Diaphorina citri psyllid: psy17871

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MGQSESQFTEEELQDYEDLTYFTKKEILAHQKFKSLAPEKVGHNKNAKLPMTKILLYPQLRVNPFGDRICHIFSSSHDGDCTFEDFLDMMSVFSESAPKPVKAEHAFRIFDFDGDDMLGMTDLKQIIDRLTGTHHLSDNDIQHLIQNILDEADLDDDGALSFAEFELFIEKSQDFAKWTSIQREYIQEL
cccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccHHHHHcccccccccHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcHHHHHHccccccccccc
***********ELQDYEDLTYFTKKEILAHQKFKSLAPEKVGHNKNAKLPMTKILLYPQLRVNPFGDRICHIFSSSHDGDCTFEDFLDMMSVFSESAPKPVKAEHAFRIFDFDGDDMLGMTDLKQIIDRLTGTHHLSDNDIQHLIQNILDEADLDDDGALSFAEFELFIEKSQDFAKWTSIQREYIQE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQSESQFTEEELQDYEDLTYFTKKEILAHQKFKSLAPEKVGHNKNAKLPMTKILLYPQLRVNPFGDRICHIFSSSHDGDCTFEDFLDMMSVFSESAPKPVKAEHAFRIFDFDGDDMLGMTDLKQIIDRLTGTHHLSDNDIQHLIQNILDEADLDDDGALSFAEFELFIEKSQDFAKWTSIQREYIQEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcium and integrin-binding protein 1 May convert the inactive conformation of integrin alpha-IIb/beta3 to an active form through binding to the integrin cytoplasmic domain. Induces cell migration and spreading mediated through integrin (possibly via focal adhesion complexes). Functions as a negative regulator of stress activated MAP kinase (MAPK) signaling pathways. May play a role in regulation of apoptosis. Interacts with and up-regulates PTK2/FAK1 activity. Down regulates inositol 1,4,5-trisphosphate receptor-dependent calcium signaling. Participates in endomitotic cell cycle, a form of mitosis in which both karyokinesis and cytokinesis are interrupted and is a hallmark of megakaryocyte differentiation.confidentQ99828
Calcium and integrin-binding protein 1 May convert the inactive conformation of integrin alpha-IIb/beta3 to an active form through binding to the integrin cytoplasmic domain (By similarity). Induces cell migration and spreading mediated through integrin (possibly via focal adhesion complexes) (By similarity). Functions as a negative regulator of stress activated MAP kinase (MAPK) signaling pathways (By similarity). May play a role in regulation of apoptosis (By similarity). Interacts with and up-regulates PTK2/FAK1 activity. Down regulates inositol 1,4,5-trisphosphate receptor-dependent calcium signaling. Participates in endomitotic cell cycle, a form of mitosis in which both karyokinesis and cytokinesis are interrupted and is a hallmark of megakaryocyte differentiation.confidentQ9Z0F4
Calcium and integrin-binding protein 1 May convert the inactive conformation of integrin alpha-IIb/beta3 to an active form through binding to the integrin cytoplasmic domain (By similarity). Induces cell migration and spreading mediated through integrin (possibly via focal adhesion complexes) (By similarity). Functions as a negative regulator of stress activated MAP kinase (MAPK) signaling pathways (By similarity). May play a role in regulation of apoptosis (By similarity). Interacts with and up-regulates PTK2/FAK1 activity (By similarity). Down regulates inositol 1,4,5-trisphosphate receptor-dependent calcium signaling. Participates in endomitotic cell cycle, a form of mitosis in which both karyokinesis and cytokinesis are interrupted and is a hallmark of megakaryocyte differentiation.confidentQ9R010

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043495 [MF]protein anchorprobableGO:0003674, GO:0005488, GO:0005515
GO:0090004 [BP]positive regulation of establishment of protein localization to plasma membraneprobableGO:0051130, GO:0070201, GO:0032879, GO:0060341, GO:0051128, GO:0032880, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0090003, GO:0050789, GO:0048522
GO:0070886 [BP]positive regulation of calcineurin-NFAT signaling cascadeprobableGO:0050850, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050848, GO:0023056, GO:0065007, GO:0070884, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0050794, GO:0048522
GO:0042383 [CC]sarcolemmaprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886
GO:0007113 [BP]endomitotic cell cycleprobableGO:0000278, GO:0009987, GO:0008150, GO:0007049, GO:0044763, GO:0044699
GO:0006302 [BP]double-strand break repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0031953 [BP]negative regulation of protein autophosphorylationprobableGO:0019220, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031952, GO:0009892, GO:0050789, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0065007, GO:0031399, GO:0048519, GO:0045936, GO:0060255, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0042325, GO:0032269, GO:0042326, GO:0031400, GO:0001933, GO:0001932, GO:0048523
GO:0030175 [CC]filopodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0071468 [BP]cellular response to acidityprobableGO:0009628, GO:0051716, GO:0010447, GO:0050896, GO:0009987, GO:0008150, GO:0071467, GO:0044763, GO:0009268, GO:0071214, GO:0044699
GO:0051453 [BP]regulation of intracellular pHprobableGO:0019725, GO:0044699, GO:0006885, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0030004, GO:0065007, GO:0044763, GO:0055067, GO:0030003, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0030641
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0022406 [BP]membrane dockingprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0033192 [MF]calmodulin-dependent protein phosphatase activityprobableGO:0016787, GO:0016791, GO:0004723, GO:0004722, GO:0004721, GO:0042578, GO:0003824, GO:0003674, GO:0016788
GO:0032088 [BP]negative regulation of NF-kappaB transcription factor activityprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044092, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0043433, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0006469 [BP]negative regulation of protein kinase activityprobableGO:0033673, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0009892, GO:0043086, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0050789, GO:0065007, GO:0044092, GO:0048519, GO:0065009, GO:0045859, GO:0045936, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0051348, GO:0042325, GO:0032269, GO:0042326, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0090314 [BP]positive regulation of protein targeting to membraneprobableGO:0033157, GO:0070201, GO:0032879, GO:0032388, GO:0060341, GO:0051050, GO:0090313, GO:0051049, GO:0032386, GO:0090316, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0051222, GO:0051223, GO:0050789, GO:0032880
GO:0040015 [BP]negative regulation of multicellular organism growthprobableGO:0045926, GO:0040014, GO:0040008, GO:0051241, GO:0008150, GO:0065007, GO:0051239, GO:0048519, GO:0050789
GO:0019900 [MF]kinase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0043010 [BP]camera-type eye developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050821 [BP]protein stabilizationprobableGO:0019222, GO:0060255, GO:0010608, GO:0031647, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0007229 [BP]integrin-mediated signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0070885 [BP]negative regulation of calcineurin-NFAT signaling cascadeprobableGO:0009968, GO:0050794, GO:0009966, GO:0048585, GO:0048583, GO:0050849, GO:0050848, GO:0008150, GO:0023057, GO:0065007, GO:0070884, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523, GO:0010648
GO:0070887 [BP]cellular response to chemical stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0031397 [BP]negative regulation of protein ubiquitinationprobableGO:0032269, GO:0032268, GO:0010605, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031400, GO:0031324, GO:0031323, GO:0051248, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0031399, GO:0031396, GO:0009892, GO:0050789, GO:0048523
GO:0005215 [MF]transporter activityprobableGO:0003674
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0031122 [BP]cytoplasmic microtubule organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0071822, GO:0043933, GO:0009987, GO:0016043, GO:0008150, GO:0000226, GO:0071840, GO:0044763, GO:0044699
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006470 [BP]protein dephosphorylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0048884 [BP]neuromast developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048882, GO:0048880, GO:0048856, GO:0044767, GO:0048513, GO:0048925, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0001578 [BP]microtubule bundle formationprobableGO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0008150, GO:0044763, GO:0071840, GO:0000226, GO:0044699
GO:0042308 [BP]negative regulation of protein import into nucleusprobableGO:1900180, GO:0070201, GO:0032879, GO:0060341, GO:0051051, GO:0033157, GO:0051049, GO:0032386, GO:0032387, GO:0090317, GO:0050794, GO:0008150, GO:0065007, GO:0046822, GO:0046823, GO:0048519, GO:0042306, GO:0051223, GO:0051224, GO:0050789, GO:0032880
GO:0017156 [BP]calcium ion-dependent exocytosisprobableGO:0046903, GO:0006810, GO:0016192, GO:0006887, GO:0044765, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0061025 [BP]membrane fusionprobableGO:0061024, GO:0008150, GO:0071840, GO:0016043
GO:0007638 [BP]mechanosensory behaviorprobableGO:0009628, GO:0009605, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0009612
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0008017 [MF]microtubule bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0097458 [CC]neuron partprobableGO:0005575, GO:0044464, GO:0005623
GO:0006611 [BP]protein export from nucleusprobableGO:0051169, GO:0051168, GO:0016482, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0033036, GO:0034613, GO:0006810, GO:0006913, GO:0045184, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0046907, GO:0015031, GO:0008150, GO:0009987
GO:0060050 [BP]positive regulation of protein glycosylationprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0060049, GO:0080090, GO:0010604, GO:0010560, GO:0009891, GO:0051246, GO:0051247, GO:0050789, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:2000112, GO:0060255, GO:0009889, GO:0050794, GO:0045913, GO:0008150, GO:0010675, GO:0032268, GO:0010559, GO:0031401, GO:0010557, GO:0010556, GO:0006109, GO:0048522
GO:0048306 [MF]calcium-dependent protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0010923 [BP]negative regulation of phosphatase activityprobableGO:0051336, GO:0019220, GO:0051346, GO:0019222, GO:0065009, GO:0010921, GO:0050790, GO:0031323, GO:0050789, GO:0051174, GO:0065007, GO:0044092, GO:0008150, GO:0035303, GO:0050794, GO:0043086
GO:0008285 [BP]negative regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0030133 [CC]transport vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0007155 [BP]cell adhesionprobableGO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L4H, chain A
Confidence level:very confident
Coverage over the Query: 8-182
View the alignment between query and template
View the model in PyMOL