Query         psy17879
Match_columns 154
No_of_seqs    129 out of 321
Neff          3.5 
Searched_HMMs 46136
Date          Sat Aug 17 01:20:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17879.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17879hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02209 VHP:  Villin headpiece  99.8 2.8E-21 6.2E-26  121.6   4.0   36  119-154     1-36  (36)
  2 smart00153 VHP Villin headpiec  99.8 8.2E-21 1.8E-25  119.3   4.0   36  119-154     1-36  (36)
  3 KOG1044|consensus               99.8 1.1E-20 2.4E-25  174.9   5.3   91   59-154   566-670 (670)
  4 KOG0443|consensus               99.8 1.9E-19 4.1E-24  170.5   5.8   63   91-154   764-827 (827)
  5 KOG0445|consensus               99.8 1.2E-19 2.7E-24  170.7   2.0  106   46-154   814-919 (919)
  6 TIGR01764 excise DNA binding d  53.0      14  0.0003   21.8   2.2   21  119-139     1-21  (49)
  7 PF12728 HTH_17:  Helix-turn-he  52.9      13 0.00028   23.1   2.1   21  119-139     1-21  (51)
  8 COG2996 Predicted RNA-bindinin  49.5      12 0.00027   33.2   2.2   46   84-138   220-265 (287)
  9 PF07467 BLIP:  Beta-lactamase   42.9      14  0.0003   31.0   1.4   21  117-137    28-49  (183)
 10 PF09286 Pro-kuma_activ:  Pro-k  40.8      22 0.00047   26.7   2.0   29  117-145    45-73  (143)
 11 PF05391 Lsm_interact:  Lsm int  34.4      27 0.00059   20.0   1.3   12  118-129     8-19  (21)
 12 PF05930 Phage_AlpA:  Prophage   30.7      29 0.00063   22.1   1.1   23  118-140     2-24  (51)
 13 PF10256 Erf4:  Golgin subfamil  29.1      35 0.00075   25.0   1.5   14  116-129    26-39  (118)
 14 PF08447 PAS_3:  PAS fold;  Int  25.7      49  0.0011   21.4   1.6   15  122-136     5-19  (91)
 15 PF00165 HTH_AraC:  Bacterial r  25.2      53  0.0011   19.7   1.6   20  118-137    18-41  (42)
 16 COG3735 Uncharacterized protei  25.0      62  0.0013   29.0   2.5   32  112-143   100-137 (299)
 17 PRK09391 fixK transcriptional   24.6      67  0.0015   25.6   2.5   33  115-147   175-208 (230)
 18 PRK11753 DNA-binding transcrip  24.0      74  0.0016   24.2   2.5   31  117-147   166-197 (211)
 19 PF12833 HTH_18:  Helix-turn-he  23.2      71  0.0015   21.1   2.0   16  123-138    65-80  (81)
 20 PRK11161 fumarate/nitrate redu  22.5      84  0.0018   24.6   2.6   33  115-147   180-213 (235)
 21 PF02201 SWIB:  SWIB/MDM2 domai  21.5     9.6 0.00021   26.5  -2.6   33  111-143    39-71  (76)
 22 PF07022 Phage_CI_repr:  Bacter  21.2      39 0.00085   22.6   0.4   23  121-145    14-36  (66)
 23 PF02809 UIM:  Ubiquitin intera  20.8      30 0.00065   18.7  -0.2   14  122-135     4-17  (18)
 24 PRK13918 CRP/FNR family transc  20.6      92   0.002   23.6   2.4   33  115-147   145-178 (202)
 25 PRK15070 propanediol utilizati  20.4      49  0.0011   28.3   1.0   22  109-130    25-46  (211)
 26 KOG3591|consensus               20.1      38 0.00082   27.5   0.2   19  105-123   121-139 (173)

No 1  
>PF02209 VHP:  Villin headpiece domain;  InterPro: IPR003128 Villin is an F-actin bundling protein involved in the maintenance of the microvilli of the absorptive epithelia. The villin-type "headpiece" domain is a modular motif found at the extreme C terminus of larger "core" domains in over 25 cytoskeletal proteins in plants and animals, often in assocation with the Gelsolin repeat. Although the headpiece is classified as an F-actin-binding domain, it has been shown that not all headpiece domains are intrinsically F-actin-binding motifs, surface charge distribution may be an important element for F-actin recognition []. An autonomously folding, 35 residue, thermostable subdomain (HP36) of the full-length 76 amino acid residue villin headpiece, is the smallest known example of a cooperatively folded domain of a naturally occurring protein. The structure of HP36, as determined by NMR spectroscopy, consists of three short helices surrounding a tightly packed hydrophobic core []. ; GO: 0003779 actin binding, 0007010 cytoskeleton organization; PDB: 1ZV6_A 1QZP_A 1UND_A 2PPZ_A 3TJW_B 1YU8_X 2JM0_A 1WY4_A 3MYC_A 1YU5_X ....
Probab=99.83  E-value=2.8e-21  Score=121.62  Aligned_cols=36  Identities=56%  Similarity=1.041  Sum_probs=31.8

Q ss_pred             CCChHHHHHHhCCCHHHHhhChhHHHHHHhHhcCCC
Q psy17879        119 HLSDVEFETLFLCTRAEFYRLPTWRRNDLKKRARLF  154 (154)
Q Consensus       119 YLSDeDF~~VFGMsr~EF~~LP~WKQ~~LKK~~gLF  154 (154)
                      ||||+||++||||+|+||++||+|||+++||++|||
T Consensus         1 YLsd~dF~~vFgm~~~eF~~lP~WKq~~lKK~~~LF   36 (36)
T PF02209_consen    1 YLSDEDFEKVFGMSREEFYKLPKWKQNNLKKKAGLF   36 (36)
T ss_dssp             GS-HHHHHHHHSS-HHHHHHS-HHHHHHHHHHTTT-
T ss_pred             CcCHHHHHHHHCCCHHHHHHChHHHHHHHHHHhCCC
Confidence            899999999999999999999999999999999998


No 2  
>smart00153 VHP Villin headpiece domain.
Probab=99.82  E-value=8.2e-21  Score=119.31  Aligned_cols=36  Identities=56%  Similarity=0.991  Sum_probs=35.7

Q ss_pred             CCChHHHHHHhCCCHHHHhhChhHHHHHHhHhcCCC
Q psy17879        119 HLSDVEFETLFLCTRAEFYRLPTWRRNDLKKRARLF  154 (154)
Q Consensus       119 YLSDeDF~~VFGMsr~EF~~LP~WKQ~~LKK~~gLF  154 (154)
                      ||||+||++||||+|+||++||+|||+++||++|||
T Consensus         1 yLsdeeF~~vfgmsr~eF~~LP~WKq~~lKk~~~LF   36 (36)
T smart00153        1 YLSDEDFEEVFGMTREEFYKLPLWKQNQLKKKLGLF   36 (36)
T ss_pred             CCCHHHHHHHHCCCHHHHHhCcHhhHHHHHhhcCCC
Confidence            899999999999999999999999999999999998


No 3  
>KOG1044|consensus
Probab=99.81  E-value=1.1e-20  Score=174.86  Aligned_cols=91  Identities=52%  Similarity=0.872  Sum_probs=78.2

Q ss_pred             ccccCCCcc----------cccccCc-cccccCCCCCCCCCCCCCCcCCHHHHHhhc---CCCCCCCCccccccCCChHH
Q psy17879         59 SSTYAGSLG----------YAASYSN-HIQRSLPNMSQPMSLEPPKIYPYHLLIITN---YRLPPDVDRKNLERHLSDVE  124 (154)
Q Consensus        59 s~t~~g~l~----------~~~~~~~-~~Rrslp~~s~~l~~~~~k~Ypye~L~~~~---~~LP~gVDptklE~YLSDeD  124 (154)
                      |++|+|++|          +...+|- -.+.+||+|..     ..++|||+.|+.++   .+||++||+++||+||+.||
T Consensus       566 stS~sgs~G~~r~~~~~~~g~~p~g~~~~~~SlP~~~~-----e~KiypYe~L~vTnrgr~klp~dVDRtrLERHL~~e~  640 (670)
T KOG1044|consen  566 STSYSGSSGGYRDYQTLRDGPMPAGRMDRGVSLPNMML-----EPKIYPYEMLMVTNRGRNKLPRDVDRTRLERHLSPED  640 (670)
T ss_pred             cccccCCCccccccccccCCCccccccccccccccccc-----cccccChHHheecccccccCcccchhhHHhhccCHHH
Confidence            577888887          2211122 36778999643     68999999999877   78999999999999999999


Q ss_pred             HHHHhCCCHHHHhhChhHHHHHHhHhcCCC
Q psy17879        125 FETLFLCTRAEFYRLPTWRRNDLKKRARLF  154 (154)
Q Consensus       125 F~~VFGMsr~EF~~LP~WKQ~~LKK~~gLF  154 (154)
                      |.+||||+.+||++||.|||+||||++.||
T Consensus       641 F~eiF~MSi~EF~rL~LWkRnnlKkkAkLF  670 (670)
T KOG1044|consen  641 FSEIFGMSISEFDRLPLWKRNNLKKKAKLF  670 (670)
T ss_pred             HHHHhccCHhhhchhhhhhhhhhhhhhccC
Confidence            999999999999999999999999999999


No 4  
>KOG0443|consensus
Probab=99.77  E-value=1.9e-19  Score=170.48  Aligned_cols=63  Identities=40%  Similarity=0.742  Sum_probs=57.8

Q ss_pred             CCCcCCHHHHHhhc-CCCCCCCCccccccCCChHHHHHHhCCCHHHHhhChhHHHHHHhHhcCCC
Q psy17879         91 PPKIYPYHLLIITN-YRLPPDVDRKNLERHLSDVEFETLFLCTRAEFYRLPTWRRNDLKKRARLF  154 (154)
Q Consensus        91 ~~k~Ypye~L~~~~-~~LP~gVDptklE~YLSDeDF~~VFGMsr~EF~~LP~WKQ~~LKK~~gLF  154 (154)
                      +...|||++|+.+. .++|+ |||+|+|.|||++||+.+|||+|+||++||+|||++|||+.+||
T Consensus       764 p~~~~~~e~l~~~~~~~~~~-id~~rrE~yLs~~dF~~~Fgmtk~eF~~LPkWKq~~lKk~~~LF  827 (827)
T KOG0443|consen  764 PRPAFPYEQLLTQSEDPVPD-IDPTRREAYLSEEEFVSVFGMTKEEFYALPKWKQNKLKKQFGLF  827 (827)
T ss_pred             cccCCCHHHHhccccCcCCC-CChhHhhhhccHHHHHHHhCcCHHHHhhcchhHHHHHhhhhccC
Confidence            33599999999544 56777 99999999999999999999999999999999999999999999


No 5  
>KOG0445|consensus
Probab=99.76  E-value=1.2e-19  Score=170.73  Aligned_cols=106  Identities=27%  Similarity=0.400  Sum_probs=81.0

Q ss_pred             CcCCCCCCCCcccccccCCCcccccccCccccccCCCCCCCCCCCCCCcCCHHHHHhhcCCCCCCCCccccccCCChHHH
Q psy17879         46 HHVPNGGAPELPVSSTYAGSLGYAASYSNHIQRSLPNMSQPMSLEPPKIYPYHLLIITNYRLPPDVDRKNLERHLSDVEF  125 (154)
Q Consensus        46 ~~~~~~~~~~~~~s~t~~g~l~~~~~~~~~~Rrslp~~s~~l~~~~~k~Ypye~L~~~~~~LP~gVDptklE~YLSDeDF  125 (154)
                      ++++--|++++.|.+-|..-- -+...-+.+-.+...+.++|...-.++||+++|..  ++||+||||.+||.||+||||
T Consensus       814 ~~vV~aGlEPl~Fk~lFp~We-~red~D~~~s~~i~~v~d~La~~c~T~yple~l~a--rpLPeGvdp~rLE~YLtdeDF  890 (919)
T KOG0445|consen  814 SYVVHAGLEPLTFKNLFPSWE-HREDIDTEVSNQITLVEDVLAKLCKTIYPLEDLLA--RPLPEGVDPLRLEIYLTDEDF  890 (919)
T ss_pred             ceEEEcCcChhhhhhhCCCce-eccccCCCcCCchhHHHHHHHHHhhhcChHHHHhc--CCCCCCCCchhheeeechHHH
Confidence            455555777777776664331 11111122333333344467777778999999974  599999999999999999999


Q ss_pred             HHHhCCCHHHHhhChhHHHHHHhHhcCCC
Q psy17879        126 ETLFLCTRAEFYRLPTWRRNDLKKRARLF  154 (154)
Q Consensus       126 ~~VFGMsr~EF~~LP~WKQ~~LKK~~gLF  154 (154)
                      +.+|||+|+||++||.|||+++||+.|||
T Consensus       891 ~~al~~~R~Ef~alp~WKQ~~lkK~~GLF  919 (919)
T KOG0445|consen  891 EFALDMTRDEFNALPAWKQVNLKKAKGLF  919 (919)
T ss_pred             HHHhccCHHHhhcchhhhhhhhhhhccCC
Confidence            99999999999999999999999999999


No 6  
>TIGR01764 excise DNA binding domain, excisionase family. An excisionase, or Xis protein, is a small protein that binds and promotes excisive recombination; it is not enzymatically active. This model represents a number of putative excisionases and related proteins from temperate phage, plasmids, and transposons, as well as DNA binding domains of other proteins, such as a DNA modification methylase. This model identifies mostly small proteins and N-terminal regions of large proteins, but some proteins appear to have two copies. This domain appears similar, in both sequence and predicted secondary structure (PSIPRED) to the MerR family of transcriptional regulators (pfam00376).
Probab=52.96  E-value=14  Score=21.80  Aligned_cols=21  Identities=24%  Similarity=0.282  Sum_probs=18.8

Q ss_pred             CCChHHHHHHhCCCHHHHhhC
Q psy17879        119 HLSDVEFETLFLCTRAEFYRL  139 (154)
Q Consensus       119 YLSDeDF~~VFGMsr~EF~~L  139 (154)
                      ||+-+|..+.+|+++..++.+
T Consensus         1 ~lt~~e~a~~lgis~~ti~~~   21 (49)
T TIGR01764         1 YLTVEEAAEYLGVSKDTVYRL   21 (49)
T ss_pred             CCCHHHHHHHHCCCHHHHHHH
Confidence            789999999999999988764


No 7  
>PF12728 HTH_17:  Helix-turn-helix domain
Probab=52.93  E-value=13  Score=23.10  Aligned_cols=21  Identities=29%  Similarity=0.311  Sum_probs=18.9

Q ss_pred             CCChHHHHHHhCCCHHHHhhC
Q psy17879        119 HLSDVEFETLFLCTRAEFYRL  139 (154)
Q Consensus       119 YLSDeDF~~VFGMsr~EF~~L  139 (154)
                      |||-+|..+.+|+++..++.+
T Consensus         1 ~lt~~e~a~~l~is~~tv~~~   21 (51)
T PF12728_consen    1 YLTVKEAAELLGISRSTVYRW   21 (51)
T ss_pred             CCCHHHHHHHHCcCHHHHHHH
Confidence            789999999999999998854


No 8  
>COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only]
Probab=49.47  E-value=12  Score=33.18  Aligned_cols=46  Identities=15%  Similarity=0.214  Sum_probs=30.2

Q ss_pred             CCCCCCCCCCcCCHHHHHhhcCCCCCCCCccccccCCChHHHHHHhCCCHHHHhh
Q psy17879         84 SQPMSLEPPKIYPYHLLIITNYRLPPDVDRKNLERHLSDVEFETLFLCTRAEFYR  138 (154)
Q Consensus        84 s~~l~~~~~k~Ypye~L~~~~~~LP~gVDptklE~YLSDeDF~~VFGMsr~EF~~  138 (154)
                      .+++......++.|-+..  ..-+|       +-.--|+||..+.|||||..|.+
T Consensus       220 ~E~l~~daq~Il~yL~~~--gG~mp-------f~DKSsPEdIk~~FgiSKg~FKr  265 (287)
T COG2996         220 HEMLDEDAQMILTYLESN--GGFMP-------FNDKSSPEDIKATFGISKGQFKR  265 (287)
T ss_pred             HHhhhhhHHHHHHHHHHc--CCccc-------cCCCCCHHHHHHHhCcCHHHHHH
Confidence            335555555566554333  33455       23456899999999999999953


No 9  
>PF07467 BLIP:  Beta-lactamase inhibitor (BLIP);  InterPro: IPR009099 The beta-lactamase-inhibitor protein (BLIP) is produced by Streptomyces species. BLIP acts as a potent inhibitor of beta-lactamases such as TEM-1, which is the most widespread resistance enzyme to penicillin antibiotics. BLIP binds competitively to TEM-1 and makes direct contacts with TEM-1 active site residues. BLIP is able to inhibit a variety of class A beta-lactamases, possibly through flexibility of its two domains. The two tandemly repeated domains of BLIP have an alpha(2)-beta(4) structure, the beta-hairpin loop from domain 1 inserting into the active site of beta-lactamase []. BLIP shows no sequence similarity with BLIP-II, even though both bind to and inhibit TEM-1 [].; PDB: 3GMY_B 3GMX_B 3C4O_B 1XXM_C 1S0W_D 3N4I_B 3C7U_B 2G2W_B 3C7V_D 3E2K_C ....
Probab=42.87  E-value=14  Score=31.01  Aligned_cols=21  Identities=24%  Similarity=0.373  Sum_probs=14.8

Q ss_pred             ccCCChHHHHHH-hCCCHHHHh
Q psy17879        117 ERHLSDVEFETL-FLCTRAEFY  137 (154)
Q Consensus       117 E~YLSDeDF~~V-FGMsr~EF~  137 (154)
                      +.+|++|-|++| |||+++|=.
T Consensus        28 ~s~lT~EkY~kIqfGMt~~EV~   49 (183)
T PF07467_consen   28 CSKLTAEKYEKIQFGMTYDEVW   49 (183)
T ss_dssp             --SS-HHHHHHS-TT-BHHHHH
T ss_pred             ccccCHHHhhhHhcCCCHHHHH
Confidence            578999999887 899999854


No 10 
>PF09286 Pro-kuma_activ:  Pro-kumamolisin, activation domain ;  InterPro: IPR015366 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This domain is found at the N terminus of peptidases belonging to MEROPS peptidase family S53 (sedolisin, clan SB). The domain adopts a ferredoxin-like fold, with an alpha+beta sandwich. Cleavage of the domain results in activation of the peptidase []. ; GO: 0008236 serine-type peptidase activity; PDB: 1T1E_A 3EDY_A 3EE6_A.
Probab=40.76  E-value=22  Score=26.69  Aligned_cols=29  Identities=21%  Similarity=0.454  Sum_probs=20.8

Q ss_pred             ccCCChHHHHHHhCCCHHHHhhChhHHHH
Q psy17879        117 ERHLSDVEFETLFLCTRAEFYRLPTWRRN  145 (154)
Q Consensus       117 E~YLSDeDF~~VFGMsr~EF~~LP~WKQ~  145 (154)
                      -+|||.+||.+.|+-+.+...+.-.|=+.
T Consensus        45 gk~Lt~~e~~~~~~p~~~~v~~V~~wL~~   73 (143)
T PF09286_consen   45 GKYLTPEEFAALFAPSPEDVAAVKSWLKS   73 (143)
T ss_dssp             T----HHHHHHHHS--HHHHHHHHHHHHH
T ss_pred             ccCCCHHHHHHHHCCCHHHHHHHHHHHHH
Confidence            58999999999999999999999999664


No 11 
>PF05391 Lsm_interact:  Lsm interaction motif;  InterPro: IPR008669 This short motif is found at the C terminus of Prp24 proteins and probably interacts with the Lsm proteins to promote U4/U6 formation [].
Probab=34.43  E-value=27  Score=19.99  Aligned_cols=12  Identities=25%  Similarity=0.584  Sum_probs=9.9

Q ss_pred             cCCChHHHHHHh
Q psy17879        118 RHLSDVEFETLF  129 (154)
Q Consensus       118 ~YLSDeDF~~VF  129 (154)
                      .-+|.+||.+.|
T Consensus         8 ~p~SNddFrkmf   19 (21)
T PF05391_consen    8 KPKSNDDFRKMF   19 (21)
T ss_pred             CccchHHHHHHH
Confidence            457999999887


No 12 
>PF05930 Phage_AlpA:  Prophage CP4-57 regulatory protein (AlpA);  InterPro: IPR010260 This entry is represents phage P4, Orf88. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  In Escherichia coli phage P4 Orf 88 is similar to AlpA of the CP4-57 cryptic prophage []. AlpA acts as a positive transcriptional regulator of slpA, a gene linked to alpA and necessary for suppression of lon mutants [, ]. The sequence of slpA suggests that it encodes an integrase gene closely related to phage P4 int and that both alpA and slpA are part of a cryptic P4-like prophage. Increase in alpA expression increases SlpA synthesis. Increased SlpA leads, in turn, to the excision and loss of the cryptic prophage. ; PDB: 1Z4H_A.
Probab=30.66  E-value=29  Score=22.13  Aligned_cols=23  Identities=35%  Similarity=0.413  Sum_probs=17.5

Q ss_pred             cCCChHHHHHHhCCCHHHHhhCh
Q psy17879        118 RHLSDVEFETLFLCTRAEFYRLP  140 (154)
Q Consensus       118 ~YLSDeDF~~VFGMsr~EF~~LP  140 (154)
                      +.|+-.|..+.+|+++..++.|=
T Consensus         2 rll~~~ev~~~~g~s~~ti~~~~   24 (51)
T PF05930_consen    2 RLLRIKEVAELLGVSRSTIYRLI   24 (51)
T ss_dssp             -EE-HHHHHHHHSS-HHHHHHHH
T ss_pred             ccccHHHHHHHHCCCHHHHHHHH
Confidence            56788999999999999998763


No 13 
>PF10256 Erf4:  Golgin subfamily A member 7/ERF4 family;  InterPro: IPR019383 Proteins in this entry include Golgin subfamily A member 7 and the Ras modification protein ERF4. 
Probab=29.10  E-value=35  Score=25.01  Aligned_cols=14  Identities=36%  Similarity=0.508  Sum_probs=12.5

Q ss_pred             cccCCChHHHHHHh
Q psy17879        116 LERHLSDVEFETLF  129 (154)
Q Consensus       116 lE~YLSDeDF~~VF  129 (154)
                      |+.|||.+||+++-
T Consensus        26 L~~~is~~ef~~iI   39 (118)
T PF10256_consen   26 LSGYISPEEFEEII   39 (118)
T ss_pred             hcCCCCHHHHHHHH
Confidence            78999999998775


No 14 
>PF08447 PAS_3:  PAS fold;  InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs []. The PAS fold appears in archaea, eubacteria and eukarya. The PAS domain contains a sensory box, or S-box domain that occupies the central portion of the PAS domain but is more widely distributed. It is often tandemly repeated. Known prosthetic groups bound in the S-box domain include haem in the oxygen sensor FixL [], FAD in the redox potential sensor NifL [], and a 4-hydroxycinnamyl chromophore in photoactive yellow protein []. Proteins containing the domain often contain other regulatory domains such as response regulator or sensor histidine kinase domains. Other S-box proteins include phytochromes and the aryl hydrocarbon receptor nuclear translocator.  This domain has been found in the gene product of the madA gene of the filamentous zygomycete fungus Phycomyces blakesleeanus. It has been shown that MadA encodes a blue-light photoreceptor for phototropism and other light responses. The gene is involved in the phototropic responses associated with sporangiophore growth; they exhibit phototropism by bending toward near-UV and blue wavelengths and away from far-UV wavelengths in a manner that is physiologically similar to plant phototropic responses [].; GO: 0005515 protein binding; PDB: 3NJA_D 3H9W_A 3GDI_B 3ICY_A 3EEH_A 3MR0_B.
Probab=25.74  E-value=49  Score=21.36  Aligned_cols=15  Identities=20%  Similarity=0.286  Sum_probs=12.2

Q ss_pred             hHHHHHHhCCCHHHH
Q psy17879        122 DVEFETLFLCTRAEF  136 (154)
Q Consensus       122 DeDF~~VFGMsr~EF  136 (154)
                      ++.|.++||++.+++
T Consensus         5 s~~~~~i~G~~~~~~   19 (91)
T PF08447_consen    5 SDNFYEIFGYSPEEI   19 (91)
T ss_dssp             -THHHHHHTS-HHHH
T ss_pred             eHHHHHHhCCCHHHh
Confidence            468999999999999


No 15 
>PF00165 HTH_AraC:  Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A.
Probab=25.17  E-value=53  Score=19.71  Aligned_cols=20  Identities=15%  Similarity=0.036  Sum_probs=11.4

Q ss_pred             cCCChHH----HHHHhCCCHHHHh
Q psy17879        118 RHLSDVE----FETLFLCTRAEFY  137 (154)
Q Consensus       118 ~YLSDeD----F~~VFGMsr~EF~  137 (154)
                      ..+|..-    |++.+||+..+|.
T Consensus        18 ~g~S~~~f~r~Fk~~~g~tp~~y~   41 (42)
T PF00165_consen   18 AGFSPSYFSRLFKKETGMTPKQYR   41 (42)
T ss_dssp             HTS-HHHHHHHHHHHTSS-HHHHH
T ss_pred             HCCCHHHHHHHHHHHHCcCHHHHh
Confidence            3445554    4566689988874


No 16 
>COG3735 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.03  E-value=62  Score=28.97  Aligned_cols=32  Identities=25%  Similarity=0.460  Sum_probs=27.8

Q ss_pred             CccccccCCChHHHHH------HhCCCHHHHhhChhHH
Q psy17879        112 DRKNLERHLSDVEFET------LFLCTRAEFYRLPTWR  143 (154)
Q Consensus       112 DptklE~YLSDeDF~~------VFGMsr~EF~~LP~WK  143 (154)
                      +-..+|..||+|+++.      -.||+-..+.++|.|-
T Consensus       100 ~~~~l~~~Ls~e~~~~le~~~~~lGi~~~~~~~~~pW~  137 (299)
T COG3735         100 DGENLEDRLSPEQLARLEMILQELGIPLQALSKMPPWQ  137 (299)
T ss_pred             CCcchhhhcCHHHHHHHHHHHHHcCCCHHHHhcCCcHH
Confidence            4567999999999974      4799999999999995


No 17 
>PRK09391 fixK transcriptional regulator FixK; Provisional
Probab=24.63  E-value=67  Score=25.63  Aligned_cols=33  Identities=15%  Similarity=0.123  Sum_probs=29.2

Q ss_pred             ccccCCChHHHHHHhCCCHHHHhh-ChhHHHHHH
Q psy17879        115 NLERHLSDVEFETLFLCTRAEFYR-LPTWRRNDL  147 (154)
Q Consensus       115 klE~YLSDeDF~~VFGMsr~EF~~-LP~WKQ~~L  147 (154)
                      ..+..++-+|....+||+|+...+ |-+|+++.+
T Consensus       175 ~i~i~lt~~~IA~~lGisretlsR~L~~L~~~Gl  208 (230)
T PRK09391        175 MMALPMSRRDIADYLGLTIETVSRALSQLQDRGL  208 (230)
T ss_pred             EEEecCCHHHHHHHHCCCHHHHHHHHHHHHHCCc
Confidence            457889999999999999999988 889998863


No 18 
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional
Probab=24.00  E-value=74  Score=24.22  Aligned_cols=31  Identities=19%  Similarity=0.303  Sum_probs=27.6

Q ss_pred             ccCCChHHHHHHhCCCHHHHhh-ChhHHHHHH
Q psy17879        117 ERHLSDVEFETLFLCTRAEFYR-LPTWRRNDL  147 (154)
Q Consensus       117 E~YLSDeDF~~VFGMsr~EF~~-LP~WKQ~~L  147 (154)
                      ...++-+|....+|++|+..++ |-+||+.++
T Consensus       166 ~~~~t~~~lA~~lG~tr~tvsR~l~~l~~~gi  197 (211)
T PRK11753        166 QIKITRQEIGRIVGCSREMVGRVLKMLEDQGL  197 (211)
T ss_pred             ecCCCHHHHHHHhCCCHHHHHHHHHHHHHCCC
Confidence            4579999999999999999998 889998874


No 19 
>PF12833 HTH_18:  Helix-turn-helix domain; PDB: 2K9S_A 3LSG_C 3OIO_A 1D5Y_B 3GBG_A 3OOU_A 1BL0_A 1XS9_A 3MN2_B 3MKL_B ....
Probab=23.23  E-value=71  Score=21.08  Aligned_cols=16  Identities=25%  Similarity=0.418  Sum_probs=11.7

Q ss_pred             HHHHHHhCCCHHHHhh
Q psy17879        123 VEFETLFLCTRAEFYR  138 (154)
Q Consensus       123 eDF~~VFGMsr~EF~~  138 (154)
                      ..|++.|||+..+|.+
T Consensus        65 ~~fk~~~g~tP~~~r~   80 (81)
T PF12833_consen   65 RAFKRYFGMTPSEYRK   80 (81)
T ss_dssp             HHHHHHHSS-HHHHHH
T ss_pred             HHHHHHHCcCHHHHHc
Confidence            4678888999999853


No 20 
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional
Probab=22.53  E-value=84  Score=24.58  Aligned_cols=33  Identities=9%  Similarity=0.194  Sum_probs=28.0

Q ss_pred             ccccCCChHHHHHHhCCCHHHHhh-ChhHHHHHH
Q psy17879        115 NLERHLSDVEFETLFLCTRAEFYR-LPTWRRNDL  147 (154)
Q Consensus       115 klE~YLSDeDF~~VFGMsr~EF~~-LP~WKQ~~L  147 (154)
                      ....-++.+|....+||+|+...+ |-+|+++.+
T Consensus       180 ~~~~~lt~~~iA~~lG~sr~tvsR~l~~l~~~g~  213 (235)
T PRK11161        180 EFRLTMTRGDIGNYLGLTVETISRLLGRFQKSGM  213 (235)
T ss_pred             eeEccccHHHHHHHhCCcHHHHHHHHHHHHHCCC
Confidence            345678999999999999999998 778888765


No 21 
>PF02201 SWIB:  SWIB/MDM2 domain;  InterPro: IPR003121 The SWI/SNF family of complexes, which are conserved from yeast to humans, are ATP-dependent chromatin-remodelling proteins that facilitate transcription activation []. The mammalian complexes are made up of 9-12 proteins called BAFs (BRG1-associated factors). The BAF60 family have at least three members: BAF60a, which is ubiquitous, BAF60b and BAF60c, which are expressed in muscle and pancreatic tissues, respectively. BAF60b is present in alternative forms of the SWI/SNF complex, including complex B (SWIB), which lacks BAF60a. The SWIB domain is a conserved region found within the BAF60b proteins [], and can be found fused to the C terminus of DNA topoisomerase in Chlamydia. MDM2 is an oncoprotein that acts as a cellular inhibitor of the p53 tumour suppressor by binding to the transactivation domain of p53 and suppressing its ability to activate transcription []. p53 acts in response to DNA damage, inducing cell cycle arrest and apoptosis. Inactivation of p53 is a common occurrence in neoplastic transformations. The core of MDM2 folds into an open bundle of four helices, which is capped by two small 3-stranded beta-sheets. It consists of a duplication of two structural repeats. MDM2 has a deep hydrophobic cleft on which the p53 alpha-helix binds; p53 residues involved in transactivation are buried deep within the cleft of MDM2, thereby concealing the p53 transactivation domain.  The SWIB and MDM2 domains are homologous and share a common fold.; GO: 0005515 protein binding; PDB: 1V31_A 3FE7_A 3JZQ_B 3EQY_B 2VYR_A 3JZO_A 3DAB_E 3LBJ_E 3FEA_A 3FDO_A ....
Probab=21.48  E-value=9.6  Score=26.48  Aligned_cols=33  Identities=21%  Similarity=0.368  Sum_probs=26.6

Q ss_pred             CCccccccCCChHHHHHHhCCCHHHHhhChhHH
Q psy17879        111 VDRKNLERHLSDVEFETLFLCTRAEFYRLPTWR  143 (154)
Q Consensus       111 VDptklE~YLSDeDF~~VFGMsr~EF~~LP~WK  143 (154)
                      .||.++..-+.|+.++++||..+-.|..|+..=
T Consensus        39 ~dp~~k~~I~cD~~L~~lf~~~~v~~~~i~~~l   71 (76)
T PF02201_consen   39 QDPKDKRIIICDEKLKKLFGKDSVNFFEIPKLL   71 (76)
T ss_dssp             BESSSTTEEE-TTSHHHHHHTSECSEEETTHHH
T ss_pred             CCcccCceEecCHHHHHHhCCCeecHhhHHHHH
Confidence            577777788899999999999888888887754


No 22 
>PF07022 Phage_CI_repr:  Bacteriophage CI repressor helix-turn-helix domain;  InterPro: IPR010744 This family consists of several phage CI repressor proteins and related bacterial sequences. The CI repressor is known to function as a transcriptional switch, determining whether transcription is lytic or lysogenic [].; GO: 0003677 DNA binding, 0045892 negative regulation of transcription, DNA-dependent; PDB: 2FJR_B.
Probab=21.16  E-value=39  Score=22.59  Aligned_cols=23  Identities=17%  Similarity=0.450  Sum_probs=16.3

Q ss_pred             ChHHHHHHhCCCHHHHhhChhHHHH
Q psy17879        121 SDVEFETLFLCTRAEFYRLPTWRRN  145 (154)
Q Consensus       121 SDeDF~~VFGMsr~EF~~LP~WKQ~  145 (154)
                      ++.||.+.+||++.-+..  .|++.
T Consensus        14 ~~~~lA~~lgis~st~s~--~~~~r   36 (66)
T PF07022_consen   14 SDKELAERLGISKSTLSN--NWKKR   36 (66)
T ss_dssp             SCHHHHCCTT--HHHHH---HHHHS
T ss_pred             CHHHHHHHhCcCHHHhhH--HHHhC
Confidence            567999999999999885  56654


No 23 
>PF02809 UIM:  Ubiquitin interaction motif;  InterPro: IPR003903 The Ubiquitin Interacting Motif (UIM), or 'LALAL-motif', is a stretch of about 20 amino acid residues, which was first described in the 26S proteasome subunit PSD4/RPN-10 that is known to recognise ubiquitin [,]. In addition, the UIM is found, often in tandem or triplet arrays, in a variety of proteins either involved in ubiquitination and ubiquitin metabolism, or known to interact with ubiquitin-like modifiers. Among the UIM proteins are two different subgroups of the UBP (ubiquitin carboxy-terminal hydrolase) family of deubiquitinating enzymes, one F-box protein, one family of HECT-containing ubiquitin-ligases (E3s) from plants, and several proteins containing ubiquitin-associated UBA and/or UBX domains []. In most of these proteins, the UIM occurs in multiple copies and in association with other domains such as UBA (IPR015940 from INTERPRO), UBX (IPR001012 from INTERPRO), ENTH, EH (IPR000261 from INTERPRO), VHS (IPR002014 from INTERPRO), SH3 (IPR001452 from INTERPRO), HECT (IPR000569 from INTERPRO), VWFA (IPR002035 from INTERPRO), EF-hand calcium-binding, WD-40 (IPR001680 from INTERPRO), F-box (IPR001810 from INTERPRO), LIM (IPR001781 from INTERPRO), protein kinase (IPR000719 from INTERPRO), ankyrin (IPR002110 from INTERPRO), PX (IPR001683 from INTERPRO), phosphatidylinositol 3- and 4-kinase (IPR000403 from INTERPRO), C2 (IPR000008 from INTERPRO), OTU (IPR003323 from INTERPRO), dnaJ (IPR001623 from INTERPRO), RING-finger (IPR001841 from INTERPRO) or FYVE-finger (IPR017455 from INTERPRO). UIMs have been shown to bind ubiquitin and to serve as a specific targeting signal important for monoubiquitination. Thus, UIMs may have several functions in ubiquitin metabolism each of which may require different numbers of UIMs [, , ].  The UIM is unlikely to form an independent folding domain. Instead, based on the spacing of the conserved residues, the motif probably forms a short alpha-helix that can be embedded into different protein folds []. Some proteins known to contain an UIM are listed below:    Eukaryotic PSD4/RPN-10/S5, a multi-ubiquitin binding subunit of the 26S proteasome.  Vertebrate Machado-Joseph disease protein 1 (Ataxin-3), which acts as a histone-binding protein that regulates transcription; defects in Ataxin-3 cause the neurodegenerative disorder Machado-Joseph disease (MJD). Vertebrate epsin and epsin2.  Vertebrate hepatocyte growth factor-regulated tyrosine kinase substrate (HRS).  Mammalian epidermal growth factor receptor substrate 15 (EPS15), which is involved in cell growth regulation.  Mammalian epidermal growth factor receptor substrate EPS15R.   Drosophila melanogaster (Fruit fly) liquid facets (lqf), an epsin.  Yeast VPS27 vacuolar sorting protein, which is required for membrane traffic to the vacuole.   ; PDB: 2KDE_A 2KDF_A 1YX6_A 1YX5_A 1YX4_A 1P9C_A 1UEL_B 1P9D_S 2KLZ_A.
Probab=20.79  E-value=30  Score=18.69  Aligned_cols=14  Identities=14%  Similarity=0.216  Sum_probs=11.8

Q ss_pred             hHHHHHHhCCCHHH
Q psy17879        122 DVEFETLFLCTRAE  135 (154)
Q Consensus       122 DeDF~~VFGMsr~E  135 (154)
                      |++++.++.||+++
T Consensus         4 d~~L~~Al~~S~~e   17 (18)
T PF02809_consen    4 DEDLQRALEMSLEE   17 (18)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhhhcc
Confidence            67889999998876


No 24 
>PRK13918 CRP/FNR family transcriptional regulator; Provisional
Probab=20.59  E-value=92  Score=23.62  Aligned_cols=33  Identities=9%  Similarity=0.033  Sum_probs=28.5

Q ss_pred             ccccCCChHHHHHHhCCCHHHHhh-ChhHHHHHH
Q psy17879        115 NLERHLSDVEFETLFLCTRAEFYR-LPTWRRNDL  147 (154)
Q Consensus       115 klE~YLSDeDF~~VFGMsr~EF~~-LP~WKQ~~L  147 (154)
                      ..+..++-+|.....|++|+...+ |-+|++..+
T Consensus       145 ~~~~~~t~~~iA~~lG~tretvsR~l~~l~~~g~  178 (202)
T PRK13918        145 ETMIYATHDELAAAVGSVRETVTKVIGELSREGY  178 (202)
T ss_pred             eEEecCCHHHHHHHhCccHHHHHHHHHHHHHCCC
Confidence            567889999999999999999998 788887654


No 25 
>PRK15070 propanediol utilization phosphotransacylase; Provisional
Probab=20.42  E-value=49  Score=28.33  Aligned_cols=22  Identities=36%  Similarity=0.362  Sum_probs=19.2

Q ss_pred             CCCCccccccCCChHHHHHHhC
Q psy17879        109 PDVDRKNLERHLSDVEFETLFL  130 (154)
Q Consensus       109 ~gVDptklE~YLSDeDF~~VFG  130 (154)
                      --|..+.+.-|||.+|++.+||
T Consensus        25 ipvgvS~RHvHLs~ed~e~LFG   46 (211)
T PRK15070         25 IPVGVSNRHVHLSQEDLEILFG   46 (211)
T ss_pred             eEEEEecceeeCCHHHHHHhcC
Confidence            3366788999999999999998


No 26 
>KOG3591|consensus
Probab=20.14  E-value=38  Score=27.46  Aligned_cols=19  Identities=42%  Similarity=0.607  Sum_probs=16.5

Q ss_pred             CCCCCCCCccccccCCChH
Q psy17879        105 YRLPPDVDRKNLERHLSDV  123 (154)
Q Consensus       105 ~~LP~gVDptklE~YLSDe  123 (154)
                      ..||+|||++..-..||.+
T Consensus       121 y~LP~~vdp~~V~S~LS~d  139 (173)
T KOG3591|consen  121 YLLPEDVDPTSVTSTLSSD  139 (173)
T ss_pred             ecCCCCCChhheEEeeCCC
Confidence            4799999999999988864


Done!