
 33 KOG4539|consensus               45.8      16 0.00035   24.3   1.7   14   39-52     55-68  (274)
 34 PRK15362 pathogenicity island   43.7      18 0.00039   26.1   1.8   13   36-48    150-162 (473)
 35 PF10585 UBA_e1_thiolCys:  Ubiq  42.9      21 0.00045   17.4   1.5   12   32-43     34-45  (45)
 36 PF11774 Lsr2:  Lsr2 ;  InterPr  42.2      68  0.0015   18.5   4.6   28   10-37     24-51  (110)
 37 PF00380 Ribosomal_S9:  Ribosom  42.1      34 0.00074   20.1   2.6   18   22-39     63-80  (121)
 38 PF09715 Plasmod_dom_1:  Plasmo  41.8      20 0.00043   19.3   1.4   26   25-50     40-65  (67)
 39 PF00605 IRF:  Interferon regul  41.1      22 0.00048   20.6   1.6   16   40-55      3-18  (109)
 40 TIGR01519 plasmod_dom_1 Plasmo  41.0      21 0.00046   19.3   1.5   12   40-51     55-66  (70)
 41 CHL00079 rps9 ribosomal protei  36.2      38 0.00083   20.2   2.2   18   22-39     72-89  (130)
 42 COG0103 RpsI Ribosomal protein  36.1      39 0.00084   20.4   2.2   17   23-39     73-89  (130)
 43 PF11314 DUF3117:  Protein of u  36.1      64  0.0014   16.4   3.4   23   13-35     27-49  (51)
 44 PRK01917 cation-binding hemery  36.0      62  0.0014   18.9   3.1   21   31-51     96-116 (139)
 45 COG5004 P2-like prophage tail   35.2      63  0.0014   17.4   2.7   21   28-49     11-31  (70)
 46 PRK13916 plasmid segregation p  34.8      26 0.00056   19.9   1.2   15   33-47     12-26  (97)
 47 COG3033 TnaA Tryptophanase [Am  33.7      46 0.00099   23.9   2.5   24   29-52    312-336 (471)
 48 COG4803 Predicted membrane pro  33.7      59  0.0013   20.4   2.8   25   12-36    139-163 (170)
 49 PF14837 INTS5_N:  Integrator c  33.7      15 0.00033   23.8   0.2   18   37-54    178-195 (213)
 50 PLN00210 40S ribosomal protein  33.5      51  0.0011   20.0   2.5   17   23-39     73-89  (141)
 51 PRK00132 rpsI 30S ribosomal pr  33.2      54  0.0012   19.6   2.5   17   23-39     73-89  (130)
 52 PF11165 DUF2949:  Protein of u  33.1      31 0.00067   18.0   1.3    8   38-45     49-56  (58)
 53 PF06897 DUF1269:  Protein of u  32.5      62  0.0013   18.4   2.6   24   12-35     78-101 (102)
 54 PF03165 MH1:  MH1 domain;  Int  32.4      21 0.00046   20.4   0.7   15   30-44     52-66  (103)
 55 PF02184 HAT:  HAT (Half-A-TPR)  32.4      36 0.00078   15.7   1.3    9   34-42      6-14  (32)
 56 smart00337 BCL BCL (B-Cell lym  31.3      98  0.0021   17.1   3.4   24   24-47     73-96  (100)
 57 cd00522 Hemerythrin Hemerythri  31.3   1E+02  0.0022   17.2   4.4   23   29-51     82-104 (113)
 58 PF07541 EIF_2_alpha:  Eukaryot  31.0      88  0.0019   17.9   3.1   34    4-37     53-86  (114)
 59 PTZ00086 40S ribosomal protein  30.7      62  0.0013   19.8   2.5   17   23-39     79-95  (147)
 60 PF06481 COX_ARM:  COX Aromatic  30.5      40 0.00086   16.4   1.4   10   40-49     33-42  (47)
 61 PRK00474 rps9p 30S ribosomal p  30.4      54  0.0012   19.7   2.2   17   23-39     73-89  (134)
 62 KOG0136|consensus               30.3      28  0.0006   26.3   1.0   12   36-47    632-643 (670)
 63 TIGR03627 arch_S9P archaeal ri  30.1      55  0.0012   19.5   2.2   17   23-39     69-85  (130)
 64 PRK00078 Maf-like protein; Rev  29.9      87  0.0019   19.6   3.1   25   10-34     74-98  (192)
 65 cd01816 Raf_RBD Ubiquitin doma  29.5      43 0.00094   18.3   1.5   12   27-38     20-31  (74)
 66 PRK04694 Maf-like protein; Rev  28.5      94   0.002   19.4   3.1   25   10-34     74-98  (190)
 67 KOG3749|consensus               28.3      41 0.00089   24.9   1.6   13   39-51    552-564 (640)
 68 PF14409 Herpeto_peptide:  Ribo  28.1      29 0.00063   18.1   0.7   11   42-52      3-13  (58)
 69 PRK00148 Maf-like protein; Rev  28.0      99  0.0022   19.4   3.2   25   10-34     71-95  (194)
 70 PF01756 ACOX:  Acyl-CoA oxidas  27.8      44 0.00095   20.4   1.5   12   36-47    153-164 (187)
 71 PF12614 RRF_GI:  Ribosome recy  27.5 1.5E+02  0.0032   17.9   4.1   21   38-58     64-84  (128)
 72 cd00103 IRF Interferon Regulat  27.2      40 0.00087   19.3   1.2   16   40-55      3-18  (107)
 73 PF04888 SseC:  Secretion syste  27.1      68  0.0015   21.0   2.4   13   36-48     56-68  (306)
 74 TIGR00172 maf MAF protein. Thi  27.0 1.1E+02  0.0024   19.0   3.2   25   10-34     73-97  (183)
 75 PF00042 Globin:  Globin plant   26.6      82  0.0018   16.8   2.4   15   29-43     15-29  (110)
 76 PRK01839 Maf-like protein; Rev  25.9 1.2E+02  0.0025   19.4   3.2   25   10-34     91-115 (209)
 77 cd00353 Ribosomal_S15p_S13e Ri  25.7 1.2E+02  0.0026   16.3   3.6   30   21-50     48-80  (80)
 78 PRK00648 Maf-like protein; Rev  25.6 1.1E+02  0.0025   19.1   3.1   25   10-34     75-99  (191)
 79 PRK14361 Maf-like protein; Pro  24.8 1.2E+02  0.0027   18.9   3.2   25   10-34     68-92  (187)
 80 PRK14364 Maf-like protein; Pro  24.8 1.2E+02  0.0027   18.8   3.2   25   10-34     67-91  (181)
 81 smart00807 AKAP_110 A-kinase a  24.8      76  0.0017   24.2   2.5   24   21-44    370-393 (851)
 82 cd04917 ACT_AKiii-LysC-EC_2 AC  24.8      86  0.0019   15.4   2.1   14   30-43     51-64  (64)
 83 cd00555 Maf Nucleotide binding  24.5 1.4E+02   0.003   18.5   3.3   25   10-34     70-94  (180)
 84 PRK04056 Maf-like protein; Rev  24.5 1.2E+02  0.0027   18.8   3.1   25   10-34     71-95  (180)
 85 PRK14366 Maf-like protein; Pro  24.2 1.3E+02  0.0028   19.0   3.2   25   10-34     76-100 (195)
 86 PRK14368 Maf-like protein; Pro  24.2 1.3E+02  0.0028   18.9   3.2   25   10-34     75-99  (193)
 87 PRK10698 phage shock protein P  24.1      51  0.0011   21.1   1.4   23   36-58      2-24  (222)
 88 PLN02298 hydrolase, alpha/beta  24.0 1.3E+02  0.0028   19.4   3.3   29   31-59    300-328 (330)
 89 PRK00032 Maf-like protein; Rev  23.4 1.3E+02  0.0029   18.8   3.1   25   10-34     73-97  (190)
 90 PRK02478 Maf-like protein; Rev  23.2 1.4E+02  0.0031   18.8   3.3   25   10-34     79-103 (199)
 91 PRK00884 Maf-like protein; Rev  23.2 1.4E+02   0.003   18.8   3.2   24   10-33     72-95  (194)
 92 PF02545 Maf:  Maf-like protein  23.1 1.3E+02  0.0029   18.8   3.1   24   10-33     74-97  (195)
 93 COG0424 Maf Nucleotide-binding  22.8 1.4E+02  0.0031   19.0   3.2   25    9-33     73-97  (193)
 94 PF00392 GntR:  Bacterial regul  22.4 1.2E+02  0.0026   15.0   2.8   16   37-52      1-16  (64)
 95 PRK00234 Maf-like protein; Rev  22.1 1.2E+02  0.0026   19.0   2.8   25   10-34     72-96  (192)
 96 PRK14898 DNA-directed RNA poly  22.1 1.3E+02  0.0029   23.2   3.4   36   19-54     13-50  (858)
 97 PF11295 DUF3096:  Protein of u  21.8   1E+02  0.0022   14.9   1.8   13   35-47     11-23  (39)
 98 PRK04425 Maf-like protein; Rev  21.7 1.5E+02  0.0033   18.7   3.2   24   10-33     75-98  (196)
 99 PF10624 TraS:  Plasmid conjuga  21.7 1.7E+02  0.0036   18.1   3.2   19   32-50     32-50  (164)
100 PF01712 dNK:  Deoxynucleoside   21.7      80  0.0017   18.5   1.8   21   31-51     46-66  (146)
101 PRK02141 Maf-like protein; Rev  21.7 1.6E+02  0.0034   18.8   3.2   25   10-34     82-106 (207)
102 PRK14362 Maf-like protein; Pro  21.4 1.3E+02  0.0028   19.2   2.8   25   10-34     83-107 (207)
103 cd01040 globin Globins are hem  21.3   1E+02  0.0023   16.9   2.2   15   29-43     18-32  (140)
104 smart00348 IRF interferon regu  21.2      68  0.0015   18.4   1.4   16   40-55      1-16  (107)
105 cd00018 AP2 DNA-binding domain  21.2 1.2E+02  0.0027   14.9   2.3   23   17-39     29-51  (61)
106 PRK01441 Maf-like protein; Rev  21.1 1.5E+02  0.0032   18.8   3.0   25   10-34     82-106 (207)
107 PF08708 PriCT_1:  Primase C te  21.0 1.1E+02  0.0024   15.5   2.1   24   15-38     47-70  (71)
108 PRK01526 Maf-like protein; Rev  21.0 1.6E+02  0.0035   18.7   3.2   25   10-34     80-104 (205)
109 PF15128 T_cell_tran_alt:  T-ce  21.0 1.5E+02  0.0033   16.7   2.7   21   25-49     19-39  (92)
110 PF10960 DUF2762:  Protein of u  20.8      71  0.0015   17.2   1.3   19   31-49      8-26  (71)
111 PHA03073 late transcription fa  20.8      87  0.0019   19.3   1.8   15   27-41     80-94  (150)
112 TIGR02481 hemeryth_dom hemeryt  20.7 1.5E+02  0.0033   16.5   2.8   21   31-51     97-117 (126)
113 PF04796 RepA_C:  Plasmid encod  20.7 1.7E+02  0.0036   18.0   3.1   29   19-51    121-150 (161)
114 PF03501 S10_plectin:  Plectin/  20.7      78  0.0017   18.1   1.5    9   35-43      7-15  (95)
115 PHA02518 ParA-like protein; Pr  20.6 1.2E+02  0.0026   18.0   2.5   17   34-50    194-210 (211)
116 PRK14367 Maf-like protein; Pro  20.3 1.7E+02  0.0037   18.5   3.2   25   10-34     79-103 (202)
117 COG5132 BUD31 Cell cycle contr  20.3      98  0.0021   18.7   1.9   15   29-47     66-80  (146)
118 cd04176 Rap2 Rap2 subgroup.  T  20.1      71  0.0015   18.1   1.3   12   39-50    152-163 (163)
119 PLN02349 glycerol-3-phosphate   20.1 2.4E+02  0.0052   20.3   4.1   32   26-58    393-424 (426)

No 1  
>PTZ00014 myosin-A; Provisional
Probab=99.73  E-value=5.8e-18  Score=122.91  Aligned_cols=58  Identities=21%  Similarity=0.439  Sum_probs=54.3

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMC   58 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~   58 (60)
                      |.++|+++++.+|||.+.++++++||..+||||||+||+|||+|||.+||.+|.++++
T Consensus       402 L~~~L~~~~~~~~~e~i~~~~~~~qA~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~  459 (821)
T PTZ00014        402 LKKELTVKVTYAGNQKIEGPWSKDESEMLKDSLSKAVYEKLFLWIIRNLNATIEPPGG  459 (821)
T ss_pred             HHHHhhceEEEeCCeeEecCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcc
Confidence            4578999999999999999999999999999999999999999999999999987543


No 2  
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins. Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr
Probab=99.72  E-value=8.7e-18  Score=119.95  Aligned_cols=56  Identities=25%  Similarity=0.388  Sum_probs=53.3

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTI   56 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~   56 (60)
                      |.++||++++.++||.+.+|++++||.++||||||+||+|||+|||.+||.++.++
T Consensus       301 L~~~lt~~~~~~~~e~i~~~~~~~qA~~~rdalak~lY~~lF~wiV~~IN~~l~~~  356 (671)
T cd01381         301 LMDALTSRTIFTRGETVVTPLSREQAVDVRDAFVKGIYGRLFVWIVRKINAAIYKP  356 (671)
T ss_pred             HhhhhceEEEEeCCceEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCc
Confidence            46799999999999999999999999999999999999999999999999999765


No 3  
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins. Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the hea
Probab=99.72  E-value=8.4e-18  Score=120.33  Aligned_cols=58  Identities=24%  Similarity=0.319  Sum_probs=54.3

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMC   58 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~   58 (60)
                      |.++|+++++.++||.+.+|++++||.+.||+|||+||+|||+|||.+||.++.++.+
T Consensus       313 L~~~l~~~~~~~~~e~i~~~~~~~qa~~~rdalak~lY~~LF~wiV~~IN~~l~~~~~  370 (692)
T cd01385         313 LMEALTKKRTVTVNETLILPYSLSEAITARDAMAKCLYSALFDWIVLRINHALLNKDD  370 (692)
T ss_pred             HHHHhccCeEEeCCCeEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccc
Confidence            4578999999999999999999999999999999999999999999999999987654


No 4  
>COG5022 Myosin heavy chain [Cytoskeleton]
Probab=99.72  E-value=4.8e-18  Score=127.27  Aligned_cols=58  Identities=33%  Similarity=0.581  Sum_probs=55.5

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMC   58 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~   58 (60)
                      |.++|+.|+|++|||++.+|++..||..+||||||+||++||+|||++||.+|+.+..
T Consensus       368 f~k~lvk~~ikt~~E~i~~~~n~~QA~~irdslAK~lY~~lFdwiV~rIN~sL~~~~~  425 (1463)
T COG5022         368 FVKWLVKRQIKTGGEWIVVPLNLEQALAIRDSLAKALYSNLFDWIVDRINKSLDHSAA  425 (1463)
T ss_pred             HHHHHHHhHhhcCceEEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCccc
Confidence            5689999999999999999999999999999999999999999999999999998765


No 5  
>cd01379 MYSc_type_III Myosin motor domain, type III myosins. Myosin III has been shown to play a role in  the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the
Probab=99.72  E-value=9.8e-18  Score=119.45  Aligned_cols=57  Identities=30%  Similarity=0.464  Sum_probs=53.9

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIM   57 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~   57 (60)
                      |.++|+++++.++||.+.+|++++||.++||||||+||+|||+|||.+||.++.++.
T Consensus       308 L~~~L~~~~~~~~ge~i~~~~~~~qA~~~rdalak~lY~~LF~wiV~~IN~~l~~~~  364 (653)
T cd01379         308 LQEALTSHCVVTRGETIVRHNTVEKATDARDAMAKALYGRLFSWIVNRINSLLKHDR  364 (653)
T ss_pred             HHHHhcccEEEeCCceeeecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccc
Confidence            467899999999999999999999999999999999999999999999999998754


No 6  
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates f
Probab=99.72  E-value=1e-17  Score=119.74  Aligned_cols=57  Identities=30%  Similarity=0.475  Sum_probs=53.9

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIM   57 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~   57 (60)
                      |.++|+++++.++||.+.++++++||.++||+|||+||+|||+|||.+||.++.++.
T Consensus       304 L~~~l~~~~~~~~~e~~~~~~~~~qa~~~rdalak~lY~~lF~wiV~~IN~~l~~~~  360 (677)
T cd01383         304 LMLALSTRKMHVNNDNIVQKLTLQQAIDARDALAKSIYASLFDWLVEQINKSLEVGK  360 (677)
T ss_pred             HHHHhhhcEEEeCCceEeecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCc
Confidence            457899999999999999999999999999999999999999999999999998754


No 7  
>cd01380 MYSc_type_V Myosin motor domain, type V myosins. Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an act
Probab=99.72  E-value=1e-17  Score=119.81  Aligned_cols=56  Identities=36%  Similarity=0.556  Sum_probs=53.5

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTI   56 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~   56 (60)
                      |.++|+++++.++||.+.++++++||.++||+|||+||+|||+|||.+||.++.++
T Consensus       305 L~~~l~~~~~~~~~e~i~~~~~~~qA~~~rdalak~lY~~LF~wiV~~iN~~l~~~  360 (691)
T cd01380         305 LRKWLVKRQIVTRSEKIVKPLTKEQAIVARDALAKHIYSKLFDWIVDVINKSLNTG  360 (691)
T ss_pred             HHHHHHhCEEEECCeeEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcC
Confidence            45789999999999999999999999999999999999999999999999999876


No 8  
>cd01377 MYSc_type_II Myosin motor domain, type II myosins. Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydro
Probab=99.71  E-value=1.4e-17  Score=119.22  Aligned_cols=57  Identities=61%  Similarity=0.976  Sum_probs=53.9

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIM   57 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~   57 (60)
                      |.++|+++++.+++|.+.+|++++||.++||+|||+||++||+|||.+||.+|.++.
T Consensus       314 L~~~l~~~~~~~~~e~i~~~~~~~~A~~~rDalak~lY~~LF~wiV~~IN~~l~~~~  370 (693)
T cd01377         314 LLKALLHPRIKVGREWVTKGQNVEQVSFSVGALAKALYERLFLWLVKRINKTLDTKQ  370 (693)
T ss_pred             HHHHhcceEEEECCeeEeeCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCC
Confidence            457899999999999999999999999999999999999999999999999998763


No 9  
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins. In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus
Probab=99.71  E-value=1.6e-17  Score=118.68  Aligned_cols=58  Identities=26%  Similarity=0.348  Sum_probs=54.1

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMC   58 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~   58 (60)
                      |.++||++.+.++||.+.+|++++||.++||+|||+||+|||+|||.+||.++.++.+
T Consensus       302 L~~~lt~~~~~~~~e~i~~~~~~~~a~~~rdalak~lY~~lF~wiV~~iN~~l~~~~~  359 (677)
T cd01387         302 LQKAITFKVTETRREKIFTPLTVESAVDARDAIAKVLYALLFNWLITRVNALVSPTQD  359 (677)
T ss_pred             HHHHhccCeEEeCCceEeccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCC
Confidence            4578999999999999999999999999999999999999999999999999987543


No 10 
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new act
Probab=99.70  E-value=2.2e-17  Score=117.94  Aligned_cols=57  Identities=30%  Similarity=0.539  Sum_probs=53.7

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIM   57 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~   57 (60)
                      |.++|+++++.+++|.+.++++++||.++||+|||+||+|||+|||.+||.++.++.
T Consensus       307 L~~~L~~~~~~~~~e~i~~~~~~~~a~~~rdalak~lY~~LF~wiV~~iN~~l~~~~  363 (674)
T cd01384         307 LEDALCKRVMVTPEEVITKPLDPDSAELSRDALAKTIYSRLFDWLVNKINSSIGQDP  363 (674)
T ss_pred             HHHHhcccEEEeCCceEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCC
Confidence            467899999999999999999999999999999999999999999999999998753


No 11 
>KOG0164|consensus
Probab=99.69  E-value=6.1e-18  Score=121.66  Aligned_cols=56  Identities=38%  Similarity=0.714  Sum_probs=53.1

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTI   56 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~   56 (60)
                      +.++|++|++.++||.+.+++++.||..+||||||++|+|||.|||.+||.+|...
T Consensus       310 l~~aL~~Rtvaa~~e~v~k~hn~~qA~YaRDAlAKaiY~RlF~Wiv~rIn~~i~~~  365 (1001)
T KOG0164|consen  310 LERALTSRTVAAGGEIVLKQHNVEQASYARDALAKAIYSRLFTWIVNRINRSIEVK  365 (1001)
T ss_pred             HHHHHHHHHHHhccchhhccccHHHHHHHHHHHHHHHHHHHHHHHHHhhhhheecc
Confidence            35799999999999999999999999999999999999999999999999999764


No 12 
>cd00124 MYSc Myosin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the fila
Probab=99.69  E-value=5.3e-17  Score=115.80  Aligned_cols=56  Identities=36%  Similarity=0.567  Sum_probs=53.3

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTI   56 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~   56 (60)
                      |.++|+++++.++||.+.++++++||.+.||+|||+||+|||+|||.+||.+|.++
T Consensus       302 L~~~l~~~~~~~~~~~~~~~~~~~~a~~~rdalak~lY~~lF~wiV~~iN~~l~~~  357 (679)
T cd00124         302 LEEALTYKVTKVGGEVITIPLTKEEAVDSRDSLAKALYSRLFDWIVSRINSSLKPK  357 (679)
T ss_pred             HHHHhhccEEEeCCceEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCC
Confidence            45789999999999999999999999999999999999999999999999999874


No 13 
>cd01378 MYSc_type_I Myosin motor domain, type I myosins. Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon
Probab=99.68  E-value=6.8e-17  Score=115.43  Aligned_cols=56  Identities=34%  Similarity=0.618  Sum_probs=53.1

Q ss_pred             CccccccceEEeCc----eEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccc
Q psy17851          1 MTKAFLKPRIKVGR----DFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTI   56 (60)
Q Consensus         1 l~~aL~~~~i~~~~----e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~   56 (60)
                      |.++|+++++.++|    |.+.+|++++||.+.||+|||+||+|||+|||.+||.+|.++
T Consensus       301 L~~~l~~~~~~~~~~~~~e~i~~~~~~~~a~~~rdalak~lY~~lF~wiV~~IN~~l~~~  360 (674)
T cd01378         301 LEKALTSRTIETGGGGRGEVYDVPLNVEQAAYTRDALAKAIYSRLFDWLVSRINKALQVK  360 (674)
T ss_pred             HHHHhcccEEEeCCCCCceeEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCC
Confidence            45789999999998    999999999999999999999999999999999999999875


No 14 
>PF00063 Myosin_head:  Myosin head (motor domain);  InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril. Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular head and the C-terminal coiled-coil rod-like tail, although some forms have a globular region in their C-terminal. There are many cell-specific isoforms of myosin heavy chains, coded for by a multi-gene family []. Myosin interacts with actin to convert chemical energy, in the form of ATP, to mechanical energy []. The 3-D structure of the head portion of myosin has been determined [] and a model for actin-myosin complex has been constructed []. The globular head is well conserved, some highly-conserved regions possibly relating to functional and structural domains []. The rod-like tail starts with an invariant proline residue, and contains many repeats of a 28 residue region, interrupted at 4 regularly-spaced points known as skip residues. Although the sequence of the tail is not well conserved, the chemical character is, hydrophobic, charged and skip residues occuring in a highly ordered and repeated fashion [].; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 1LKX_A 2V26_A 2BKI_A 3L9I_A 2BKH_A 2X51_A 2VB6_A 2VAS_A 1OE9_A 1W8J_A ....
Probab=99.68  E-value=4.3e-17  Score=115.76  Aligned_cols=57  Identities=42%  Similarity=0.619  Sum_probs=51.3

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIM   57 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~   57 (60)
                      |.++|+++++.+++|.+.++++++||...||+|||+||++||+|||.+||.+|.++.
T Consensus       303 L~~~l~~~~~~~~~e~~~~~~~~~~a~~~rdalak~LY~~LF~wIV~~iN~~L~~~~  359 (689)
T PF00063_consen  303 LEKALTTRTIKVGGETVTKPLSVEQASDARDALAKALYSRLFDWIVERINSALSPSE  359 (689)
T ss_dssp             HHHHHHSEEEESTTSEEEEE-BHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--SS
T ss_pred             HHHHHhhccccccccccccccchhhhhhhhhhhhhhhhhHHHHHHHHhhhhcccccc
Confidence            457899999999999999999999999999999999999999999999999998865


No 15 
>smart00242 MYSc Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
Probab=99.67  E-value=9.3e-17  Score=114.64  Aligned_cols=57  Identities=44%  Similarity=0.631  Sum_probs=53.8

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIM   57 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~   57 (60)
                      |.++|+++++.++||.+.++++++||.+.||+|||+||+|||+|||.+||.+|.+++
T Consensus       309 L~~~l~~~~~~~~~e~~~~~~~~~~a~~~rd~lak~lY~~lF~wiV~~iN~~l~~~~  365 (677)
T smart00242      309 LEKALTKRKIKTGGEVITKPLNVEQALDARDALAKALYSRLFDWLVKRINKSLSFKD  365 (677)
T ss_pred             HHHHhcccEEEeCCceEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCC
Confidence            457899999999999999999999999999999999999999999999999998764


No 16 
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins. Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of
Probab=99.65  E-value=2.3e-16  Score=113.31  Aligned_cols=56  Identities=20%  Similarity=0.295  Sum_probs=51.6

Q ss_pred             CccccccceEE-----eCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccc
Q psy17851          1 MTKAFLKPRIK-----VGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTI   56 (60)
Q Consensus         1 l~~aL~~~~i~-----~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~   56 (60)
                      |.++|+++.+.     ++||.+.+|++++||.+.||+|||+||+|||+|||.+||.++...
T Consensus       333 L~~~l~~r~~~~~~g~~~~~~i~~~l~~~qA~~~rdalak~lY~~LF~wiV~~IN~~l~~~  393 (717)
T cd01382         333 LRVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALAKAVYSHLFDHVVSRVNQCFPFE  393 (717)
T ss_pred             HHHHHhheEEecccccCCCceEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCC
Confidence            45789998887     789999999999999999999999999999999999999999754


No 17 
>KOG0162|consensus
Probab=99.58  E-value=9.9e-16  Score=110.77  Aligned_cols=54  Identities=26%  Similarity=0.581  Sum_probs=48.1

Q ss_pred             ccccccceEEe----CceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccc
Q psy17851          2 TKAFLKPRIKV----GRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDT   55 (60)
Q Consensus         2 ~~aL~~~~i~~----~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~   55 (60)
                      +++||.|.+..    +.|++..||+++||...||||||+||.|||||||++||.+|..
T Consensus       319 ~~~Lt~R~M~s~~G~kr~~~~v~LNv~QA~~~RDAlakaiy~~lFD~lV~rvNkam~~  376 (1106)
T KOG0162|consen  319 EEKLTSRIMESKWGGKREVIHVPLNVEQASYTRDALAKAIYARLFDWLVERVNKAMQA  376 (1106)
T ss_pred             HHHHHHHHHhhcccccceeEEecccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            46777777655    3499999999999999999999999999999999999999984


No 18 
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the 
Probab=99.52  E-value=1.7e-14  Score=104.40  Aligned_cols=58  Identities=24%  Similarity=0.304  Sum_probs=47.2

Q ss_pred             CccccccceEEeCceE-------------EEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy17851          1 MTKAFLKPRIKVGRDF-------------VTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMC   58 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~-------------~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~   58 (60)
                      |.++|+++++..+++.             +..+.++.||.++||||||+||+|||+|||.+||.+|.+++.
T Consensus       300 L~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~  370 (767)
T cd01386         300 LSSATFKHTLRGGINQMTTGPQRPGLSDTETSSGLKMTAVECLEGMASGLYSELFAAVVSLINRSISSSHH  370 (767)
T ss_pred             HHHHhcccEEeecceeeeccccccccccccccCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCC
Confidence            3567777776665432             334678899999999999999999999999999999987654


No 19 
>KOG0163|consensus
Probab=99.45  E-value=1.3e-13  Score=100.46  Aligned_cols=47  Identities=28%  Similarity=0.456  Sum_probs=43.1

Q ss_pred             CceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccc
Q psy17851         13 GRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMCA   59 (60)
Q Consensus        13 ~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~~   59 (60)
                      .|-.|.+|+.+.||...||||||++|++||+|||.+||+++......
T Consensus       404 kGTvIrVPLK~~eA~n~RDALaKaiYSkLFD~lV~~iNqsiPFe~St  450 (1259)
T KOG0163|consen  404 KGTVIRVPLKIHEASNARDALAKAIYSKLFDWLVGRINQSIPFEKST  450 (1259)
T ss_pred             cceEEEeeccHHhhcchHHHHHHHHHHHHHHHHHHHhhccccccccc
Confidence            46889999999999999999999999999999999999999765543


No 20 
>KOG0160|consensus
Probab=99.38  E-value=2.7e-13  Score=99.10  Aligned_cols=56  Identities=30%  Similarity=0.407  Sum_probs=52.8

Q ss_pred             ccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy17851          2 TKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIM   57 (60)
Q Consensus         2 ~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~   57 (60)
                      ..+|+.|.+.++++++.++++..||...||++||.||++||+|+|.+||.+|....
T Consensus       308 ~~~L~~r~i~~~~e~i~k~l~~~qa~~~rD~lak~iys~LFdwlV~~in~sL~~~~  363 (862)
T KOG0160|consen  308 EQWLSKRKILTARESIVKPLTLSQAVKRRDALAKQLYSLLFDWLVAKINGSLGAND  363 (862)
T ss_pred             HHHHHHHHhhcccceeecccCHHHHHHhhhhhHHHHHHHHHHHHHHHhhcccccCC
Confidence            46789999999999999999999999999999999999999999999999998744


No 21 
>KOG4229|consensus
Probab=99.22  E-value=4.2e-12  Score=94.46  Aligned_cols=58  Identities=22%  Similarity=0.316  Sum_probs=55.1

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMC   58 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~   58 (60)
                      |.++++.++....||.+..+++.++|.+.|||+||.+|+|||.|||.+||..+.++++
T Consensus       365 l~~alt~~~~~~~ge~~~~~l~~~~A~d~rda~ak~ly~~lf~~iv~rIn~~~~~~~~  422 (1062)
T KOG4229|consen  365 LQEALTARVNVTRGELLLAPLLVERAVDVRDAMAKTLYGRLFDWIVLRINAALSPESD  422 (1062)
T ss_pred             hhhhhcccceeeehhhhhhhhhHHHhccCchHHHHHHHHHHHHHHHhhHHhccCcccc
Confidence            4678999999999999999999999999999999999999999999999999998876


No 22 
>KOG0161|consensus
Probab=99.22  E-value=7.6e-12  Score=96.78  Aligned_cols=56  Identities=64%  Similarity=1.025  Sum_probs=53.5

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTI   56 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~   56 (60)
                      |..++++|++++|++.+.+..+.+|+..+..+|||++|+|||.|||.|||.+++.+
T Consensus       388 ~~~al~~priKvg~e~v~k~q~~~q~~~~v~alAk~lYerlF~wlV~riN~sld~~  443 (1930)
T KOG0161|consen  388 FLKALLRPRIKVGREWVSKAQNVEQVLFAVEALAKALYERLFGWLVKRINKSLDSK  443 (1930)
T ss_pred             HHHHhcccceeccchhhhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhc
Confidence            45789999999999999999999999999999999999999999999999999876


No 23 
>PF02376 CUT:  CUT domain;  InterPro: IPR003350 A class, also called ONECUT, of homeodomain proteins. The CUT domain is a DNA-binding motif which can bind independently or in cooperation with the homeodomain (IPR001356 from INTERPRO), often found downstream of the CUT domain. Proteins display two modes of DNA binding, which hinge on the homeodomain and on the linker that separates it from the cut domain, and two modes of transcriptional stimulation, which hinge on the homeodomain [].; GO: 0003677 DNA binding; PDB: 1WH6_A 2D5V_A 2CSF_A 1X2L_A 2O49_A 2O4A_A 1YSE_A 1S7E_A 1WIZ_A 1WH8_A.
Probab=77.10  E-value=2.4  Score=23.57  Aligned_cols=15  Identities=33%  Similarity=0.702  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHHHH
Q psy17851         33 ISKACYERMFRWLVN   47 (60)
Q Consensus        33 laK~lY~rLF~wiV~   47 (60)
                      -.|.+|-||++||-.
T Consensus        60 ~gre~y~RM~nWL~~   74 (87)
T PF02376_consen   60 KGREPYIRMYNWLSL   74 (87)
T ss_dssp             HHHHHHHHHHHHHCS
T ss_pred             cccHHHHHHHHHhcC
Confidence            468899999999853


No 24 
>PF11758 Bacteriocin_IIi:  Aureocin-like type II bacteriocin;  InterPro: IPR020968  This is a small family of type II bacteriocins usually encoded on a plasmid. Characteristically the members are small, cationic, rich in Lys and Try, and bring about a generalised membrane permeabilisation leading to leakage of ions. The family includes aureocin A, lacticins Q and Z, and BhtB [, ].
Probab=72.71  E-value=2.8  Score=21.38  Aligned_cols=13  Identities=23%  Similarity=0.713  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHhhc
Q psy17851         40 RMFRWLVNRINRS   52 (60)
Q Consensus        40 rLF~wiV~~IN~~   52 (60)
                      .-|+||+++|++-
T Consensus        36 ~a~dWI~~kI~~I   48 (51)
T PF11758_consen   36 MAIDWIVQKIKKI   48 (51)
T ss_pred             chHHHHHHHHHHH
Confidence            4589999999864


No 25 
>PF11310 DUF3113:  Protein of unknown function (DUF3113);  InterPro: IPR021461 This entry is represented by Bacteriophage 92, Orf93. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=62.70  E-value=18  Score=18.88  Aligned_cols=35  Identities=14%  Similarity=0.196  Sum_probs=24.7

Q ss_pred             ccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHH
Q psy17851          6 LKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYER   40 (60)
Q Consensus         6 ~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~r   40 (60)
                      ..-++-++=-+.+....-.+..+..++||+.||..
T Consensus         7 INAtidiRIPTeVe~~~~~~vD~eKe~LAdyLy~N   41 (60)
T PF11310_consen    7 INATIDIRIPTEVEYHHFDDVDKEKEALADYLYNN   41 (60)
T ss_pred             eeeEEeEeccceeeecchhhhhhHHHHHHHHHhcC
Confidence            33444445445556667788889999999999963


No 26 
>PF05600 DUF773:  Protein of unknown function (DUF773);  InterPro: IPR008491 This family contains several eukaryotic sequences which are thought to be CDK5 activator-binding proteins, however, the function of this family is unknown.
Probab=58.94  E-value=5.9  Score=28.45  Aligned_cols=11  Identities=45%  Similarity=1.322  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHH
Q psy17851         38 YERMFRWLVNR   48 (60)
Q Consensus        38 Y~rLF~wiV~~   48 (60)
                      |++|.+|||+|
T Consensus        13 ~~kl~dWLv~R   23 (507)
T PF05600_consen   13 YSKLLDWLVDR   23 (507)
T ss_pred             hhHHHHHHHHc
Confidence            89999999984


No 27 
>COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only]
Probab=58.54  E-value=5.2  Score=23.87  Aligned_cols=17  Identities=35%  Similarity=0.747  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy17851         33 ISKACYERMFRWLVNRI   49 (60)
Q Consensus        33 laK~lY~rLF~wiV~~I   49 (60)
                      -||+-|+.+|.|=..+.
T Consensus        22 ra~~FY~~vFgW~~~~~   38 (127)
T COG3324          22 RAKAFYEKVFGWTFEDY   38 (127)
T ss_pred             HHHHHHHHhhCceeccc
Confidence            57899999999976655


No 28 
>PF13105 DUF3959:  Protein of unknown function (DUF3959)
Probab=52.08  E-value=14  Score=23.95  Aligned_cols=18  Identities=22%  Similarity=0.525  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q psy17851         32 AISKACYERMFRWLVNRI   49 (60)
Q Consensus        32 alaK~lY~rLF~wiV~~I   49 (60)
                      -+||-+|+|+-.||---+
T Consensus        36 YfaKk~ySRiCSWiAYap   53 (239)
T PF13105_consen   36 YFAKKIYSRICSWIAYAP   53 (239)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            479999999999997643


No 29 
>PF15026 FAM74:  FAM74 protein
Probab=49.84  E-value=52  Score=19.30  Aligned_cols=26  Identities=27%  Similarity=0.391  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhcccc
Q psy17851         30 VEAISKACYERMFRWLVNRINRSLDT   55 (60)
Q Consensus        30 rdalaK~lY~rLF~wiV~~IN~~l~~   55 (60)
                      ..-|+.-+....|.||+..||.+-..
T Consensus        86 vqrls~~~h~~~~~~i~~~i~~~~~g  111 (127)
T PF15026_consen   86 VQRLSLLLHLAVFLWIIIAINFSFSG  111 (127)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcccc
Confidence            34566677779999999999987643


No 30 
>PF14730 DUF4468:  Domain of unknown function (DUF4468) with TBP-like fold
Probab=48.81  E-value=21  Score=19.47  Aligned_cols=19  Identities=21%  Similarity=0.613  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHHhhc
Q psy17851         34 SKACYERMFRWLVNRINRS   52 (60)
Q Consensus        34 aK~lY~rLF~wiV~~IN~~   52 (60)
                      +..||.++-.|+....+..
T Consensus        12 k~~ly~~~~~W~~~~~~~~   30 (91)
T PF14730_consen   12 KDQLYDRAKKWLAKNFKSA   30 (91)
T ss_pred             HHHHHHHHHHHHHHhcccc
Confidence            3579999999999988873


No 31 
>PF08998 Epsilon_antitox:  Bacterial epsilon antitoxin;  InterPro: IPR015090 The epsilon antitoxin, produced by various prokaryotes, forms part of a post-segregational killing system, which is involved in the initiation of programmed cell death of plasmid-free cells. The protein is folded into a three-helix bundle that directly interacts with the zeta toxin, inactivating it []. ; GO: 0015643 toxin binding, 0009636 response to toxin, 0031342 negative regulation of cell killing; PDB: 1GVN_C 3Q8X_C.
Probab=48.50  E-value=46  Score=18.82  Aligned_cols=20  Identities=20%  Similarity=0.521  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q psy17851         28 FAVEAISKACYERMFRWLVN   47 (60)
Q Consensus        28 ~~rdalaK~lY~rLF~wiV~   47 (60)
                      ..-.-++.++|.|+-+++++
T Consensus        11 EilnEfs~~vy~rvlnyVln   30 (89)
T PF08998_consen   11 EILNEFSSSVYNRVLNYVLN   30 (89)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHh
Confidence            35667999999999999986


No 32 
>PF00349 Hexokinase_1:  Hexokinase;  InterPro: IPR022672 Hexokinase is an important enzyme that catalyses the ATP-dependent conversion of aldo- and keto-hexose sugars to the hexose-6-phosphate (H6P). The enzyme can catalyse this reaction on glucose, fructose, sorbitol and glucosamine, and as such is the first step in a number of metabolic pathways []. The addition of a phosphate group to the sugar acts to trap it in a cell, since the negatively charged phosphate cannot easily traverse the plasma membrane. The enzyme is widely distributed in eukaryotes. There are three isozymes of hexokinase in yeast (PI, PII and glucokinase): isozymes PI and PII phosphorylate both aldo- and keto-sugars; glucokinase is specific for aldo-hexoses. All three isozymes contain two domains []. Structural studies of yeast hexokinase reveal a well-defined catalytic pocket that binds ATP and hexose, allowing easy transfer of the phosphate from ATP to the sugar []. Vertebrates contain four hexokinase isozymes, designated I to IV, where types I to III contain a duplication of the two-domain yeast-type hexokinases. Both the N- and C-terminal halves bind hexose and H6P, though in types I an III only the C-terminal half supports catalysis, while both halves support catalysis in type II. The N-terminal half is the regulatory region. Type IV hexokinase is similar to the yeast enzyme in containing only the two domains, and is sometimes incorrectly referred to as glucokinase. The different vertebrate isozymes differ in their catalysis, localisation and regulation, thereby contributing to the different patterns of glucose metabolism in different tissues []. Whereas types I to III can phosphorylate a variety of hexose sugars and are inhibited by glucose-6-phosphate (G6P), type IV is specific for glucose and shows no G6P inhibition. Type I enzyme may have a catabolic function, producing H6P for energy production in glycolysis; it is bound to the mitochondrial membrane, which enables the coordination of glycolysis with the TCA cycle. Types II and III enzyme may have anabolic functions, providing H6P for glycogen or lipid synthesis. Type IV enzyme is found in the liver and pancreatic beta-cells, where it is controlled by insulin (activation) and glucagon (inhibition). In pancreatic beta-cells, type IV enzyme acts as a glucose sensor to modify insulin secretion. Mutations in type IV hexokinase have been associated with diabetes mellitus.  Hexokinase (2.7.1.1 from EC), a fructose and glucose phosphorylating enzyme, contains two structurally similar domains represented by this family and PF03727 from PFAM. Some hexokinases have two copies of each of these domains. This entry represents the N-terminal domain.; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0005975 carbohydrate metabolic process; PDB: 3O1W_A 3O6W_A 3O4W_B 3O08_B 3O80_A 3O5B_A 3O8M_A 3O1B_A 1BG3_A 4DHY_A ....
Probab=48.35  E-value=11  Score=23.80  Aligned_cols=17  Identities=24%  Similarity=0.505  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHhhcccc
Q psy17851         39 ERMFRWLVNRINRSLDT   55 (60)
Q Consensus        39 ~rLF~wiV~~IN~~l~~   55 (60)
                      +.||+||.++|+.-+..
T Consensus       107 ~~lFd~ia~~i~~f~~~  123 (206)
T PF00349_consen  107 EELFDFIADCIAEFLKE  123 (206)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             ccHHHHHHHHHHHHHHH
Confidence            78999999999987764


No 33 
>KOG4539|consensus
Probab=45.78  E-value=16  Score=24.28  Aligned_cols=14  Identities=7%  Similarity=0.574  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHhhc
Q psy17851         39 ERMFRWLVNRINRS   52 (60)
Q Consensus        39 ~rLF~wiV~~IN~~   52 (60)
                      +.||+||+++.|..
T Consensus        55 d~l~n~I~~k~~K~   68 (274)
T KOG4539|consen   55 DLLVNFISDKMNKA   68 (274)
T ss_pred             HHHHHHHHHHHHHH
Confidence            67999999999975


No 34 
>PRK15362 pathogenicity island 2 effector protein SseC; Provisional
Probab=43.66  E-value=18  Score=26.10  Aligned_cols=13  Identities=23%  Similarity=0.787  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHHH
Q psy17851         36 ACYERMFRWLVNR   48 (60)
Q Consensus        36 ~lY~rLF~wiV~~   48 (60)
                      .|++.+|+||+.-
T Consensus       150 gIf~~ifdWi~~~  162 (473)
T PRK15362        150 GIFGAIFDWIVGI  162 (473)
T ss_pred             cHHHHHHHHHHHH
Confidence            5899999999864


No 35 
>PF10585 UBA_e1_thiolCys:  Ubiquitin-activating enzyme active site ;  InterPro: IPR019572  Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP. Later the ubiquitin moiety is transferred to a cysteine residue on one of the many forms of ubiquitin-conjugating enzymes (E2) []. This domain carries the last of five conserved cysteines that is part of the active site of the enzyme, responsible for ubiquitin thiolester complex formation, the active site being represented by the sequence motif PICTLKNFP []. Not all proteins in this entry contain a functional active site.; PDB: 3CMM_A 1Y8Q_B 1Y8R_E 3KYD_B 3KYC_B 2PX9_A 1Z7L_A 3GZN_D 3DBL_F 1R4N_H ....
Probab=42.92  E-value=21  Score=17.39  Aligned_cols=12  Identities=25%  Similarity=0.517  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHH
Q psy17851         32 AISKACYERMFR   43 (60)
Q Consensus        32 alaK~lY~rLF~   43 (60)
                      ..||.+|+.+|.
T Consensus        34 ~wAk~~f~~~F~   45 (45)
T PF10585_consen   34 EWAKDLFEELFG   45 (45)
T ss_dssp             HHHHHHHHHHHT
T ss_pred             HHHHHHHHHHhC
Confidence            468899999984


No 36 
>PF11774 Lsr2:  Lsr2 ;  InterPro: IPR024412 This entry represents Lsr2, which is a small, basic DNA-bridging protein present in Mycobacterium and related actinomycetes. It is a functional homologue of the H-NS-like proteins []. H-NS proteins play a role in nucleoid organisation and also function as a pleiotropic regulator of gene expression [, ].; PDB: 4E1R_B 4E1P_B 2KNG_A.
Probab=42.17  E-value=68  Score=18.48  Aligned_cols=28  Identities=7%  Similarity=-0.079  Sum_probs=23.5

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAISKAC   37 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdalaK~l   37 (60)
                      ....|..++.-|+.+.|...|++|++.|
T Consensus        24 F~ldG~~YeIDLs~~na~~lr~~l~~yi   51 (110)
T PF11774_consen   24 FGLDGVDYEIDLSAENAAKLRDALAPYI   51 (110)
T ss_dssp             EEETTEEEEEEE-HHHHHHHHHHHHHHH
T ss_pred             EEECCeEEEEECCHHHHHHHHHHHHHHH
Confidence            3457999999999999999999999865


No 37 
>PF00380 Ribosomal_S9:  Ribosomal protein S9/S16;  InterPro: IPR000754 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein S9 is one of the proteins from the small ribosomal subunit. It belongs to the S9P family of ribosomal proteins which, on the basis of sequence similarities [, ], groups bacterial; algal chloroplast; cyanelle and archaeal S9 proteins; and mammalian; plant; and yeast mitochondrial ribosomal S9 proteins. These proteins adopt a beta-alpha-beta fold similar to that found in numerous RNA/DNA-binding proteins, as well as in kinases from the GHMP kinase family [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2V46_I 3T1H_I 3MR8_I 3F1G_I 3D5C_I 3D5A_I 2WDG_I 3MS0_I 2WDM_I 2J02_I ....
Probab=42.14  E-value=34  Score=20.11  Aligned_cols=18  Identities=22%  Similarity=0.076  Sum_probs=15.1

Q ss_pred             CHHHHHHHHHHHHHHHHH
Q psy17851         22 TKEQVEFAVEAISKACYE   39 (60)
Q Consensus        22 ~~~~a~~~rdalaK~lY~   39 (60)
                      ...||...|.++||+|=.
T Consensus        63 ~~gQa~Air~aiaraL~~   80 (121)
T PF00380_consen   63 ISGQAGAIRLAIARALVK   80 (121)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             EeeehHHHHHHHHHHHHH
Confidence            356999999999999954


No 38 
>PF09715 Plasmod_dom_1:  Plasmodium protein of unknown function (Plasmod_dom_1);  InterPro: IPR006410 These sequences represent an uncharacterised family consisting of a small number of hypothetical proteins of the malaria parasite Plasmodium falciparum (isolate 3D7). 
Probab=41.83  E-value=20  Score=19.31  Aligned_cols=26  Identities=23%  Similarity=0.218  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy17851         25 QVEFAVEAISKACYERMFRWLVNRIN   50 (60)
Q Consensus        25 ~a~~~rdalaK~lY~rLF~wiV~~IN   50 (60)
                      .+.....|++--+---.|.||++|||
T Consensus        40 n~l~~~~a~~p~~~i~~~~Yi~~Rin   65 (67)
T PF09715_consen   40 NSLSLMTAAIPFFAIPIFPYIVKRIN   65 (67)
T ss_pred             HHHHHHHHhccchhhHHHHHHHHHhh
Confidence            33444555442222356789999998


No 39 
>PF00605 IRF:  Interferon regulatory factor transcription factor;  InterPro: IPR001346 Viral infections induce the expression of type I interferons (IFN-alpha and IFN-beta) genes. The induction is due to the transcriptional activation of the IFN genes. Interferon regulatory factor I (IRF-1) is one of the transcription factors responsible for that activation. IRF-1 binds to an upstream regulatory cis element, known as the interferon consensus sequence (ICS), which is found in the promoters of type I IFN and IFN-inducible MHC class I genes. Interferon regulatory factor 2 (IRF-2) is a protein that also interacts with the ICS, but that does not function as an activator; rather, it suppresses the function of IRF-1 under certain circumstances []. These proteins share a highly conserved N-terminal domain of about 100 amino acid residues which is involved in DNA-binding and which contain five conserved tryptophans. This domain is known as a 'tryptophan pentad repeat' or a 'tryptophan cluster' and is also present in:  Interferon consensus sequence binding protein (ICSBP) [], a transcription factor expressed predominantly in lymphoid tissues and induced by IFN-gamma that also binds to the ICS. Transcriptional regulator ISGF3 gamma subunit []. ISGF3 is responsible for the initial stimulation of interferon-alpha-responsive genes. It recognises and binds to the interferon-stimulated response element (ISRE) within the regulatory sequences of target genes. Interferon regulatory factor 3 (IRF-3). Interferon regulatory factor 4 (IRF-4) which binds to the interferon- stimulated response element (ISRE) of the MHC class I promoter. Interferon regulatory factor 5 (IRF-5). Interferon regulatory factor 6 (IRF-6). Interferon regulatory factor 7 (IRF-7). Gamma Herpesviruses vIRF-1, -2 and -3, proteins with homology to the cellular transcription factors of the IRF family []. Neither vIRF-1 nor vIRF-2 bind to DNA with the same specificity as cellular IRFs, indicating that if vIRFs are DNA-binding proteins, their binding has a pattern distinct from that of the cellular IRFs. Whether vIRF-3 can bind DNA with the same specificity as cellular IRFs is not known.  The IRF tryptophan pentad repeat DNA-binding domain has an alpha/beta architecture comprising a cluster of three alpha-helices (alpha1-alpha3) flanked on one side by a mixed four-stranded beta-sheet (beta1-beta4). It forms a helix-turn-helix motif that binds to ISRE consensus sequences found in target promoters. Three of the tryptophan residues contact DNA by recognising a GAAA sequence []. This entry represents the IRF tryptophan pentad repeat DNA-binding domain.; GO: 0000975 regulatory region DNA binding; PDB: 2IRF_H 1IRF_A 1IRG_A 2DLL_A 3QU3_C 2PI0_D 2O6G_G 1T2K_A 2O61_A 3QU6_C ....
Probab=41.14  E-value=22  Score=20.57  Aligned_cols=16  Identities=25%  Similarity=0.596  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHhhcccc
Q psy17851         40 RMFRWLVNRINRSLDT   55 (60)
Q Consensus        40 rLF~wiV~~IN~~l~~   55 (60)
                      ||-.||+..||+-.-+
T Consensus         3 rlr~WL~~~i~sg~yp   18 (109)
T PF00605_consen    3 RLRPWLIEQIDSGRYP   18 (109)
T ss_dssp             -HHHHHHHHHHHTCST
T ss_pred             cHHHHHHHHHhcCCCC
Confidence            6789999999986543


No 40 
>TIGR01519 plasmod_dom_1 Plasmodium falciparum uncharacterized domain. This model represents an uncharacterized domain present in roughly eight hypothetical proteins of the malaria parasite Plasmodium falciparum.
Probab=40.95  E-value=21  Score=19.33  Aligned_cols=12  Identities=25%  Similarity=0.567  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHhh
Q psy17851         40 RMFRWLVNRINR   51 (60)
Q Consensus        40 rLF~wiV~~IN~   51 (60)
                      -.|.||++|||-
T Consensus        55 ~i~~Yi~~RinF   66 (70)
T TIGR01519        55 PILSYITKRINF   66 (70)
T ss_pred             hhHHHHHHHHHh
Confidence            457899999993


No 41 
>CHL00079 rps9 ribosomal protein S9
Probab=36.20  E-value=38  Score=20.24  Aligned_cols=18  Identities=17%  Similarity=0.099  Sum_probs=15.3

Q ss_pred             CHHHHHHHHHHHHHHHHH
Q psy17851         22 TKEQVEFAVEAISKACYE   39 (60)
Q Consensus        22 ~~~~a~~~rdalaK~lY~   39 (60)
                      ...||...|.++||+|-.
T Consensus        72 ~sgQa~Air~aIaraLv~   89 (130)
T CHL00079         72 LTGQAEAIRLGLARALCK   89 (130)
T ss_pred             hhHHHHHHHHHHHHHHHH
Confidence            356999999999999965


No 42 
>COG0103 RpsI Ribosomal protein S9 [Translation, ribosomal structure and biogenesis]
Probab=36.14  E-value=39  Score=20.41  Aligned_cols=17  Identities=24%  Similarity=0.165  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy17851         23 KEQVEFAVEAISKACYE   39 (60)
Q Consensus        23 ~~~a~~~rdalaK~lY~   39 (60)
                      .-||...|.++||+|-.
T Consensus        73 ~GQA~AiR~gIaRAL~~   89 (130)
T COG0103          73 SGQAGAIRHGIARALVE   89 (130)
T ss_pred             hHHHHHHHHHHHHHHHH
Confidence            46999999999999843


No 43 
>PF11314 DUF3117:  Protein of unknown function (DUF3117);  InterPro: IPR021465  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=36.13  E-value=64  Score=16.38  Aligned_cols=23  Identities=13%  Similarity=0.125  Sum_probs=20.2

Q ss_pred             CceEEEeeCCHHHHHHHHHHHHH
Q psy17851         13 GRDFVTKSQTKEQVEFAVEAISK   35 (60)
Q Consensus        13 ~~e~~~~~~~~~~a~~~rdalaK   35 (60)
                      ||-..+..++.++|....++|..
T Consensus        27 GGGRLVvEl~~~Ea~~L~~~l~~   49 (51)
T PF11314_consen   27 GGGRLVVELNPDEAKELGEALKE   49 (51)
T ss_pred             CCcEEEEEeCHHHHHHHHHHHHh
Confidence            67889999999999998888864


No 44 
>PRK01917 cation-binding hemerythrin HHE family protein; Provisional
Probab=35.97  E-value=62  Score=18.94  Aligned_cols=21  Identities=5%  Similarity=0.262  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHhh
Q psy17851         31 EAISKACYERMFRWLVNRINR   51 (60)
Q Consensus        31 dalaK~lY~rLF~wiV~~IN~   51 (60)
                      ..++..+...|.+|+++.|..
T Consensus        96 ~~~~~~l~~~L~~Wl~~HI~~  116 (139)
T PRK01917         96 FELGRRLVAELPEWFDQHVRT  116 (139)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            347778889999999998863


No 45 
>COG5004 P2-like prophage tail protein X [General function prediction only]
Probab=35.19  E-value=63  Score=17.40  Aligned_cols=21  Identities=19%  Similarity=0.264  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q psy17851         28 FAVEAISKACYERMFRWLVNRI   49 (60)
Q Consensus        28 ~~rdalaK~lY~rLF~wiV~~I   49 (60)
                      +..|+||-..|+|+-. +++-+
T Consensus        11 DtvDalc~~~Ygrt~~-v~eav   31 (70)
T COG5004          11 DTVDALCWRVYGRTTG-VTEAV   31 (70)
T ss_pred             chHHHHHHHHHhhHHH-HHHHH
Confidence            5789999999999943 55533


No 46 
>PRK13916 plasmid segregation protein ParR; Provisional
Probab=34.83  E-value=26  Score=19.90  Aligned_cols=15  Identities=40%  Similarity=0.702  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHHH
Q psy17851         33 ISKACYERMFRWLVN   47 (60)
Q Consensus        33 laK~lY~rLF~wiV~   47 (60)
                      +-|.=|+.||++||+
T Consensus        12 i~r~~~~~iF~FL~~   26 (97)
T PRK13916         12 IKKEDYPQIFDFLEN   26 (97)
T ss_pred             hcccccHHHHHHHHH
Confidence            346668999999986


No 47 
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism]
Probab=33.75  E-value=46  Score=23.91  Aligned_cols=24  Identities=25%  Similarity=0.487  Sum_probs=20.7

Q ss_pred             HHHHHHHHHHHHH-HHHHHHHHhhc
Q psy17851         29 AVEAISKACYERM-FRWLVNRINRS   52 (60)
Q Consensus        29 ~rdalaK~lY~rL-F~wiV~~IN~~   52 (60)
                      ..++||-.||+.+ |+||-.||++.
T Consensus       312 dmealAvGL~e~~~~~yl~~Rv~Qv  336 (471)
T COG3033         312 DMEALAVGLREGVNFDYLAHRVAQV  336 (471)
T ss_pred             hHHHHHHHHHHhcCcHHHHHHHHHH
Confidence            4568999999887 99999999974


No 48 
>COG4803 Predicted membrane protein [Function unknown]
Probab=33.74  E-value=59  Score=20.37  Aligned_cols=25  Identities=24%  Similarity=0.275  Sum_probs=22.2

Q ss_pred             eCceEEEeeCCHHHHHHHHHHHHHH
Q psy17851         12 VGRDFVTKSQTKEQVEFAVEAISKA   36 (60)
Q Consensus        12 ~~~e~~~~~~~~~~a~~~rdalaK~   36 (60)
                      .++..+.++++.++=...|++++.+
T Consensus       139 ~~g~vlrTSLs~e~E~~Lr~a~~~~  163 (170)
T COG4803         139 FGGTVLRTSLSKEEEQKLRAALSEG  163 (170)
T ss_pred             cCCEEEEccCCHHHHHHHHHHHhcc
Confidence            4789999999999999999999864


No 49 
>PF14837 INTS5_N:  Integrator complex subunit 5 N-terminus
Probab=33.72  E-value=15  Score=23.78  Aligned_cols=18  Identities=22%  Similarity=0.471  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHhhccc
Q psy17851         37 CYERMFRWLVNRINRSLD   54 (60)
Q Consensus        37 lY~rLF~wiV~~IN~~l~   54 (60)
                      -|+--|||||.+|-.+..
T Consensus       178 ~hsphFDWVvahigs~FP  195 (213)
T PF14837_consen  178 QHSPHFDWVVAHIGSCFP  195 (213)
T ss_pred             ccCCchhhhHHHHHhhCc
Confidence            467789999999977653


No 50 
>PLN00210 40S ribosomal protein S16; Provisional
Probab=33.51  E-value=51  Score=19.96  Aligned_cols=17  Identities=24%  Similarity=0.182  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy17851         23 KEQVEFAVEAISKACYE   39 (60)
Q Consensus        23 ~~~a~~~rdalaK~lY~   39 (60)
                      ..||...|.++||+|=.
T Consensus        73 sgQa~Air~aiaraL~~   89 (141)
T PLN00210         73 TSQIYAIRQSIAKALVA   89 (141)
T ss_pred             hHHHHHHHHHHHHHHHH
Confidence            46999999999999955


No 51 
>PRK00132 rpsI 30S ribosomal protein S9; Reviewed
Probab=33.17  E-value=54  Score=19.56  Aligned_cols=17  Identities=24%  Similarity=0.186  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy17851         23 KEQVEFAVEAISKACYE   39 (60)
Q Consensus        23 ~~~a~~~rdalaK~lY~   39 (60)
                      ..||...|.++||+|-.
T Consensus        73 sgQa~Air~aiaraLv~   89 (130)
T PRK00132         73 SGQAGAIRHGIARALLE   89 (130)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            46899999999999965


No 52 
>PF11165 DUF2949:  Protein of unknown function (DUF2949);  InterPro: IPR021336  This family of proteins with unknown function appear to be restricted to Cyanobacteria. 
Probab=33.06  E-value=31  Score=17.96  Aligned_cols=8  Identities=38%  Similarity=1.315  Sum_probs=6.1

Q ss_pred             HHHHHHHH
Q psy17851         38 YERMFRWL   45 (60)
Q Consensus        38 Y~rLF~wi   45 (60)
                      .+++|+|+
T Consensus        49 L~~i~DWl   56 (58)
T PF11165_consen   49 LDQIFDWL   56 (58)
T ss_pred             HHHHHHHH
Confidence            56788886


No 53 
>PF06897 DUF1269:  Protein of unknown function (DUF1269);  InterPro: IPR009200 There are currently no experimental data for members of this group or their homologues. However, these proteins are predicted to contain two or more transmembrane segments.
Probab=32.53  E-value=62  Score=18.38  Aligned_cols=24  Identities=21%  Similarity=0.286  Sum_probs=20.6

Q ss_pred             eCceEEEeeCCHHHHHHHHHHHHH
Q psy17851         12 VGRDFVTKSQTKEQVEFAVEAISK   35 (60)
Q Consensus        12 ~~~e~~~~~~~~~~a~~~rdalaK   35 (60)
                      .++..+.++++.++-...++++.+
T Consensus        78 ~gg~v~~t~ls~~~e~~L~~al~~  101 (102)
T PF06897_consen   78 FGGKVLRTSLSEEDEDELQEALDE  101 (102)
T ss_pred             cCCEEEeccCCHHHHHHHHHHHhc
Confidence            467899999999999988888875


No 54 
>PF03165 MH1:  MH1 domain;  InterPro: IPR003619 Mammalian dwarfins are phosphorylated in response to transforming growth factor beta and are implicated in control of cell growth []. The dwarfin family also includes the Drosophila protein MAD that is required for the function of decapentaplegic (DPP) and may play a role in DPP signalling. Drosophila Mad binds to DNA and directly mediates activation of vestigial by Dpp []. This domain is also found in nuclear factor I (NF-I) or CCAAT box-binding transcription factor (CTF). This entry represents the MH1 (MAD homology 1) domain is found at the amino terminus of MAD related proteins such as Smads. This domain is separated from the MH2 domain by a non-conserved linker region. The crystal structure of the MH1 domain shows that a highly conserved 11 residue beta hairpin is used to bind the DNA consensus sequence GNCN in the major groove, shown to be vital for the transcriptional activation of target genes. Not all examples of MH1 can bind to DNA however. Smad2 cannot bind DNA and has a large insertion within the hairpin that presumably abolishes DNA binding. A basic helix (H2) in MH1 with the nuclear localisation signal KKLKK has been shown to be essential for Smad3 nuclear import. Smads also use the MH1 domain to interact with transcription factors such as Jun, TFE3, Sp1, and Runx [, , ].; GO: 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 3QSV_A 1MHD_A 1OZJ_A 3KMP_B.
Probab=32.44  E-value=21  Score=20.42  Aligned_cols=15  Identities=27%  Similarity=0.820  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHHHH
Q psy17851         30 VEAISKACYERMFRW   44 (60)
Q Consensus        30 rdalaK~lY~rLF~w   44 (60)
                      +..+.-.+|.|||.|
T Consensus        52 ~k~~phvl~crlwRw   66 (103)
T PF03165_consen   52 RKGLPHVLYCRLWRW   66 (103)
T ss_dssp             EEE-HHHHHHHHHT-
T ss_pred             cccCceEEEEEEech
Confidence            445677899999999


No 55 
>PF02184 HAT:  HAT (Half-A-TPR) repeat;  InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing. They are structurally and sequentially similar to TPRs (tetratricopeptide repeats), though they lack the highly conserved alanine and glycine residues found in TPRs. The number of HAT repeats found in different proteins varies between 9 and 12. HAT-repeat-containing proteins appear to be components of macromolecular complexes that are required for RNA processing []. The repeats may be involved in protein-protein interactions. The HAT motif has striking structural similarities to HEAT repeats (IPR000357 from INTERPRO), being of a similar length and consisting of two short helices connected by a loop domain, as in HEAT repeats.; GO: 0006396 RNA processing, 0005622 intracellular
Probab=32.43  E-value=36  Score=15.65  Aligned_cols=9  Identities=33%  Similarity=0.800  Sum_probs=6.8

Q ss_pred             HHHHHHHHH
Q psy17851         34 SKACYERMF   42 (60)
Q Consensus        34 aK~lY~rLF   42 (60)
                      |++||+|.-
T Consensus         6 AR~IyeR~v   14 (32)
T PF02184_consen    6 ARSIYERFV   14 (32)
T ss_pred             HHHHHHHHH
Confidence            678999853


No 56 
>smart00337 BCL BCL (B-Cell lymphoma); contains BH1, BH2 regions. (BH1, BH2, (BH3 (one helix only)) and not BH4(one helix only)). Involved in apoptosis regulation
Probab=31.33  E-value=98  Score=17.12  Aligned_cols=24  Identities=17%  Similarity=0.228  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q psy17851         24 EQVEFAVEAISKACYERMFRWLVN   47 (60)
Q Consensus        24 ~~a~~~rdalaK~lY~rLF~wiV~   47 (60)
                      +.....-+.++..|++++-+||.+
T Consensus        73 ~~~~~i~~~~~~~l~~~l~~Wi~~   96 (100)
T smart00337       73 DLVSRLASWLSEFLRETLRSWIRE   96 (100)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344455666777888888888754


No 57 
>cd00522 Hemerythrin Hemerythrin (Hr) is a non-heme diiron oxygen transport protein found in four marine invertebrate phyla including priapulida, brachiopoda, sipunculida, and annelida, as well as in protozoa. Myohemerythrin (Mhr), a hemerythrin homolog, is found in the muscle tissue of sipunculids as well as in polycheate and oligocheate annelids. In addition to oxygen transport, Mhr proteins are involved in cadmium fixation and host anti-bacterial defense. Hr and Mhr proteins have the same "four alpha helix bundle" motif and active site structure. Hr forms oligomers, the octameric form being most prevalent, while Mhr is monomeric.
Probab=31.26  E-value=1e+02  Score=17.25  Aligned_cols=23  Identities=26%  Similarity=0.447  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhh
Q psy17851         29 AVEAISKACYERMFRWLVNRINR   51 (60)
Q Consensus        29 ~rdalaK~lY~rLF~wiV~~IN~   51 (60)
                      .+..++..+..-|.+|+++.|..
T Consensus        82 ~~~~~~~~~~~~l~~Wl~~HI~~  104 (113)
T cd00522          82 LKAPVGQADLKYLKDWLVNHIKT  104 (113)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhHh
Confidence            34445667888899999998864


No 58 
>PF07541 EIF_2_alpha:  Eukaryotic translation initiation factor 2 alpha subunit;  InterPro: IPR011488 In Eukaryota and Archaea, translation initiation factor 2 (eIF2/aIF2), which contains three subunits (alpha, beta and gamma), is pivotal for binding of charged initiator tRNA to the small ribosomal subunit. This entry represents the alpha subunit of both eukaryota and archaeal translation initiator factor 2.; GO: 0003723 RNA binding, 0003743 translation initiation factor activity, 0005850 eukaryotic translation initiation factor 2 complex; PDB: 2QN6_B 3CW2_C 2AHO_B 3QSY_B 3V11_B 2QMU_B 1YZ7_A 1YZ6_A 3AEV_A 1KL9_A ....
Probab=31.02  E-value=88  Score=17.94  Aligned_cols=34  Identities=15%  Similarity=0.132  Sum_probs=27.1

Q ss_pred             ccccceEEeCceEEEeeCCHHHHHHHHHHHHHHH
Q psy17851          4 AFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKAC   37 (60)
Q Consensus         4 aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~l   37 (60)
                      -+..+.++++++.-.+....+.....|++|-++.
T Consensus        53 ~i~~~~vkI~~~iel~c~~~dGIe~IK~aL~~~~   86 (114)
T PF07541_consen   53 RIKPQPVKIRADIELTCFAPDGIEAIKKALRAAE   86 (114)
T ss_dssp             HCCHT-EEEEEEEEEEE-STTHHHHHHHHHHHHH
T ss_pred             hCcCCcEEEEEEEEEEeCCCCHHHHHHHHHHHHH
Confidence            3556778899999999999999999999997765


No 59 
>PTZ00086 40S ribosomal protein S16; Provisional
Probab=30.71  E-value=62  Score=19.76  Aligned_cols=17  Identities=24%  Similarity=0.073  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy17851         23 KEQVEFAVEAISKACYE   39 (60)
Q Consensus        23 ~~~a~~~rdalaK~lY~   39 (60)
                      ..||...|.++||+|=.
T Consensus        79 sgQA~Air~aIaRAL~~   95 (147)
T PTZ00086         79 VAQAYAIRQAIAKGLVA   95 (147)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            46999999999999955


No 60 
>PF06481 COX_ARM:  COX Aromatic Rich Motif;  InterPro: IPR010514 COX2 (Cytochrome O ubiquinol OXidase 2) is a major component of the respiratory complex during vegetative growth. It transfers electrons from a quinol to the binuclear centre of the catalytic subunit 1. The function of this region is not known.; GO: 0008827 cytochrome o ubiquinol oxidase activity, 0022900 electron transport chain, 0055114 oxidation-reduction process, 0016021 integral to membrane; PDB: 1CYX_A 1CYW_A 1FFT_G.
Probab=30.52  E-value=40  Score=16.39  Aligned_cols=10  Identities=20%  Similarity=0.312  Sum_probs=7.7

Q ss_pred             HHHHHHHHHH
Q psy17851         40 RMFRWLVNRI   49 (60)
Q Consensus        40 rLF~wiV~~I   49 (60)
                      .||+.||.+-
T Consensus        33 ~LF~~Iv~k~   42 (47)
T PF06481_consen   33 GLFDDIVMKY   42 (47)
T ss_dssp             THHHHHHHHT
T ss_pred             HHHHHHHHHh
Confidence            5888888764


No 61 
>PRK00474 rps9p 30S ribosomal protein S9P; Reviewed
Probab=30.38  E-value=54  Score=19.68  Aligned_cols=17  Identities=29%  Similarity=0.257  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy17851         23 KEQVEFAVEAISKACYE   39 (60)
Q Consensus        23 ~~~a~~~rdalaK~lY~   39 (60)
                      ..||...|.++||+|-.
T Consensus        73 sgQa~Air~aIaraL~~   89 (134)
T PRK00474         73 MGQADAARTAIARGLVE   89 (134)
T ss_pred             hHHHHHHHHHHHHHHHH
Confidence            45899999999999965


No 62 
>KOG0136|consensus
Probab=30.25  E-value=28  Score=26.26  Aligned_cols=12  Identities=33%  Similarity=0.935  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHH
Q psy17851         36 ACYERMFRWLVN   47 (60)
Q Consensus        36 ~lY~rLF~wiV~   47 (60)
                      .+|++||+|--.
T Consensus       632 nVYenLFewAk~  643 (670)
T KOG0136|consen  632 NVYENLFEWAKK  643 (670)
T ss_pred             chhHHHHHHHhh
Confidence            589999999765


No 63 
>TIGR03627 arch_S9P archaeal ribosomal protein S9P. This model describes exclusively the archaeal ribosomal protein S9P. Homologous eukaryotic and bacterial ribosomal proteins are excluded from this model.
Probab=30.08  E-value=55  Score=19.52  Aligned_cols=17  Identities=29%  Similarity=0.257  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy17851         23 KEQVEFAVEAISKACYE   39 (60)
Q Consensus        23 ~~~a~~~rdalaK~lY~   39 (60)
                      ..||...|.++|++|-.
T Consensus        69 sgQa~Air~aIaraL~~   85 (130)
T TIGR03627        69 MGQADAARTAIARGLVE   85 (130)
T ss_pred             hHHHHHHHHHHHHHHHH
Confidence            45899999999999965


No 64 
>PRK00078 Maf-like protein; Reviewed
Probab=29.86  E-value=87  Score=19.61  Aligned_cols=25  Identities=16%  Similarity=0.219  Sum_probs=20.0

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..|+
T Consensus        74 V~~~g~ilgKP~~~eeA~~~L~~ls   98 (192)
T PRK00078         74 VAFNGKVLGKPKDEEDAFEMLKALS   98 (192)
T ss_pred             EEECCEEeCCCCCHHHHHHHHHHHC
Confidence            4468899999999999988665553


No 65 
>cd01816 Raf_RBD Ubiquitin domain of  Raf serine/threonine kinases. The Raf serine/threonine kinases are composed of three conserved regions, CR1, CR2 and CR3.  CR1 has two Ras binding domains (RBD and CRD), CR2 is a serine/threonine rich domain and CR3 is the catalytic kinase domain.  The RBD of Raf is structurally similar to ubiquitin with little of no sequence similarity.The Raf signalling pathway plays an important role in the proliferation and survival of tumor cells.
Probab=29.47  E-value=43  Score=18.32  Aligned_cols=12  Identities=25%  Similarity=0.102  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHH
Q psy17851         27 EFAVEAISKACY   38 (60)
Q Consensus        27 ~~~rdalaK~lY   38 (60)
                      ...||||+|+|=
T Consensus        20 ~tl~daL~KaLk   31 (74)
T cd01816          20 MTLRDALAKALK   31 (74)
T ss_pred             cCHHHHHHHHHH
Confidence            357899999983


No 66 
>PRK04694 Maf-like protein; Reviewed
Probab=28.48  E-value=94  Score=19.44  Aligned_cols=25  Identities=16%  Similarity=0.228  Sum_probs=20.0

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..++
T Consensus        74 v~~~g~ilgKP~~~~eA~~~L~~ls   98 (190)
T PRK04694         74 VVLGERVFGKPVDVDDAIAMLRALS   98 (190)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHhC
Confidence            4458899999999999988665553


No 67 
>KOG3749|consensus
Probab=28.32  E-value=41  Score=24.90  Aligned_cols=13  Identities=23%  Similarity=0.836  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHhh
Q psy17851         39 ERMFRWLVNRINR   51 (60)
Q Consensus        39 ~rLF~wiV~~IN~   51 (60)
                      +|+|+||..|++.
T Consensus       552 ~RVlewI~rR~~g  564 (640)
T KOG3749|consen  552 ARVLEWIFRRVAG  564 (640)
T ss_pred             hHHHHHHHHHhcc
Confidence            4889999999875


No 68 
>PF14409 Herpeto_peptide:  Ribosomally synthesized peptide in Herpetosiphon
Probab=28.10  E-value=29  Score=18.09  Aligned_cols=11  Identities=36%  Similarity=1.008  Sum_probs=7.8

Q ss_pred             HHHHHHHHhhc
Q psy17851         42 FRWLVNRINRS   52 (60)
Q Consensus        42 F~wiV~~IN~~   52 (60)
                      |.|+++||+.-
T Consensus         3 ~r~~~dr~~~~   13 (58)
T PF14409_consen    3 FRWFADRTTEY   13 (58)
T ss_pred             chhhhhhhhhh
Confidence            67888887753


No 69 
>PRK00148 Maf-like protein; Reviewed
Probab=28.04  E-value=99  Score=19.40  Aligned_cols=25  Identities=16%  Similarity=0.186  Sum_probs=20.0

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..++
T Consensus        71 V~~~g~Il~KP~~~eeA~~~L~~ls   95 (194)
T PRK00148         71 LLIDGRLLGKPHTPEEAIERWQQMS   95 (194)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHhC
Confidence            4458899999999999988665553


No 70 
>PF01756 ACOX:  Acyl-CoA oxidase;  InterPro: IPR002655 Acyl-CoA oxidase (ACO) acts on CoA derivatives of fatty acids with chain lengths from 8 to 18. It catalyses the first and rate-determining step of the peroxisomal beta-oxidation of fatty acids []. Acyl-CoA oxidase is a homodimer and the polypeptide chain of the subunit is folded into the N-terminal alpha-domain, beta-domain, and C-terminal alpha-domain []. Functional differences between the peroxisomal acyl-CoA oxidases and the mitochondrial acyl-CoA dehydrogenases are attributed to structural differences in the FAD environments [].  Experimental data indicate that, in the pumpkin, the expression pattern of ACOX is very similar to that of the glyoxysomal enzyme 3-ketoacyl-CoA thiolase []. In humans, defects in ACOX1 are the cause of pseudoneonatal adrenoleukodystrophy, also known as peroxisomal acyl-CoA oxidase deficiency. Pseudo-NALD is a peroxisomal single-enzyme disorder. Clinical features include mental retardation, leukodystrophy, seizures, mild hepatomegaly and hearing deficit. Pseudo-NALD is characterised by increased plasma levels of very-long chain fatty acids due to a decrease in, or absence of, peroxisome acyl-CoA oxidase activity, despite the peroxisomes being intact and functioning. This entry represents the Acyl-CoA oxidase C-terminal.; GO: 0003997 acyl-CoA oxidase activity, 0006635 fatty acid beta-oxidation, 0055114 oxidation-reduction process, 0005777 peroxisome; PDB: 2FON_A 1IS2_B 2DDH_A 1W07_B.
Probab=27.78  E-value=44  Score=20.36  Aligned_cols=12  Identities=33%  Similarity=0.911  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHH
Q psy17851         36 ACYERMFRWLVN   47 (60)
Q Consensus        36 ~lY~rLF~wiV~   47 (60)
                      .+|++||+|.-.
T Consensus       153 ~vYe~l~~~a~~  164 (187)
T PF01756_consen  153 DVYEALFEWAKK  164 (187)
T ss_dssp             -HHHHHHHHHHH
T ss_pred             hHHHHHHHHHHH
Confidence            579999999655


No 71 
>PF12614 RRF_GI:  Ribosome recycling factor ;  InterPro: IPR022253  This family of proteins is found in bacteria and viruses. Proteins in this family are approximately 130 amino acids in length. There are two conserved sequence motifs: LPS and LKR. Overproduction of ribosome recycling factor (RRF) reduces tna operon expression and increases the rate of cleavage of TnaC-tRNA(2)(Pro), relieving the growth inhibition associated with plasmid-mediated tnaC overexpression. 
Probab=27.46  E-value=1.5e+02  Score=17.87  Aligned_cols=21  Identities=19%  Similarity=0.227  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHhhccccccc
Q psy17851         38 YERMFRWLVNRINRSLDTIMC   58 (60)
Q Consensus        38 Y~rLF~wiV~~IN~~l~~~~~   58 (60)
                      =..-|+|++.+|+..+....|
T Consensus        64 ~~~~~~~li~kie~~L~~~~d   84 (128)
T PF12614_consen   64 DYEEFQFLIKKIEAALLQHSD   84 (128)
T ss_pred             chHHHHHHHHHHHHHhccccc
Confidence            455899999999999976654


No 72 
>cd00103 IRF Interferon Regulatory Factor (IRF); also known as tryptophan pentad repeat. The family of IRF transcription factors is important in the regulation of interferons in response to infection by virus and in the regulation of interferon-inducible genes. The IRF family is characterized by a unique 'tryptophan cluster' DNA-binding region. Viral IRFs bind to cellular IRFs; block type I and II interferons and host IRF-mediated transcriptional activation.
Probab=27.19  E-value=40  Score=19.35  Aligned_cols=16  Identities=25%  Similarity=0.603  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHhhcccc
Q psy17851         40 RMFRWLVNRINRSLDT   55 (60)
Q Consensus        40 rLF~wiV~~IN~~l~~   55 (60)
                      +|=.|||..||+---+
T Consensus         3 ~lr~WL~~~i~sg~yp   18 (107)
T cd00103           3 RLRPWLVEQVDSGTYP   18 (107)
T ss_pred             chHHHHHHHhccCCCC
Confidence            6778999999976544


No 73 
>PF04888 SseC:  Secretion system effector C (SseC) like family ;  InterPro: IPR006972 SseC is a secreted protein that forms a complex together with SecB and SecD on the surface of Salmonella typhimurium. All these proteins are secreted by the type III secretion system []. Many mucosal pathogens use type III secretion systems for the injection of effector proteins into target cells. SecB, SseC and SecD are inserted into the target cell membrane. where they form a small pore or translocon [, ]. In addition to SseC, this family includes the bacterial secreted proteins PopB, PepB, YopB and EspD which are thought to be directly involved in pore formation, and type III secretion system translocon.; GO: 0009405 pathogenesis
Probab=27.05  E-value=68  Score=21.04  Aligned_cols=13  Identities=15%  Similarity=0.756  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHH
Q psy17851         36 ACYERMFRWLVNR   48 (60)
Q Consensus        36 ~lY~rLF~wiV~~   48 (60)
                      .+.+.+|+||+.-
T Consensus        56 Gi~~kIf~wi~~a   68 (306)
T PF04888_consen   56 GIFSKIFGWIGTA   68 (306)
T ss_pred             ChHHHHHHHHHHH
Confidence            6899999999864


No 74 
>TIGR00172 maf MAF protein. This nonessential gene causes inhibition of septation when overexpressed. A member of the family is found in the Archaeon Pyrococcus horikoshii and another in the round worm Caenorhabditis elegans.
Probab=26.95  E-value=1.1e+02  Score=19.02  Aligned_cols=25  Identities=16%  Similarity=0.238  Sum_probs=20.0

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..++
T Consensus        73 V~~~g~ilgKP~~~~eA~~~L~~ls   97 (183)
T TIGR00172        73 VILDGEIYGKPKDKEEAAEFLRKLS   97 (183)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHhC
Confidence            4458999999999999988665553


No 75 
>PF00042 Globin:  Globin plant globin signature erythrocruorin family signature alpha hemoglobin signature myoglobin signature thalassemia.;  InterPro: IPR000971 Globins are haem-containing proteins involved in binding and/or transporting oxygen. They belong to a very large and well studied family that is widely distributed in many organisms []. Globins have evolved from a common ancestor and can be divided into three groups: single-domain globins, and two types of chimeric globins, flavohaemoglobins and globin-coupled sensors. Bacteria have all three types of globins, while archaea lack flavohaemoglobins, and eukaryotes lack globin-coupled sensors []. Several functionally different haemoglobins can coexist in the same species. The major types of globins include:   Haemoglobin (Hb): trimer of two alpha and two beta chains, although embryonic and foetal forms can substitute the alpha or beta chain for ones with higher oxygen affinity, such as gamma, delta, epsilon or zeta chains. Hb transports oxygen from lungs to other tissues in vertebrates []. Hb proteins are also present in unicellular organisms where they act as enzymes or sensors []. Myoglobin (Mb): monomeric protein responsible for oxygen storage in vertebrate muscle [].  Neuroglobin: a myoglobin-like haemprotein expressed in vertebrate brain and retina, where it is involved in neuroprotection from damage due to hypoxia or ischemia []. Neuroglobin belongs to a branch of the globin family that diverged early in evolution.  Cytoglobin: an oxygen sensor expressed in multiple tissues. Related to neuroglobin []. Erythrocruorin: highly cooperative extracellular respiratory proteins found in annelids and arthropods that are assembled from as many as 180 subunit into hexagonal bilayers []. Leghaemoglobin (legHb or symbiotic Hb): occurs in the root nodules of leguminous plants, where it facilitates the diffusion of oxygen to symbiotic bacteriods in order to promote nitrogen fixation. Non-symbiotic haemoglobin (NsHb): occurs in non-leguminous plants, and can be over-expressed in stressed plants []. Flavohaemoglobins (FHb): chimeric, with an N-terminal globin domain and a C-terminal ferredoxin reductase-like NAD/FAD-binding domain. FHb provides protection against nitric oxide via its C-terminal domain, which transfers electrons to haem in the globin []. Globin-coupled sensors: chimeric, with an N-terminal myoglobin-like domain and a C-terminal domain that resembles the cytoplasmic signalling domain of bacterial chemoreceptors. They bind oxygen, and act to initiate an aerotactic response or regulate gene expression [, ].  Protoglobin: a single domain globin found in archaea that is related to the N-terminal domain of globin-coupled sensors []. Truncated 2/2 globin: lack the first helix, giving them a 2-over-2 instead of the canonical 3-over-3 alpha-helical sandwich fold. Can be divided into three main groups (I, II and II) based on structural features [].   This entry covers most of the globin family of proteins, but it omits some bacterial globins and the protoglobins. More information about these proteins can be found at Protein of the Month: Haemoglobin [].; GO: 0005506 iron ion binding, 0020037 heme binding; PDB: 2WTH_A 2WTG_A 3A59_G 3FS4_C 3CY5_C 3D1A_B 2RI4_J 3EU1_B 1JEB_A 2Z6N_B ....
Probab=26.57  E-value=82  Score=16.81  Aligned_cols=15  Identities=13%  Similarity=0.514  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHHHHHH
Q psy17851         29 AVEAISKACYERMFR   43 (60)
Q Consensus        29 ~rdalaK~lY~rLF~   43 (60)
                      ..+.++..+|.+||.
T Consensus        15 ~~~~~g~~~f~~lF~   29 (110)
T PF00042_consen   15 DKDEFGSEFFQRLFE   29 (110)
T ss_dssp             GHHHHHHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHH
Confidence            467788999999997


No 76 
>PRK01839 Maf-like protein; Reviewed
Probab=25.86  E-value=1.2e+02  Score=19.36  Aligned_cols=25  Identities=4%  Similarity=0.135  Sum_probs=20.1

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..++
T Consensus        91 V~~~g~IlgKP~~~eeA~~~L~~ls  115 (209)
T PRK01839         91 VTIDGAILGKPADAADALAMLTRLA  115 (209)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHhC
Confidence            4468899999999999988766554


No 77 
>cd00353 Ribosomal_S15p_S13e Ribosomal protein S15 (prokaryotic)_S13 (eukaryotic) binds the central domain of 16S rRNA and is required for assembly of the small ribosomal subunit and for intersubunit association, thus representing a key element in the assembly of the whole ribosome. S15 also plays an important autoregulatory role by binding and preventing its own mRNA from being translated. S15 has a predominantly alpha-helical fold that is highly structured except for the N-terminal alpha helix.
Probab=25.73  E-value=1.2e+02  Score=16.29  Aligned_cols=30  Identities=10%  Similarity=0.241  Sum_probs=23.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHH---HHHHHHHHHh
Q psy17851         21 QTKEQVEFAVEAISKACYER---MFRWLVNRIN   50 (60)
Q Consensus        21 ~~~~~a~~~rdalaK~lY~r---LF~wiV~~IN   50 (60)
                      .........|.-|.+.|+..   .|.|++.++|
T Consensus        48 rgL~~lv~kRrrLL~YLk~~~~~~y~~~i~~L~   80 (80)
T cd00353          48 RGLLLLVSKRRRLLKYLKRKDRLRYEWLIEKLG   80 (80)
T ss_pred             HhHHHHHHHHHHHHHHHHHcCchhHHHHHHhcc
Confidence            34445667788999999888   8999988754


No 78 
>PRK00648 Maf-like protein; Reviewed
Probab=25.55  E-value=1.1e+02  Score=19.07  Aligned_cols=25  Identities=12%  Similarity=0.161  Sum_probs=19.9

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..++
T Consensus        75 V~~~g~ilgKP~~~~eA~~~L~~ls   99 (191)
T PRK00648         75 VWYDGKVLGKPKDEEEAVEMLRTLS   99 (191)
T ss_pred             EEECCEEeCCCCCHHHHHHHHHHhC
Confidence            4468899999999999987665553


No 79 
>PRK14361 Maf-like protein; Provisional
Probab=24.84  E-value=1.2e+02  Score=18.90  Aligned_cols=25  Identities=16%  Similarity=0.295  Sum_probs=19.9

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..++
T Consensus        68 V~~~g~ilgKP~~~eeA~~~L~~ls   92 (187)
T PRK14361         68 VALGGVLLAKPADEAENEAFLRVLS   92 (187)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHhC
Confidence            4468899999999999988665553


No 80 
>PRK14364 Maf-like protein; Provisional
Probab=24.83  E-value=1.2e+02  Score=18.76  Aligned_cols=25  Identities=12%  Similarity=0.174  Sum_probs=19.8

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..++
T Consensus        67 V~~~g~ilgKP~~~eeA~~~L~~ls   91 (181)
T PRK14364         67 LGLDGQIIGKPDSKQHAFDIWKQLS   91 (181)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHhC
Confidence            4468899999999999987655543


No 81 
>smart00807 AKAP_110 A-kinase anchor protein 110 kDa. This family consists of several mammalian protein kinase A anchoring protein 3 (PRKA3) or A-kinase anchor protein 110 kDa (AKAP 110) sequences. Agents that increase intracellular cAMP are potent stimulators of sperm motility. Anchoring inhibitor peptides, designed to disrupt the interaction of the cAMP-dependent protein kinase A (PKA) with A kinase-anchoring proteins (AKAPs), are potent inhibitors of sperm motility. PKA anchoring is a key biochemical mechanism controlling motility. AKAP110 shares compartments with both RI and RII isoforms of PKA and may function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction PUBMED:10319321.
Probab=24.82  E-value=76  Score=24.19  Aligned_cols=24  Identities=17%  Similarity=0.254  Sum_probs=20.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHH
Q psy17851         21 QTKEQVEFAVEAISKACYERMFRW   44 (60)
Q Consensus        21 ~~~~~a~~~rdalaK~lY~rLF~w   44 (60)
                      +..+.|.+..||+-|-||+-||.=
T Consensus       370 hg~Q~AtdimdaML~kL~s~l~~~  393 (851)
T smart00807      370 HGSQKATDIMDAMLKKLYSVLFAK  393 (851)
T ss_pred             ccccchHHHHHHHHHHHHHHHHcc
Confidence            445678999999999999999973


No 82 
>cd04917 ACT_AKiii-LysC-EC_2 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII. This CD includes the second of two ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in bacteria (Escherichia coli (EC) LysC). Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. The E. coli AKIII (LysC) binds two feedback allosteric inhibitor lysine molecules at the dimer interface located between the ACT1 domain of two subunits. The second ACT domain (ACT2), this CD, is not involved in the binding of heterotrophic effectors. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=24.77  E-value=86  Score=15.36  Aligned_cols=14  Identities=14%  Similarity=0.368  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHHH
Q psy17851         30 VEAISKACYERMFR   43 (60)
Q Consensus        30 rdalaK~lY~rLF~   43 (60)
                      .+...+.||..+|+
T Consensus        51 ~~~a~~~Lh~~f~~   64 (64)
T cd04917          51 KDEVVQRLHSRLFE   64 (64)
T ss_pred             HHHHHHHHHHHHhC
Confidence            45567778888874


No 83 
>cd00555 Maf Nucleotide binding protein Maf. Maf has been implicated in inhibition of septum formation in eukaryotes, bacteria and archaea, but homologs in B.subtilis and S.cerevisiae are nonessential for cell division. Maf has been predicted to be a nucleotide- or nucleic acid-binding protein with structural similarity to the hypoxanthine/xanthine NTP pyrophosphatase Ham1 from Methanococcus jannaschii, RNase H from Escherichia coli, and some other nucleotide or RNA-binding proteins.
Probab=24.51  E-value=1.4e+02  Score=18.46  Aligned_cols=25  Identities=12%  Similarity=0.270  Sum_probs=19.8

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..++
T Consensus        70 v~~~g~il~KP~~~~eA~~~L~~ls   94 (180)
T cd00555          70 VVLDGRILGKPKDREEAREMLKRLS   94 (180)
T ss_pred             EEECCEEEcCCCCHHHHHHHHHHHc
Confidence            4458899999999999988665553


No 84 
>PRK04056 Maf-like protein; Reviewed
Probab=24.50  E-value=1.2e+02  Score=18.79  Aligned_cols=25  Identities=20%  Similarity=0.341  Sum_probs=19.7

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..|+
T Consensus        71 V~~~g~ilgKP~~~~eA~~~L~~ls   95 (180)
T PRK04056         71 VSCGNKILRKAKDKEEAREMLKLQS   95 (180)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHHC
Confidence            4458899999999999988665553


No 85 
>PRK14366 Maf-like protein; Provisional
Probab=24.19  E-value=1.3e+02  Score=18.96  Aligned_cols=25  Identities=36%  Similarity=0.476  Sum_probs=20.0

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..++
T Consensus        76 V~~~g~ilgKP~~~eeA~~mL~~ls  100 (195)
T PRK14366         76 VCCGRRILLKAETEEQAEEYLELLS  100 (195)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHhC
Confidence            4457899999999999988766554


No 86 
>PRK14368 Maf-like protein; Provisional
Probab=24.15  E-value=1.3e+02  Score=18.92  Aligned_cols=25  Identities=8%  Similarity=0.186  Sum_probs=20.1

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..|+
T Consensus        75 V~~~g~ilgKP~~~~eA~~~L~~ls   99 (193)
T PRK14368         75 VVCDGEIMGKPKDEADAVRMLKKLS   99 (193)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHhC
Confidence            4468899999999999988665553


No 87 
>PRK10698 phage shock protein PspA; Provisional
Probab=24.12  E-value=51  Score=21.10  Aligned_cols=23  Identities=17%  Similarity=0.177  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHHHhhccccccc
Q psy17851         36 ACYERMFRWLVNRINRSLDTIMC   58 (60)
Q Consensus        36 ~lY~rLF~wiV~~IN~~l~~~~~   58 (60)
                      .|++|+++.|-..||..++.-.|
T Consensus         2 ~if~Rl~~ii~a~in~~ldkaED   24 (222)
T PRK10698          2 GIFSRFADIVNANINALLEKAED   24 (222)
T ss_pred             CHHHHHHHHHHhHHHHHHHhhcC
Confidence            58899999999999998876443


No 88 
>PLN02298 hydrolase, alpha/beta fold family protein
Probab=23.95  E-value=1.3e+02  Score=19.37  Aligned_cols=29  Identities=10%  Similarity=0.165  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhcccccccc
Q psy17851         31 EAISKACYERMFRWLVNRINRSLDTIMCA   59 (60)
Q Consensus        31 dalaK~lY~rLF~wiV~~IN~~l~~~~~~   59 (60)
                      |...+.++..+++||-..+=..-.+..|+
T Consensus       300 d~~~~~~~~~i~~fl~~~~~~~~~~~~~~  328 (330)
T PLN02298        300 DENIEIVRRDILSWLNERCTGKATPSEDS  328 (330)
T ss_pred             HHHHHHHHHHHHHHHHHhccCCCCCcccc
Confidence            45567788888999888765444444443


No 89 
>PRK00032 Maf-like protein; Reviewed
Probab=23.35  E-value=1.3e+02  Score=18.81  Aligned_cols=25  Identities=12%  Similarity=0.256  Sum_probs=19.7

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..++
T Consensus        73 V~~~g~IlgKP~~~eeA~~~L~~ls   97 (190)
T PRK00032         73 VVLDGEVLEKPRDAADAAAMLRALS   97 (190)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHhC
Confidence            4468899999999999987655543


No 90 
>PRK02478 Maf-like protein; Reviewed
Probab=23.25  E-value=1.4e+02  Score=18.76  Aligned_cols=25  Identities=16%  Similarity=0.360  Sum_probs=19.9

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..|+
T Consensus        79 V~~~g~ilgKP~~~~eA~~~L~~ls  103 (199)
T PRK02478         79 MSLGDEVFHKPKDMEEARRHLQKLS  103 (199)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHhc
Confidence            4468899999999999987665553


No 91 
>PRK00884 Maf-like protein; Reviewed
Probab=23.24  E-value=1.4e+02  Score=18.83  Aligned_cols=24  Identities=13%  Similarity=0.137  Sum_probs=19.4

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAI   33 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdal   33 (60)
                      +..+|+.+.+|.+.++|...-..|
T Consensus        72 V~~~g~ilgKP~~~eeA~~~L~~l   95 (194)
T PRK00884         72 CVLDGEITGKPLTEENARAQLRKA   95 (194)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHH
Confidence            446889999999999998875554


No 92 
>PF02545 Maf:  Maf-like protein;  InterPro: IPR003697 Maf is a putative inhibitor of septum formation in eukaryotes, bacteria, and archaea. The Maf protein shares substantial amino acid sequence identity with the Escherichia coli OrfE protein [].; GO: 0005737 cytoplasm; PDB: 2P5X_A 1EXC_B 1EX2_A.
Probab=23.09  E-value=1.3e+02  Score=18.79  Aligned_cols=24  Identities=8%  Similarity=0.270  Sum_probs=17.3

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAI   33 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdal   33 (60)
                      +..+|+.+.+|.+.++|......+
T Consensus        74 v~~~g~Il~KP~~~eeA~~~L~~l   97 (195)
T PF02545_consen   74 VVCDGEILGKPKDEEEAREMLKSL   97 (195)
T ss_dssp             EECTTEEE-S-SSHHHHHHHHHHH
T ss_pred             eeeeeEEEeCCCCHHHHHHHHHhh
Confidence            445789999999999998765554


No 93 
>COG0424 Maf Nucleotide-binding protein implicated in inhibition of septum formation [Cell division and chromosome partitioning]
Probab=22.82  E-value=1.4e+02  Score=18.99  Aligned_cols=25  Identities=8%  Similarity=0.186  Sum_probs=19.9

Q ss_pred             eEEeCceEEEeeCCHHHHHHHHHHH
Q psy17851          9 RIKVGRDFVTKSQTKEQVEFAVEAI   33 (60)
Q Consensus         9 ~i~~~~e~~~~~~~~~~a~~~rdal   33 (60)
                      .+..+|+.+.+|.+.++|...-..|
T Consensus        73 vv~ldgrilgKP~~~~eA~~~L~~l   97 (193)
T COG0424          73 VVVLDGRILGKPKDEEEAREMLRKL   97 (193)
T ss_pred             EEEECCEEecCCCCHHHHHHHHHHh
Confidence            3556899999999999998765544


No 94 
>PF00392 GntR:  Bacterial regulatory proteins, gntR family;  InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities. The HTH GntR family has many members distributed among diverse bacterial groups that regulate various biological processes. It was named GntR after the Bacillus subtilis repressor of the gluconate operon []. Family members include GntR, HutC, KorA, NtaR, FadR, ExuR, FarR, DgoR and PhnF. The crystal structure of the FadR protein has been determined []. In general, these proteins contain a DNA-binding HTH domain at the N terminus, and an effector-binding or oligomerisation domain at the C terminus (IPR011711 from INTERPRO). The DNA-binding domain is well conserved in structure for the whole of the GntR family, consisting of a 3-helical bundle core with a small beta-sheet (wing); the GntR winged helix structure is similar to that found in several other transcriptional regulator families. The regions outside the DNA-binding domain are more variable and are consequently used to define GntR subfamilies []. This entry represents the N-terminal DNA-binding domain of the GntR family.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1HW1_B 1H9T_A 1HW2_A 1H9G_A 1E2X_A 3IHU_A 3C7J_A 2RA5_A 3BY6_C 3IC7_A ....
Probab=22.37  E-value=1.2e+02  Score=15.03  Aligned_cols=16  Identities=25%  Similarity=0.403  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHHHHhhc
Q psy17851         37 CYERMFRWLVNRINRS   52 (60)
Q Consensus        37 lY~rLF~wiV~~IN~~   52 (60)
                      +|..++++|...|-..
T Consensus         1 l~~~i~~~l~~~I~~g   16 (64)
T PF00392_consen    1 LYEQIYDQLRQAILSG   16 (64)
T ss_dssp             HHHHHHHHHHHHHHTT
T ss_pred             CHHHHHHHHHHHHHcC
Confidence            4666777777776543


No 95 
>PRK00234 Maf-like protein; Reviewed
Probab=22.10  E-value=1.2e+02  Score=18.96  Aligned_cols=25  Identities=24%  Similarity=0.213  Sum_probs=19.8

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..++
T Consensus        72 V~~~g~Il~KP~~~~eA~~mL~~ls   96 (192)
T PRK00234         72 AVLGGQILGKPHTFERAREQLLAAS   96 (192)
T ss_pred             EEeCCEECCCCCCHHHHHHHHHHHC
Confidence            4458899999999999988665553


No 96 
>PRK14898 DNA-directed RNA polymerase subunit A''; Provisional
Probab=22.08  E-value=1.3e+02  Score=23.17  Aligned_cols=36  Identities=14%  Similarity=0.131  Sum_probs=28.3

Q ss_pred             eeCCHHHHHHHHHHHHHH--HHHHHHHHHHHHHhhccc
Q psy17851         19 KSQTKEQVEFAVEAISKA--CYERMFRWLVNRINRSLD   54 (60)
Q Consensus        19 ~~~~~~~a~~~rdalaK~--lY~rLF~wiV~~IN~~l~   54 (60)
                      .++++......++.+++.  |+...|+||+..|-....
T Consensus        13 ~~~p~~~~~~i~~~~~~~~~lt~~~~d~Il~~I~~~y~   50 (858)
T PRK14898         13 LDLPRSLKDELFEKLSKRDGVTEEMVEEIIDEVVSAYL   50 (858)
T ss_pred             CCCCHHHHHHHHHHHHhhcCCCHHHHHHHHHHHHHHHh
Confidence            456777777888888865  999999999998775543


No 97 
>PF11295 DUF3096:  Protein of unknown function (DUF3096);  InterPro: IPR021446 This entry is represented by the archaeal Thermoproteus tenax spherical virus 1, Orf18. The characteristics of the protein distribution suggest prophage matches and lateral genetic transfer in addition to the phage matches.
Probab=21.79  E-value=1e+02  Score=14.88  Aligned_cols=13  Identities=15%  Similarity=0.378  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHH
Q psy17851         35 KACYERMFRWLVN   47 (60)
Q Consensus        35 K~lY~rLF~wiV~   47 (60)
                      --++.|+.+|+|.
T Consensus        11 iLi~PrllnyiVa   23 (39)
T PF11295_consen   11 ILIMPRLLNYIVA   23 (39)
T ss_pred             HHHHHHHHHHHHH
Confidence            3567899999885


No 98 
>PRK04425 Maf-like protein; Reviewed
Probab=21.74  E-value=1.5e+02  Score=18.65  Aligned_cols=24  Identities=4%  Similarity=-0.143  Sum_probs=19.2

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAI   33 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdal   33 (60)
                      +..+|+.+.+|.+.++|...-..+
T Consensus        75 V~~~g~ilgKP~~~eeA~~~L~~l   98 (196)
T PRK04425         75 AWCDGRQWGKPMNLANAQKMLMHL   98 (196)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHh
Confidence            446889999999999998765544


No 99 
>PF10624 TraS:  Plasmid conjugative transfer entry exclusion protein TraS;  InterPro: IPR018898  Entry exclusion (Eex) is a process which prevents redundant transfer of DNA between donor cells. TraS is a protein involved in Eex. It blocks redundant conjugative DNA synthesis and transport between donor cells, and it is suggested that TraS interferes with a signalling pathway that is required to trigger DNA transfer []. TraS on the recipient cell is known to form an interaction with TraG on the donor cell []. 
Probab=21.72  E-value=1.7e+02  Score=18.09  Aligned_cols=19  Identities=21%  Similarity=0.506  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHHHHh
Q psy17851         32 AISKACYERMFRWLVNRIN   50 (60)
Q Consensus        32 alaK~lY~rLF~wiV~~IN   50 (60)
                      -++-.|...||-|+-.+|-
T Consensus        32 l~f~~lWqglFiwlF~qIr   50 (164)
T PF10624_consen   32 LLFIVLWQGLFIWLFIQIR   50 (164)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4667899999999999993


No 100
>PF01712 dNK:  Deoxynucleoside kinase;  InterPro: IPR002624 This family consists of various deoxynucleoside kinases including cytidine (2.7.1.74 from EC), guanosine (2.7.1.113 from EC), adenosine (2.7.1.76 from EC) and thymidine kinase (2.7.1.21 from EC, which also phosphorylates deoxyuridine and deoxycytosine. These enzymes catalyse the production of deoxynucleotide 5'-monophosphate from a deoxynucleoside, using ATP and yielding ADP in the process.; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0006139 nucleobase-containing compound metabolic process; PDB: 2JAS_B 2JAT_B 2JAQ_A 2VP4_D 1ZMX_F 1ZM7_C 1OE0_B 2VP9_C 2VPP_B 2VP6_G ....
Probab=21.72  E-value=80  Score=18.45  Aligned_cols=21  Identities=19%  Similarity=0.414  Sum_probs=16.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHhh
Q psy17851         31 EAISKACYERMFRWLVNRINR   51 (60)
Q Consensus        31 dalaK~lY~rLF~wiV~~IN~   51 (60)
                      +...-.+|..+|+|++..+..
T Consensus        46 ~~~e~~~Y~~~~~~l~~~~~~   66 (146)
T PF01712_consen   46 SKEEYDLYDKLFDELIEEIPK   66 (146)
T ss_dssp             -HHHHHHHHHHHHHHHHHCCH
T ss_pred             CHHHHHHHHHHHHHHHHHhhc
Confidence            445568999999999998765


No 101
>PRK02141 Maf-like protein; Reviewed
Probab=21.68  E-value=1.6e+02  Score=18.79  Aligned_cols=25  Identities=16%  Similarity=0.105  Sum_probs=19.9

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..|+
T Consensus        82 V~~~g~ilgKP~~~~eA~~mL~~ls  106 (207)
T PRK02141         82 ATFDGLQIGKPGTHERALAQLQAMR  106 (207)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHhC
Confidence            4468899999999999988665554


No 102
>PRK14362 Maf-like protein; Provisional
Probab=21.35  E-value=1.3e+02  Score=19.19  Aligned_cols=25  Identities=4%  Similarity=0.117  Sum_probs=19.9

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..|+
T Consensus        83 V~~~g~ilgKP~~~eeA~~~L~~ls  107 (207)
T PRK14362         83 VALDGMILGKPADRADALSMLRRLA  107 (207)
T ss_pred             EEeCCEEcCCCCCHHHHHHHHHHhC
Confidence            4468899999999999988665553


No 103
>cd01040 globin Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.
Probab=21.27  E-value=1e+02  Score=16.89  Aligned_cols=15  Identities=40%  Similarity=0.698  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHHH
Q psy17851         29 AVEAISKACYERMFR   43 (60)
Q Consensus        29 ~rdalaK~lY~rLF~   43 (60)
                      ....++..+|.+||.
T Consensus        18 ~~~~~g~~~f~~lf~   32 (140)
T cd01040          18 DREEIGLEFYERLFK   32 (140)
T ss_pred             cHHhHHHHHHHHHHH
Confidence            356788889998887


No 104
>smart00348 IRF interferon regulatory factor. interferon regulatory factor, also known as trytophan pentad repeat
Probab=21.25  E-value=68  Score=18.41  Aligned_cols=16  Identities=25%  Similarity=0.569  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHhhcccc
Q psy17851         40 RMFRWLVNRINRSLDT   55 (60)
Q Consensus        40 rLF~wiV~~IN~~l~~   55 (60)
                      ||=.||+..||+-.-+
T Consensus         1 rlr~WL~~~i~sg~yp   16 (107)
T smart00348        1 RLRPWLVEQVESGQYP   16 (107)
T ss_pred             ChHHHHHHHhccCCCC
Confidence            4668999999976543


No 105
>cd00018 AP2 DNA-binding domain found in transcription regulators in plants such as APETALA2 and EREBP (ethylene responsive element binding protein). In EREBPs the domain specifically binds to the 11bp GCC box of the ethylene response element (ERE), a promotor element essential for ethylene responsiveness. EREBPs and the C-repeat binding factor CBF1, which is involved in stress response, contain a single copy of the AP2 domain. APETALA2-like proteins, which play a role in plant  development contain two copies.
Probab=21.24  E-value=1.2e+02  Score=14.93  Aligned_cols=23  Identities=13%  Similarity=0.007  Sum_probs=18.0

Q ss_pred             EEeeCCHHHHHHHHHHHHHHHHH
Q psy17851         17 VTKSQTKEQVEFAVEAISKACYE   39 (60)
Q Consensus        17 ~~~~~~~~~a~~~rdalaK~lY~   39 (60)
                      +...-+.++|..++|..+..+++
T Consensus        29 lG~f~t~eeAa~Ayd~a~~~~~g   51 (61)
T cd00018          29 LGTFDTAEEAARAYDRAALKLRG   51 (61)
T ss_pred             cCCCCCHHHHHHHHHHHHHHhcC
Confidence            34556899999999988877765


No 106
>PRK01441 Maf-like protein; Reviewed
Probab=21.07  E-value=1.5e+02  Score=18.82  Aligned_cols=25  Identities=20%  Similarity=0.423  Sum_probs=19.7

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..++
T Consensus        82 V~~~g~il~KP~~~~eA~~~L~~ls  106 (207)
T PRK01441         82 VAVGRRILPKAELVDEASQCLRLLS  106 (207)
T ss_pred             EEECCEEcCCCCCHHHHHHHHHHHC
Confidence            4457899999999999988665553


No 107
>PF08708 PriCT_1:  Primase C terminal 1 (PriCT-1);  InterPro: IPR014820 This alpha helical domain is found at the C-terminal of primases. 
Probab=21.03  E-value=1.1e+02  Score=15.52  Aligned_cols=24  Identities=13%  Similarity=0.177  Sum_probs=18.0

Q ss_pred             eEEEeeCCHHHHHHHHHHHHHHHH
Q psy17851         15 DFVTKSQTKEQVEFAVEAISKACY   38 (60)
Q Consensus        15 e~~~~~~~~~~a~~~rdalaK~lY   38 (60)
                      +....||+..|....-.|++|..|
T Consensus        47 ~~~~~PL~~~Ev~~i~kSi~k~~~   70 (71)
T PF08708_consen   47 SNFSPPLPESEVKAIAKSIAKWTW   70 (71)
T ss_pred             HHcCCCCCHHHHHHHHHHHHHhcc
Confidence            335789999999888777777543


No 108
>PRK01526 Maf-like protein; Reviewed
Probab=20.99  E-value=1.6e+02  Score=18.69  Aligned_cols=25  Identities=32%  Similarity=0.490  Sum_probs=19.9

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..|+
T Consensus        80 V~~~g~IlgKP~~~~eA~~mL~~ls  104 (205)
T PRK01526         80 AAVGRRILPKATTYEEVKNCIKMLS  104 (205)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHhC
Confidence            4468899999999999988665553


No 109
>PF15128 T_cell_tran_alt:  T-cell leukemia translocation-altered
Probab=20.96  E-value=1.5e+02  Score=16.74  Aligned_cols=21  Identities=24%  Similarity=0.276  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q psy17851         25 QVEFAVEAISKACYERMFRWLVNRI   49 (60)
Q Consensus        25 ~a~~~rdalaK~lY~rLF~wiV~~I   49 (60)
                      +|.+.|-++.|-+    +.|||-.+
T Consensus        19 ~a~Dmrv~ifkll----L~WlvlsL   39 (92)
T PF15128_consen   19 EANDMRVQIFKLL----LGWLVLSL   39 (92)
T ss_pred             HhccHHHHHHHHH----HHHHHHHH
Confidence            3556666666655    45887643


No 110
>PF10960 DUF2762:  Protein of unknown function (DUF2762);  InterPro: IPR024405 BhlA is a SP-beta prophage-derived protein found in Bacillus subtilis [, ] and other Bacilli. A related protein, UviB, has also been described in Clostridia, where it is believed to be involved in bacteriocin secretion or immunity [, ].
Probab=20.80  E-value=71  Score=17.15  Aligned_cols=19  Identities=26%  Similarity=0.607  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q psy17851         31 EAISKACYERMFRWLVNRI   49 (60)
Q Consensus        31 dalaK~lY~rLF~wiV~~I   49 (60)
                      -+++..+++-||-||.--+
T Consensus         8 ~~~sQG~fA~LFv~Ll~yv   26 (71)
T PF10960_consen    8 LALSQGIFAVLFVWLLFYV   26 (71)
T ss_pred             HHHHcCcHHHHHHHHHHHH
Confidence            4567788899999987644


No 111
>PHA03073 late transcription factor VLTF-2; Provisional
Probab=20.77  E-value=87  Score=19.33  Aligned_cols=15  Identities=0%  Similarity=0.142  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHH
Q psy17851         27 EFAVEAISKACYERM   41 (60)
Q Consensus        27 ~~~rdalaK~lY~rL   41 (60)
                      .-.||++|+.+|..+
T Consensus        80 ~ICRDSfa~~Vk~~v   94 (150)
T PHA03073         80 KICRDSFASMVKSHV   94 (150)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            357999999999866


No 112
>TIGR02481 hemeryth_dom hemerythrin-like metal-binding domain. This model describes both members of the hemerythrin (TIGR00058) family of marine invertebrates and a broader collection of bacterial and archaeal homologs. Many of the latter group are multidomain proteins with signal-transducing domains such as the GGDEF diguanylate cyclase domain (TIGR00254, pfam00990) and methyl-accepting chemotaxis protein signaling domain (pfam00015). Most hemerythrins are oxygen-carriers with a bound non-heme iron, but at least one example is a cadmium-binding protein, apparently with a role in sequestering toxic metals rather than in binding oxygen. Patterns of conserved residues suggest that all prokaryotic instances of this domain bind iron or another heavy metal, but the exact function is unknown. Not surprisingly, the prokaryote with the most instances of this domain is Magnetococcus sp. MC-1, a magnetotactic bacterium.
Probab=20.72  E-value=1.5e+02  Score=16.49  Aligned_cols=21  Identities=29%  Similarity=0.583  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHhh
Q psy17851         31 EAISKACYERMFRWLVNRINR   51 (60)
Q Consensus        31 dalaK~lY~rLF~wiV~~IN~   51 (60)
                      +.++..+...|-+|++..|..
T Consensus        97 ~~~~~~~~~~l~~Wl~~HI~~  117 (126)
T TIGR02481        97 ESLAEELLDFLKDWLVNHILK  117 (126)
T ss_pred             hhHHHHHHHHHHHHHHHHhHH
Confidence            456667888899999998863


No 113
>PF04796 RepA_C:  Plasmid encoded RepA protein;  InterPro: IPR006881 This is a family of plasmid encoded proteins involved in plasmid replication. The role of RepA in the replication process is not clearly understood [].
Probab=20.71  E-value=1.7e+02  Score=18.05  Aligned_cols=29  Identities=17%  Similarity=0.359  Sum_probs=20.4

Q ss_pred             eeCCHHHHHHHH-HHHHHHHHHHHHHHHHHHHhh
Q psy17851         19 KSQTKEQVEFAV-EAISKACYERMFRWLVNRINR   51 (60)
Q Consensus        19 ~~~~~~~a~~~r-dalaK~lY~rLF~wiV~~IN~   51 (60)
                      .|++..-....+ -++|..||.    ||..|+..
T Consensus       121 VPld~ralraL~~Sp~AlDiY~----WL~yR~~~  150 (161)
T PF04796_consen  121 VPLDLRALRALKGSPLALDIYA----WLTYRLHR  150 (161)
T ss_pred             CCCCHHHHHHHccChHHHHHHH----HHHHHHHh
Confidence            355554444555 489999999    99998864


No 114
>PF03501 S10_plectin:  Plectin/S10 domain;  InterPro: IPR005326 This presumed domain is found at the N terminus of some isoforms of the cytoskeletal muscle protein plectin as well as the ribosomal S10 protein. This domain may be involved in RNA binding.; PDB: 2XZM_7 2XZN_7 3U5C_K 3U5G_K.
Probab=20.67  E-value=78  Score=18.08  Aligned_cols=9  Identities=44%  Similarity=0.789  Sum_probs=7.3

Q ss_pred             HHHHHHHHH
Q psy17851         35 KACYERMFR   43 (60)
Q Consensus        35 K~lY~rLF~   43 (60)
                      ++||+.||.
T Consensus         7 ~~Iye~LFk   15 (95)
T PF03501_consen    7 IAIYEYLFK   15 (95)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHhh
Confidence            578998886


No 115
>PHA02518 ParA-like protein; Provisional
Probab=20.64  E-value=1.2e+02  Score=18.05  Aligned_cols=17  Identities=12%  Similarity=0.108  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHHHHHh
Q psy17851         34 SKACYERMFRWLVNRIN   50 (60)
Q Consensus        34 aK~lY~rLF~wiV~~IN   50 (60)
                      +..-|.+|++||..++.
T Consensus       194 a~~~~~~l~~ei~~~~~  210 (211)
T PHA02518        194 AAEEIIQLVKELFRGIS  210 (211)
T ss_pred             HHHHHHHHHHHHHHHhc
Confidence            44558888889888763


No 116
>PRK14367 Maf-like protein; Provisional
Probab=20.30  E-value=1.7e+02  Score=18.48  Aligned_cols=25  Identities=8%  Similarity=0.076  Sum_probs=19.7

Q ss_pred             EEeCceEEEeeCCHHHHHHHHHHHH
Q psy17851         10 IKVGRDFVTKSQTKEQVEFAVEAIS   34 (60)
Q Consensus        10 i~~~~e~~~~~~~~~~a~~~rdala   34 (60)
                      +..+|+.+.+|.+.++|...-..++
T Consensus        79 V~~dg~IlgKP~~~eeA~~~L~~ls  103 (202)
T PRK14367         79 VVSDGIILGKPRSQAEAIEFLNRLS  103 (202)
T ss_pred             EEECCEEecCCCCHHHHHHHHHHhC
Confidence            4467899999999999988655553


No 117
>COG5132 BUD31 Cell cycle control protein, G10 family [Transcription / Cell division and chromosome partitioning]
Probab=20.27  E-value=98  Score=18.73  Aligned_cols=15  Identities=40%  Similarity=0.636  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q psy17851         29 AVEAISKACYERMFRWLVN   47 (60)
Q Consensus        29 ~rdalaK~lY~rLF~wiV~   47 (60)
                      .|.++++.||+    ||..
T Consensus        66 KR~aISt~LY~----wL~k   80 (146)
T COG5132          66 KRGAISTKLYG----WLSK   80 (146)
T ss_pred             hhhhHHHHHHH----HHHH
Confidence            47777777777    7765


No 118
>cd04176 Rap2 Rap2 subgroup.  The Rap2 subgroup is part of the Rap subfamily of the Ras family.  It consists of Rap2a, Rap2b, and Rap2c.  Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton.  In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments.  In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway.  The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis.  Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation.  A number of additional effector proteins for Rap2 have been identified, incl
Probab=20.13  E-value=71  Score=18.05  Aligned_cols=12  Identities=25%  Similarity=0.570  Sum_probs=8.5

Q ss_pred             HHHHHHHHHHHh
Q psy17851         39 ERMFRWLVNRIN   50 (60)
Q Consensus        39 ~rLF~wiV~~IN   50 (60)
                      ..+|.||+.++|
T Consensus       152 ~~l~~~l~~~l~  163 (163)
T cd04176         152 NELFAEIVRQMN  163 (163)
T ss_pred             HHHHHHHHHhcC
Confidence            467888887664


No 119
>PLN02349 glycerol-3-phosphate acyltransferase
Probab=20.07  E-value=2.4e+02  Score=20.32  Aligned_cols=32  Identities=16%  Similarity=0.105  Sum_probs=23.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy17851         26 VEFAVEAISKACYERMFRWLVNRINRSLDTIMC   58 (60)
Q Consensus        26 a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~   58 (60)
                      -...|+++++++|+.+=+ .-+.+|+++..+++
T Consensus       393 ~~e~r~~~t~~~~~~V~~-~Y~~L~~ai~g~~~  424 (426)
T PLN02349        393 GAEAREAFTQAAYASVVE-QYAVLKSAIHGGQG  424 (426)
T ss_pred             hHHHHHHHHHHHHHHHHH-HHHHHHHhccCCCC
Confidence            346789999999986655 56678888776553


Done!