Query         psy17880
Match_columns 120
No_of_seqs    182 out of 1302
Neff          9.2 
Searched_HMMs 46136
Date          Fri Aug 16 16:31:14 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17880.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17880hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1701|consensus               99.9 2.9E-28 6.4E-33  175.7  -2.3  117    3-120   274-393 (468)
  2 KOG1701|consensus               99.9   2E-26 4.4E-31  166.3   2.2  116    4-119   335-462 (468)
  3 KOG2272|consensus               99.9 1.8E-26   4E-31  157.2  -2.3  118    1-118   193-311 (332)
  4 KOG4577|consensus               99.9 1.8E-25 3.8E-30  154.8  -4.3  115    3-118    33-152 (383)
  5 KOG2272|consensus               99.9 1.9E-24   4E-29  147.4  -3.5  114    4-118   138-251 (332)
  6 KOG1703|consensus               99.9 9.9E-23 2.1E-27  153.3   3.8  117    3-119   303-420 (479)
  7 KOG1703|consensus               99.9   6E-23 1.3E-27  154.5   2.3  115    2-116   362-478 (479)
  8 KOG1044|consensus               99.8   1E-21 2.2E-26  146.4   2.3  108    3-111   133-242 (670)
  9 KOG1044|consensus               99.7 5.7E-18 1.2E-22  126.5   3.1  113    7-120    69-191 (670)
 10 PF00412 LIM:  LIM domain;  Int  99.7 3.4E-17 7.5E-22   90.3   2.2   56   65-120     1-58  (58)
 11 PF00412 LIM:  LIM domain;  Int  99.6 3.4E-16 7.3E-21   86.3   4.6   56    6-61      1-58  (58)
 12 KOG1700|consensus               99.5 2.4E-15 5.2E-20  101.9  -0.1  117    3-119     7-166 (200)
 13 smart00132 LIM Zinc-binding do  99.0 2.7E-10 5.9E-15   57.3   2.9   36   64-99      1-38  (39)
 14 smart00132 LIM Zinc-binding do  98.9 1.3E-09 2.8E-14   54.8   2.4   36    5-40      1-38  (39)
 15 KOG4577|consensus               98.4 4.8E-09   1E-13   73.6  -5.9   58   62-120    33-91  (383)
 16 KOG0490|consensus               98.0 4.6E-07 9.9E-12   62.4  -2.5  108    9-117     2-117 (235)
 17 KOG1700|consensus               97.8 4.1E-06 8.8E-11   57.0  -0.5   55   63-117     8-64  (200)
 18 KOG1702|consensus               97.5 6.1E-06 1.3E-10   55.7  -2.3   55   64-118     6-61  (264)
 19 KOG1702|consensus               97.4   8E-06 1.7E-10   55.2  -2.8   60    2-61      3-63  (264)
 20 PF14446 Prok-RING_1:  Prokaryo  93.3   0.079 1.7E-06   28.4   2.0   37   62-98      5-51  (54)
 21 KOG0490|consensus               92.0    0.03 6.6E-07   38.4  -0.8   50   68-118     2-54  (235)
 22 PF08394 Arc_trans_TRASH:  Arch  91.8    0.13 2.8E-06   25.4   1.5   31   65-98      1-33  (37)
 23 PF14835 zf-RING_6:  zf-RING of  90.9    0.16 3.4E-06   28.3   1.4   45   30-74      8-52  (65)
 24 PF10083 DUF2321:  Uncharacteri  90.6    0.28   6E-06   32.1   2.6   50   49-100    27-80  (158)
 25 PF09943 DUF2175:  Uncharacteri  87.9    0.19 4.1E-06   30.5   0.3   28   64-91      4-33  (101)
 26 PF10367 Vps39_2:  Vacuolar sor  87.2    0.47   1E-05   28.5   1.9   27   63-89     79-107 (109)
 27 smart00504 Ubox Modified RING   87.1     1.5 3.1E-05   23.6   3.7   43   30-73      2-46  (63)
 28 PF02069 Metallothio_Pro:  Prok  86.5    0.43 9.4E-06   25.4   1.2   25   90-114     9-33  (52)
 29 PF11781 RRN7:  RNA polymerase   86.1    0.62 1.3E-05   22.8   1.6   25   90-118    10-34  (36)
 30 PF07191 zinc-ribbons_6:  zinc-  85.8    0.26 5.5E-06   27.9   0.1   48   49-102    16-64  (70)
 31 PF01258 zf-dskA_traR:  Prokary  85.4    0.18 3.9E-06   24.6  -0.6   28   32-59      6-33  (36)
 32 PF13920 zf-C3HC4_3:  Zinc fing  84.9     2.4 5.2E-05   21.9   3.6   42   31-73      4-48  (50)
 33 COG1645 Uncharacterized Zn-fin  84.8    0.77 1.7E-05   29.2   1.9   23   90-117    30-52  (131)
 34 PRK14890 putative Zn-ribbon RN  83.6    0.95 2.1E-05   24.7   1.7   50    2-69      6-55  (59)
 35 PF13248 zf-ribbon_3:  zinc-rib  81.5    0.97 2.1E-05   20.3   1.1   12    3-14      2-13  (26)
 36 COG2191 Formylmethanofuran deh  80.2    0.99 2.1E-05   30.9   1.2   31   89-119   173-203 (206)
 37 COG4847 Uncharacterized protei  80.0    0.77 1.7E-05   27.5   0.6   30   64-93      8-39  (103)
 38 PF14634 zf-RING_5:  zinc-RING   79.7     2.8   6E-05   21.1   2.6   39   32-70      2-44  (44)
 39 PF10367 Vps39_2:  Vacuolar sor  78.9     2.7 5.8E-05   25.1   2.8   29   90-118    80-109 (109)
 40 PF13717 zinc_ribbon_4:  zinc-r  78.6    0.54 1.2E-05   23.0  -0.3   32    2-38      1-34  (36)
 41 PF06677 Auto_anti-p27:  Sjogre  78.3     1.1 2.3E-05   22.7   0.7   22   31-56     19-40  (41)
 42 PF04570 DUF581:  Protein of un  78.3     1.4   3E-05   24.0   1.2   28   90-117    18-47  (58)
 43 cd00162 RING RING-finger (Real  77.3     3.4 7.3E-05   19.9   2.5   24   48-71     18-44  (45)
 44 COG2888 Predicted Zn-ribbon RN  77.3     2.6 5.6E-05   23.1   2.1   10    4-13     10-19  (61)
 45 PF10235 Cript:  Microtubule-as  75.4     1.9 4.2E-05   25.6   1.4   42   25-74     40-81  (90)
 46 PF13240 zinc_ribbon_2:  zinc-r  74.8       2 4.3E-05   18.7   1.0    6   67-72      4-9   (23)
 47 PF14471 DUF4428:  Domain of un  74.4     3.3 7.2E-05   21.8   2.0   29   31-60      1-30  (51)
 48 KOG0320|consensus               72.7     3.4 7.3E-05   27.8   2.1   48   27-74    129-179 (187)
 49 PF13923 zf-C3HC4_2:  Zinc fing  72.4     4.6 9.9E-05   19.6   2.2   30   32-61      1-30  (39)
 50 COG5152 Uncharacterized conser  72.2     1.4 3.1E-05   30.1   0.4   47   29-76    196-244 (259)
 51 PRK00420 hypothetical protein;  72.1     3.1 6.7E-05   25.8   1.8   11   62-72     23-33  (112)
 52 PLN03208 E3 ubiquitin-protein   71.7      11 0.00023   25.8   4.4   50   28-78     17-85  (193)
 53 COG2191 Formylmethanofuran deh  69.7     1.4 3.1E-05   30.1  -0.1   31   30-60    173-203 (206)
 54 PF10886 DUF2685:  Protein of u  69.3     3.4 7.3E-05   22.1   1.3   24   63-86      2-26  (54)
 55 PF00645 zf-PARP:  Poly(ADP-rib  69.3     2.1 4.5E-05   24.6   0.6   12    3-14      7-18  (82)
 56 KOG1813|consensus               68.0     2.9 6.2E-05   30.3   1.1   46   29-75    241-288 (313)
 57 PF12674 Zn_ribbon_2:  Putative  67.7     2.9 6.4E-05   24.3   1.0   28   32-59      3-35  (81)
 58 PF13719 zinc_ribbon_5:  zinc-r  66.3     1.9 4.1E-05   21.1  -0.0   32    2-38      1-34  (37)
 59 TIGR02098 MJ0042_CXXC MJ0042 f  64.9     1.9 4.1E-05   20.9  -0.2   12    2-13      1-12  (38)
 60 PF06827 zf-FPG_IleRS:  Zinc fi  64.2     1.3 2.9E-05   20.4  -0.8   12   63-74      2-13  (30)
 61 PF12773 DZR:  Double zinc ribb  63.7     6.9 0.00015   20.0   1.9    7   65-71     32-38  (50)
 62 PF06906 DUF1272:  Protein of u  63.7      17 0.00036   19.7   3.3   23   51-73     30-52  (57)
 63 KOG0978|consensus               62.6     3.4 7.3E-05   33.4   0.7   44   29-73    643-689 (698)
 64 KOG3002|consensus               61.5     8.6 0.00019   28.0   2.6   45   28-73     47-91  (299)
 65 cd02340 ZZ_NBR1_like Zinc fing  61.1     7.6 0.00017   19.6   1.7   13   64-76      2-14  (43)
 66 smart00659 RPOLCX RNA polymera  61.1       6 0.00013   20.2   1.3    9   90-98      4-12  (44)
 67 smart00291 ZnF_ZZ Zinc-binding  60.5     8.4 0.00018   19.4   1.8    9   51-59     28-36  (44)
 68 PLN03208 E3 ubiquitin-protein   60.3     7.7 0.00017   26.4   2.0   41   63-103    19-83  (193)
 69 PF11571 Med27:  Mediator compl  57.3     4.4 9.5E-05   23.9   0.4   17   56-72     48-64  (90)
 70 PF10080 DUF2318:  Predicted me  56.1      12 0.00027   22.7   2.3   26   90-119    37-62  (102)
 71 PRK14559 putative protein seri  55.6       8 0.00017   31.2   1.7   48    4-72      2-51  (645)
 72 cd02249 ZZ Zinc finger, ZZ typ  55.4      10 0.00023   19.2   1.6    8   52-59     25-32  (46)
 73 PF02591 DUF164:  Putative zinc  55.1     2.7 5.9E-05   22.4  -0.7   28   90-117    24-54  (56)
 74 PF09723 Zn-ribbon_8:  Zinc rib  50.7     5.8 0.00013   19.9   0.2    9   90-98      7-15  (42)
 75 COG4306 Uncharacterized protei  50.5      19 0.00041   22.9   2.5   48   51-100    29-80  (160)
 76 COG0266 Nei Formamidopyrimidin  50.3     8.9 0.00019   27.6   1.1   27   62-88    245-271 (273)
 77 KOG4443|consensus               50.2       8 0.00017   31.1   1.0   22   79-100   106-127 (694)
 78 COG2075 RPL24A Ribosomal prote  48.7      19 0.00042   20.1   2.1   21   90-110     5-28  (66)
 79 PF00569 ZZ:  Zinc finger, ZZ t  48.2      16 0.00034   18.6   1.6   10   50-59     28-37  (46)
 80 COG4357 Zinc finger domain con  47.6     1.3 2.8E-05   26.7  -2.9   32   82-113    56-87  (105)
 81 PF12677 DUF3797:  Domain of un  47.0      21 0.00045   18.7   1.9   26   63-88     14-42  (49)
 82 PF12855 Ecl1:  Life-span regul  46.2       7 0.00015   19.9   0.1   20   91-114     9-28  (43)
 83 cd02336 ZZ_RSC8 Zinc finger, Z  45.9      18  0.0004   18.5   1.6   30   31-60      2-33  (45)
 84 PRK00807 50S ribosomal protein  45.4      21 0.00045   18.8   1.8    9   64-72      3-11  (52)
 85 PF14569 zf-UDP:  Zinc-binding   45.3      24 0.00052   20.4   2.2   24   49-72     35-61  (80)
 86 PF00097 zf-C3HC4:  Zinc finger  45.0      28 0.00061   16.7   2.3   30   32-61      1-30  (41)
 87 PF07503 zf-HYPF:  HypF finger;  44.9     5.5 0.00012   19.3  -0.4   30    6-39      2-31  (35)
 88 PHA02929 N1R/p28-like protein;  44.8      12 0.00025   26.4   1.0   37   63-99    175-227 (238)
 89 PF00096 zf-C2H2:  Zinc finger,  44.7     7.6 0.00016   16.2   0.1   13   89-101     1-13  (23)
 90 PRK00398 rpoP DNA-directed RNA  44.1      11 0.00024   19.1   0.7   27   64-98      5-31  (46)
 91 smart00184 RING Ring finger. E  42.5      12 0.00026   17.0   0.6   24   66-89      2-25  (39)
 92 smart00834 CxxC_CXXC_SSSS Puta  42.3     9.8 0.00021   18.4   0.3    9   64-72      7-15  (41)
 93 PF12156 ATPase-cat_bd:  Putati  41.4      14 0.00031   21.7   0.9   30   64-96      2-34  (88)
 94 PF01286 XPA_N:  XPA protein N-  41.3      12 0.00026   18.0   0.5   10   32-41      6-15  (34)
 95 KOG0978|consensus               41.1     5.4 0.00012   32.3  -1.2   43   63-105   644-695 (698)
 96 PRK11595 DNA utilization prote  38.6      30 0.00065   23.9   2.3   21   52-72     22-44  (227)
 97 PF13894 zf-C2H2_4:  C2H2-type   37.5      14  0.0003   15.0   0.3   12   89-100     1-12  (24)
 98 KOG2114|consensus               37.1      18  0.0004   30.1   1.2   33   64-96    842-880 (933)
 99 COG4393 Predicted membrane pro  37.0      21 0.00045   26.6   1.3   26   91-120   337-362 (405)
100 PF08271 TF_Zn_Ribbon:  TFIIB z  36.9      29 0.00064   17.2   1.6   12   89-100    20-31  (43)
101 PF07649 C1_3:  C1-like domain;  36.8      20 0.00044   16.3   0.9   11   90-100     2-12  (30)
102 TIGR02605 CxxC_CxxC_SSSS putat  36.5      14 0.00031   19.0   0.4   10   64-73      7-16  (52)
103 PF04641 Rtf2:  Rtf2 RING-finge  36.1      76  0.0016   22.5   4.0   55   26-80    110-169 (260)
104 PHA02610 uvsY.-2 hypothetical   36.0      29 0.00063   18.4   1.4   13    4-16      2-14  (53)
105 PF08209 Sgf11:  Sgf11 (transcr  35.8     8.4 0.00018   18.4  -0.6   16   89-104     5-20  (33)
106 TIGR00570 cdk7 CDK-activating   35.3      59  0.0013   23.9   3.4   26   48-73     26-54  (309)
107 PF12171 zf-C2H2_jaz:  Zinc-fin  35.0      17 0.00038   15.9   0.5   14   89-102     2-15  (27)
108 cd02342 ZZ_UBA_plant Zinc fing  35.0      38 0.00082   17.3   1.7    8   52-59     26-33  (43)
109 PF00130 C1_1:  Phorbol esters/  35.0      47   0.001   16.9   2.2   12    3-14     11-22  (53)
110 KOG4739|consensus               34.3      24 0.00053   24.8   1.3   33   42-74     16-49  (233)
111 PF01873 eIF-5_eIF-2B:  Domain   34.0      61  0.0013   20.4   2.9   32   57-91     89-120 (125)
112 PF07754 DUF1610:  Domain of un  33.9      47   0.001   14.6   1.7    9   65-73      1-9   (24)
113 PF12874 zf-met:  Zinc-finger o  33.5      15 0.00032   15.6   0.1   13   89-101     1-13  (25)
114 PF13834 DUF4193:  Domain of un  33.4      15 0.00032   22.3   0.1   30   27-56     68-98  (99)
115 KOG2462|consensus               33.2      17 0.00037   26.2   0.4   16   27-42    128-143 (279)
116 PRK00085 recO DNA repair prote  32.9      26 0.00056   24.2   1.3   28   89-116   150-177 (247)
117 PF00628 PHD:  PHD-finger;  Int  32.8      42 0.00092   16.9   1.8   27    5-31      1-30  (51)
118 PF07975 C1_4:  TFIIH C1-like d  32.3      21 0.00045   18.9   0.6    9   65-73      2-10  (51)
119 PRK01103 formamidopyrimidine/5  32.0      24 0.00052   25.2   1.0   12   62-73    245-256 (274)
120 PF13912 zf-C2H2_6:  C2H2-type   31.9      16 0.00035   15.8   0.1   13   89-101     2-14  (27)
121 PRK14810 formamidopyrimidine-D  31.9      24 0.00052   25.2   1.0   13   62-74    244-256 (272)
122 PRK14873 primosome assembly pr  31.0      24 0.00052   28.6   1.0   37   32-71    395-431 (665)
123 PRK10445 endonuclease VIII; Pr  30.8      27 0.00058   24.8   1.0   12   62-73    235-246 (263)
124 COG0846 SIR2 NAD-dependent pro  30.5      87  0.0019   22.2   3.6   48   16-77    112-162 (250)
125 cd02335 ZZ_ADA2 Zinc finger, Z  30.4      51  0.0011   16.9   1.9    8   52-59     26-33  (49)
126 KOG2932|consensus               30.4      27 0.00058   25.8   1.0   42   31-72     92-133 (389)
127 TIGR00577 fpg formamidopyrimid  30.3      27 0.00059   24.9   1.0   26   62-87    245-270 (272)
128 COG1996 RPC10 DNA-directed RNA  29.8      21 0.00045   18.7   0.3    9   90-98      8-16  (49)
129 PRK14811 formamidopyrimidine-D  29.8      27 0.00059   24.9   1.0   13   62-74    235-247 (269)
130 PF14803 Nudix_N_2:  Nudix N-te  29.4      14  0.0003   17.8  -0.4   10    5-14      2-11  (34)
131 PHA00080 DksA-like zinc finger  29.3      21 0.00045   20.2   0.3   28   31-58     33-60  (72)
132 PF11331 DUF3133:  Protein of u  29.3      38 0.00083   17.5   1.2    6   65-70     34-39  (46)
133 COG1381 RecO Recombinational D  29.1      32  0.0007   24.2   1.2   26   90-115   156-181 (251)
134 PF10122 Mu-like_Com:  Mu-like   28.8      18 0.00038   19.2  -0.1   10   63-72      5-14  (51)
135 PRK14891 50S ribosomal protein  28.6      36 0.00077   21.7   1.2   23   63-85      5-31  (131)
136 PRK13945 formamidopyrimidine-D  28.6      30 0.00064   24.9   1.0   13   62-74    254-266 (282)
137 TIGR00599 rad18 DNA repair pro  28.3      24 0.00052   26.8   0.5   44   29-73     26-71  (397)
138 PF00320 GATA:  GATA zinc finge  28.2      71  0.0015   15.2   2.1   28   32-59      1-29  (36)
139 smart00746 TRASH metallochaper  28.0      57  0.0012   14.1   1.7    9   65-73      1-9   (39)
140 PRK13715 conjugal transfer pro  27.5      22 0.00047   20.2   0.1   29   30-58     35-63  (73)
141 cd02344 ZZ_HERC2 Zinc finger,   27.1      54  0.0012   16.8   1.6    8   52-59     26-33  (45)
142 COG1997 RPL43A Ribosomal prote  26.6      74  0.0016   18.9   2.2   37    2-46     34-70  (89)
143 KOG2186|consensus               26.3      15 0.00032   26.2  -0.8   44    1-44      1-44  (276)
144 KOG3816|consensus               26.0      25 0.00054   26.8   0.2   49   52-100   429-486 (526)
145 PF04981 NMD3:  NMD3 family ;    25.9      48   0.001   23.1   1.6   24   32-61      1-24  (236)
146 PF10892 DUF2688:  Protein of u  25.7      20 0.00042   19.4  -0.3   37   31-72     12-48  (60)
147 PF04810 zf-Sec23_Sec24:  Sec23  25.7      53  0.0011   16.1   1.4   29    4-37      3-32  (40)
148 PRK00241 nudC NADH pyrophospha  25.3      46   0.001   23.6   1.5    9   64-72    101-109 (256)
149 PF05502 Dynactin_p62:  Dynacti  25.3      44 0.00095   26.1   1.4   13   87-99     51-63  (483)
150 PF03604 DNA_RNApol_7kD:  DNA d  25.1      39 0.00085   15.9   0.7    8   91-98      3-10  (32)
151 TIGR02419 C4_traR_proteo phage  25.1      19 0.00041   19.8  -0.4   27   31-57     33-59  (63)
152 PF03854 zf-P11:  P-11 zinc fin  24.8      43 0.00094   17.5   0.9   26   49-74     20-47  (50)
153 cd02339 ZZ_Mind_bomb Zinc fing  24.7      66  0.0014   16.3   1.6   13   64-76      2-15  (45)
154 KOG2114|consensus               24.5      31 0.00067   28.9   0.5   46   22-70    835-880 (933)
155 PRK12495 hypothetical protein;  24.4      53  0.0012   22.9   1.6   28   63-100    43-70  (226)
156 PHA02768 hypothetical protein;  24.4      12 0.00026   20.2  -1.3   12   88-99     31-42  (55)
157 PF15121 TMEM71:  TMEM71 protei  24.3      85  0.0018   20.2   2.3   30   88-117    55-84  (149)
158 PF08792 A2L_zn_ribbon:  A2L zi  24.1      44 0.00096   15.8   0.8   10   46-55     17-26  (33)
159 PRK04023 DNA polymerase II lar  23.6      61  0.0013   27.9   2.0   36   30-73    639-674 (1121)
160 cd01412 SIRT5_Af1_CobB SIRT5_A  23.5 1.5E+02  0.0033   20.2   3.8   47   16-77     99-145 (224)
161 smart00355 ZnF_C2H2 zinc finge  23.4      44 0.00096   13.4   0.8   13   89-101     1-13  (26)
162 PF13771 zf-HC5HC2H:  PHD-like   23.4 1.1E+02  0.0025   17.3   2.7   54   58-115    32-89  (90)
163 PF03107 C1_2:  C1 domain;  Int  22.7      76  0.0016   14.4   1.5   12   90-101     2-13  (30)
164 cd02341 ZZ_ZZZ3 Zinc finger, Z  22.6      61  0.0013   16.7   1.3   13   64-76      2-15  (48)
165 PF05864 Chordopox_RPO7:  Chord  22.5      20 0.00042   19.5  -0.6   17   89-105     5-21  (63)
166 PRK03564 formate dehydrogenase  22.5 2.3E+02  0.0049   20.9   4.5   10    3-12    187-196 (309)
167 KOG3039|consensus               22.5 1.7E+02  0.0036   21.1   3.7   51   25-75    217-272 (303)
168 PF13832 zf-HC5HC2H_2:  PHD-zin  22.1      69  0.0015   19.1   1.7   29   60-89     53-85  (110)
169 PRK11019 hypothetical protein;  21.9      34 0.00073   20.3   0.2   29   30-58     37-65  (88)
170 PF09889 DUF2116:  Uncharacteri  21.9      49  0.0011   18.0   0.8   12   63-74      4-15  (59)
171 cd01407 SIR2-fam SIR2 family o  21.9      89  0.0019   21.3   2.3   17   62-78    133-149 (218)
172 PF11077 DUF2616:  Protein of u  21.8      31 0.00067   23.1   0.0   35   27-61    137-171 (173)
173 KOG2879|consensus               21.6 1.2E+02  0.0025   22.1   2.8   43   30-73    240-287 (298)
174 PF07750 GcrA:  GcrA cell cycle  21.5      17 0.00036   24.0  -1.3   28   93-120   117-152 (162)
175 cd01411 SIR2H SIR2H: Uncharact  21.3 1.9E+02  0.0041   20.0   3.8   17   62-78    136-152 (225)
176 KOG3970|consensus               21.3      82  0.0018   22.3   2.0   49   22-73     46-105 (299)
177 PF04945 YHS:  YHS domain;  Int  21.3      11 0.00024   19.1  -1.7   30   66-98      4-36  (47)
178 PHA03082 DNA-dependent RNA pol  21.1      21 0.00046   19.4  -0.7   16   89-104     5-20  (63)
179 PLN03123 poly [ADP-ribose] pol  20.8      69  0.0015   27.5   1.8   30    3-32     17-58  (981)
180 PF13639 zf-RING_2:  Ring finge  20.7 1.2E+02  0.0027   14.6   2.6    9   49-57     22-30  (44)
181 KOG0823|consensus               20.6 1.6E+02  0.0035   20.7   3.3   55   26-81     44-104 (230)
182 smart00249 PHD PHD zinc finger  20.6      79  0.0017   14.9   1.5   25    6-30      2-29  (47)
183 smart00653 eIF2B_5 domain pres  20.4 1.1E+02  0.0025   18.7   2.4   24   63-88     81-104 (110)
184 PF05290 Baculo_IE-1:  Baculovi  20.3      76  0.0017   20.4   1.6   43   30-72     81-131 (140)
185 PF14255 Cys_rich_CPXG:  Cystei  20.1      40 0.00088   17.8   0.3   10    5-14      2-11  (52)
186 PF14570 zf-RING_4:  RING/Ubox   20.0      93   0.002   16.2   1.6   20   52-71     24-46  (48)

No 1  
>KOG1701|consensus
Probab=99.93  E-value=2.9e-28  Score=175.69  Aligned_cols=117  Identities=32%  Similarity=0.709  Sum_probs=109.1

Q ss_pred             Cccccccccccccc--eEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCcccCcEEEEe
Q psy17880          3 KAYCTSCKKKCSGE--VLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVEGEVVTAL   80 (120)
Q Consensus         3 ~~~C~~C~~~i~~~--~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~~~~~~~~   80 (120)
                      ..+|.+|++.|.++  .+.++++.||..||+|..|++.|.++.||..|+++||+.||.... .+|..|+++|++++|.|.
T Consensus       274 ~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tl-ekC~~Cg~~I~d~iLrA~  352 (468)
T KOG1701|consen  274 FGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDTL-EKCNKCGEPIMDRILRAL  352 (468)
T ss_pred             hhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHHH-HHHhhhhhHHHHHHHHhc
Confidence            34899999999765  678999999999999999999999999999999999999999887 899999999999999999


Q ss_pred             CccccccccccccCCCcCCCCceeee-CCeeeeccCCCcCC
Q psy17880         81 GKTYHQKCFTCARCRFSKKREIYNWL-GGRAYENRLGGRAY  120 (120)
Q Consensus        81 ~~~~H~~Cf~C~~C~~~l~~~~~~~~-~g~~yC~~~~~~~~  120 (120)
                      |+.||+.||+|..|++.|++..|.+. ++++||-.|+-+.|
T Consensus       353 GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kf  393 (468)
T KOG1701|consen  353 GKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKF  393 (468)
T ss_pred             ccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhc
Confidence            99999999999999999999998876 79999999987765


No 2  
>KOG1701|consensus
Probab=99.92  E-value=2e-26  Score=166.26  Aligned_cols=116  Identities=27%  Similarity=0.624  Sum_probs=104.2

Q ss_pred             ccccccccccccceEEECCcccccccccccccccccCCCCee-ecCCeeccHhHHHhHhCCCCCCCCCccc---C--c--
Q psy17880          4 AYCTSCKKKCSGEVLRVQDKYFHITCFQCSVCKNSLAQGGYF-NKDGAYYCTSDYQKKFGTKCAQCGEYVE---G--E--   75 (120)
Q Consensus         4 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~-~~~~~~~C~~c~~~~~~~~C~~C~~~i~---~--~--   75 (120)
                      .+|..|+++|.+.+|.+.|+.||+.||+|..|.+.|++-.|. ..++++||..||.++|+++|+.|+++|.   |  +  
T Consensus       335 ekC~~Cg~~I~d~iLrA~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~~G~~etv  414 (468)
T KOG1701|consen  335 EKCNKCGEPIMDRILRALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILPRDGKDETV  414 (468)
T ss_pred             HHHhhhhhHHHHHHHHhcccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccCCCCCcceE
Confidence            468999999999999999999999999999999999987776 4678999999999999999999999994   2  2  


Q ss_pred             EEEEeCccccccccccccCCCcCCC----CceeeeCCeeeeccCCCcC
Q psy17880         76 VVTALGKTYHQKCFTCARCRFSKKR----EIYNWLGGRAYENRLGGRA  119 (120)
Q Consensus        76 ~~~~~~~~~H~~Cf~C~~C~~~l~~----~~~~~~~g~~yC~~~~~~~  119 (120)
                      .|+++++.||.+|++|..|+.+|+.    ..-|-+||.++|+.+..++
T Consensus       415 Rvvamdr~fHv~CY~CEDCg~~LS~e~e~qgCyPld~HllCk~Ch~~R  462 (468)
T KOG1701|consen  415 RVVAMDRDFHVNCYKCEDCGLLLSSEEEGQGCYPLDGHLLCKTCHLKR  462 (468)
T ss_pred             EEEEccccccccceehhhcCccccccCCCCcceeccCceeechhhhhh
Confidence            6789999999999999999999982    3588899999999987553


No 3  
>KOG2272|consensus
Probab=99.91  E-value=1.8e-26  Score=157.15  Aligned_cols=118  Identities=25%  Similarity=0.592  Sum_probs=111.2

Q ss_pred             CCCccccccccccccceEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCcccCcEEEEe
Q psy17880          1 MIKAYCTSCKKKCSGEVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVEGEVVTAL   80 (120)
Q Consensus         1 ~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~~~~~~~~   80 (120)
                      |.-++|..|.+||+++++.++|+.||.++|+|+.|.+|+-+...|++.|.+||+.+|.++++..|..|+.+|.|+++.+.
T Consensus       193 mgipiCgaC~rpIeervi~amgKhWHveHFvCa~CekPFlGHrHYEkkGlaYCe~h~~qLfG~~CF~C~~~i~G~vv~al  272 (332)
T KOG2272|consen  193 MGIPICGACRRPIEERVIFAMGKHWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFICNRVIGGDVVSAL  272 (332)
T ss_pred             cCCcccccccCchHHHHHHHhccccchhheeehhcCCcccchhhhhhcCchhHHHHHHHHhhhhheecCCccCccHHHHh
Confidence            34578999999999999999999999999999999999988899999999999999999999999999999999999999


Q ss_pred             CccccccccccccCCCcCC-CCceeeeCCeeeeccCCCc
Q psy17880         81 GKTYHQKCFTCARCRFSKK-REIYNWLGGRAYENRLGGR  118 (120)
Q Consensus        81 ~~~~H~~Cf~C~~C~~~l~-~~~~~~~~g~~yC~~~~~~  118 (120)
                      +++|.++||.|+.|++.|. ...|++.|-+|.|++++.|
T Consensus       273 ~KawCv~cf~Cs~Cdkkl~~K~Kf~E~DmkP~CKkCy~r  311 (332)
T KOG2272|consen  273 NKAWCVECFSCSTCDKKLTQKNKFYEFDMKPVCKKCYDR  311 (332)
T ss_pred             hhhhccccccccccccccccccceeeeccchHHHHHHhh
Confidence            9999999999999999996 5579999999999998864


No 4  
>KOG4577|consensus
Probab=99.89  E-value=1.8e-25  Score=154.77  Aligned_cols=115  Identities=30%  Similarity=0.668  Sum_probs=102.3

Q ss_pred             Cccccccccccccc-eEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCcccC-cEE-EE
Q psy17880          3 KAYCTSCKKKCSGE-VLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVEG-EVV-TA   79 (120)
Q Consensus         3 ~~~C~~C~~~i~~~-~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~~-~~~-~~   79 (120)
                      -++|+.|.+.|.++ ++.++++.||..|++|+.|..+|.+ .+|.+++.+||+++|.++|+.+|..|.+.|+. .+| .|
T Consensus        33 ip~CagC~q~IlDrFilKvl~R~wHs~CLkCs~C~~qL~d-rCFsR~~s~yCkedFfKrfGTKCsaC~~GIpPtqVVRkA  111 (383)
T KOG4577|consen   33 IPICAGCDQHILDRFILKVLDRHWHSSCLKCSDCHDQLAD-RCFSREGSVYCKEDFFKRFGTKCSACQEGIPPTQVVRKA  111 (383)
T ss_pred             cccccchHHHHHHHHHHHHHhhhhhhhhcchhhhhhHHHH-HHhhcCCceeehHHHHHHhCCcchhhcCCCChHHHHHHh
Confidence            47899999999877 6788999999999999999999986 69999999999999999999999999999975 444 68


Q ss_pred             eCccccccccccccCCCcCCCC-cee-eeCCeeeeccCCCc
Q psy17880         80 LGKTYHQKCFTCARCRFSKKRE-IYN-WLGGRAYENRLGGR  118 (120)
Q Consensus        80 ~~~~~H~~Cf~C~~C~~~l~~~-~~~-~~~g~~yC~~~~~~  118 (120)
                      .+..||.+||.|..|+++|..+ +|| +.|+++.|+.++..
T Consensus       112 qd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~  152 (383)
T KOG4577|consen  112 QDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYET  152 (383)
T ss_pred             hcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHH
Confidence            8999999999999999999655 566 45899999998854


No 5  
>KOG2272|consensus
Probab=99.87  E-value=1.9e-24  Score=147.41  Aligned_cols=114  Identities=24%  Similarity=0.417  Sum_probs=105.9

Q ss_pred             ccccccccccccceEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCcccCcEEEEeCcc
Q psy17880          4 AYCTSCKKKCSGEVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVEGEVVTALGKT   83 (120)
Q Consensus         4 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~~~~~~~~~~~   83 (120)
                      -+|.+|+..|+++.+...+..||+.+|.|..|++.|.+ ...+..+.+||.+|+.+.-.|+|..|.+||++++|.++|+.
T Consensus       138 YvC~KCh~~iD~~~l~fr~d~yH~yHFkCt~C~keL~s-daRevk~eLyClrChD~mgipiCgaC~rpIeervi~amgKh  216 (332)
T KOG2272|consen  138 YVCQKCHAHIDEQPLTFRGDPYHPYHFKCTTCGKELTS-DAREVKGELYCLRCHDKMGIPICGACRRPIEERVIFAMGKH  216 (332)
T ss_pred             eehhhhhhhcccccccccCCCCCccceecccccccccc-hhhhhccceeccccccccCCcccccccCchHHHHHHHhccc
Confidence            46899999999899999999999999999999999976 45667789999999999888999999999999999999999


Q ss_pred             ccccccccccCCCcCCCCceeeeCCeeeeccCCCc
Q psy17880         84 YHQKCFTCARCRFSKKREIYNWLGGRAYENRLGGR  118 (120)
Q Consensus        84 ~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~~~~  118 (120)
                      ||.++|+|+.|.+|+-+...++.+|.+||+.++.+
T Consensus       217 WHveHFvCa~CekPFlGHrHYEkkGlaYCe~h~~q  251 (332)
T KOG2272|consen  217 WHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHYHQ  251 (332)
T ss_pred             cchhheeehhcCCcccchhhhhhcCchhHHHHHHH
Confidence            99999999999999999999999999999998755


No 6  
>KOG1703|consensus
Probab=99.86  E-value=9.9e-23  Score=153.33  Aligned_cols=117  Identities=28%  Similarity=0.554  Sum_probs=111.2

Q ss_pred             Ccccccccccccc-ceEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCcccCcEEEEeC
Q psy17880          3 KAYCTSCKKKCSG-EVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVEGEVVTALG   81 (120)
Q Consensus         3 ~~~C~~C~~~i~~-~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~~~~~~~~~   81 (120)
                      .+.|..|++.|.+ +++.++++.||+.+|.|..|...+....+...+|.+||..|+...+.+.|.+|+++|.++.|.+.+
T Consensus       303 ~p~c~~c~~~i~~~~~i~~~~~~~h~~~~~c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~~p~C~~C~~~i~~~~v~a~~  382 (479)
T KOG1703|consen  303 RPLCLSCNQKIRSVKVIVALGKEWHPEHFSCEVCAIVILDGGPRELDGKILCHECFHAPFRPNCKRCLLPILEEGVCALG  382 (479)
T ss_pred             cccccccccCcccceeEeeccccccccceeeccccccccCCCccccCCCccHHHHHHHhhCccccccCCchHHhHhhhcc
Confidence            4789999999998 899999999999999999999999888888999999999999999999999999999999999999


Q ss_pred             ccccccccccccCCCcCCCCceeeeCCeeeeccCCCcC
Q psy17880         82 KTYHQKCFTCARCRFSKKREIYNWLGGRAYENRLGGRA  119 (120)
Q Consensus        82 ~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~~~~~  119 (120)
                      +.||++||.|..|+++|.+..|++.||.+||+.++...
T Consensus       383 ~~wH~~cf~C~~C~~~~~~~~~~~~~~~pyce~~~~~~  420 (479)
T KOG1703|consen  383 RLWHPECFVCADCGKPLKNSSFFESDGEPYCEDHYKKL  420 (479)
T ss_pred             CeechhceeeecccCCCCCCcccccCCccchhhhHhhh
Confidence            99999999999999999999999999999999988543


No 7  
>KOG1703|consensus
Probab=99.86  E-value=6e-23  Score=154.51  Aligned_cols=115  Identities=27%  Similarity=0.590  Sum_probs=109.7

Q ss_pred             CCccccccccccccceEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCccc--CcEEEE
Q psy17880          2 IKAYCTSCKKKCSGEVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVE--GEVVTA   79 (120)
Q Consensus         2 ~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~--~~~~~~   79 (120)
                      ..+.|.+|+++|.++.|.+.+..||++||.|..|++++....|+..++.+||+.||.++++.+|..|.++++  +..+.+
T Consensus       362 ~~p~C~~C~~~i~~~~v~a~~~~wH~~cf~C~~C~~~~~~~~~~~~~~~pyce~~~~~~~~~~~~~~~~p~~~~~~~ie~  441 (479)
T KOG1703|consen  362 FRPNCKRCLLPILEEGVCALGRLWHPECFVCADCGKPLKNSSFFESDGEPYCEDHYKKLFTTKCDYCKKPVEFGSRQIEA  441 (479)
T ss_pred             hCccccccCCchHHhHhhhccCeechhceeeecccCCCCCCcccccCCccchhhhHhhhccccchhccchhHhhhhHhhc
Confidence            357899999999999999999999999999999999999999999999999999999999999999999986  678999


Q ss_pred             eCccccccccccccCCCcCCCCceeeeCCeeeeccCC
Q psy17880         80 LGKTYHQKCFTCARCRFSKKREIYNWLGGRAYENRLG  116 (120)
Q Consensus        80 ~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~~  116 (120)
                      .+..||..||+|+.|.+.|.++.|+...++++|+.++
T Consensus       442 ~~~~~h~~~F~c~~c~~~l~~~~~~~~~~~p~c~~~~  478 (479)
T KOG1703|consen  442 DGSPFHGDCFRCANCMKKLTKKTFFETLDKPLCQKHF  478 (479)
T ss_pred             cCccccccceehhhhhccccCCceeecCCccccccCC
Confidence            9999999999999999999999999999999999986


No 8  
>KOG1044|consensus
Probab=99.83  E-value=1e-21  Score=146.38  Aligned_cols=108  Identities=34%  Similarity=0.807  Sum_probs=97.6

Q ss_pred             Ccccccccccc-ccceEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCcccCcEEEEeC
Q psy17880          3 KAYCTSCKKKC-SGEVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVEGEVVTALG   81 (120)
Q Consensus         3 ~~~C~~C~~~i-~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~~~~~~~~~   81 (120)
                      ...|++|++.| .|+.+.++++.||..||+|..|+..|.+ .+..+|+.+||+.+|.+.|+.+|..|.+.|.|.++.+.|
T Consensus       133 ps~cagc~~~lk~gq~llald~qwhv~cfkc~~c~~vL~g-ey~skdg~pyce~dy~~~fgvkc~~c~~fisgkvLqag~  211 (670)
T KOG1044|consen  133 PSTCAGCGEELKNGQALLALDKQWHVSCFKCKSCSAVLNG-EYMSKDGVPYCEKDYQAKFGVKCEECEKFISGKVLQAGD  211 (670)
T ss_pred             Cccccchhhhhhccceeeeeccceeeeeeehhhhcccccc-eeeccCCCcchhhhhhhhcCeehHHhhhhhhhhhhhccC
Confidence            35799999988 7889999999999999999999999976 699999999999999999999999999999999999999


Q ss_pred             ccccccccccccCCCcCCCCc-eeeeCCeee
Q psy17880         82 KTYHQKCFTCARCRFSKKREI-YNWLGGRAY  111 (120)
Q Consensus        82 ~~~H~~Cf~C~~C~~~l~~~~-~~~~~g~~y  111 (120)
                      ++||+.|-+|++|+..+..++ .|+-+..+|
T Consensus       212 kh~HPtCARCsRCgqmF~eGEEMYlQGs~iW  242 (670)
T KOG1044|consen  212 KHFHPTCARCSRCGQMFGEGEEMYLQGSEIW  242 (670)
T ss_pred             cccCcchhhhhhhccccccchheeecccccc
Confidence            999999999999999998665 554454444


No 9  
>KOG1044|consensus
Probab=99.70  E-value=5.7e-18  Score=126.55  Aligned_cols=113  Identities=28%  Similarity=0.563  Sum_probs=94.6

Q ss_pred             cccccccccceEEECCcccccccccccccccccCCC-CeeecCCeeccHhHHHhHh--------CCCCCCCCCcc-cCcE
Q psy17880          7 TSCKKKCSGEVLRVQDKYFHITCFQCSVCKNSLAQG-GYFNKDGAYYCTSDYQKKF--------GTKCAQCGEYV-EGEV   76 (120)
Q Consensus         7 ~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~-~~~~~~~~~~C~~c~~~~~--------~~~C~~C~~~i-~~~~   76 (120)
                      ..|..-|.++++.++|++||++||.|+.|..+...+ ....-+....|+.|....-        ...|++|++.| .|..
T Consensus        69 ~~c~~~~~gevvsa~gktyh~~cf~cs~ck~pf~~g~~vt~~gk~~~c~~c~~~~~~~p~~~~~ps~cagc~~~lk~gq~  148 (670)
T KOG1044|consen   69 DDCRAFVEGEVVSTLGKTYHPKCFSCSTCKSPFKSGDKVTFSGKECLCQTCSQPMPVSPAESYGPSTCAGCGEELKNGQA  148 (670)
T ss_pred             cchhhhccceeEecccceeccccceecccCCCCCCCCeeeecchhhhhhhhcCcccCCcccccCCccccchhhhhhccce
Confidence            456677889999999999999999999999998766 4445555678888875321        24799999999 6789


Q ss_pred             EEEeCccccccccccccCCCcCCCCceeeeCCeeeeccCCCcCC
Q psy17880         77 VTALGKTYHQKCFTCARCRFSKKREIYNWLGGRAYENRLGGRAY  120 (120)
Q Consensus        77 ~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~~~~~~  120 (120)
                      +.|.++.||..||+|..|...|. ++|+..||.|||++++...|
T Consensus       149 llald~qwhv~cfkc~~c~~vL~-gey~skdg~pyce~dy~~~f  191 (670)
T KOG1044|consen  149 LLALDKQWHVSCFKCKSCSAVLN-GEYMSKDGVPYCEKDYQAKF  191 (670)
T ss_pred             eeeeccceeeeeeehhhhccccc-ceeeccCCCcchhhhhhhhc
Confidence            99999999999999999999884 55788999999999998765


No 10 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.66  E-value=3.4e-17  Score=90.29  Aligned_cols=56  Identities=29%  Similarity=0.698  Sum_probs=50.6

Q ss_pred             CCCCCCcccCc--EEEEeCccccccccccccCCCcCCCCceeeeCCeeeeccCCCcCC
Q psy17880         65 CAQCGEYVEGE--VVTALGKTYHQKCFTCARCRFSKKREIYNWLGGRAYENRLGGRAY  120 (120)
Q Consensus        65 C~~C~~~i~~~--~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~~~~~~  120 (120)
                      |..|+++|.+.  ++.+.|+.||++||+|+.|+++|.++.++..||++||+.++.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            78999999753  346999999999999999999999999999999999999998776


No 11 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.64  E-value=3.4e-16  Score=86.30  Aligned_cols=56  Identities=39%  Similarity=1.002  Sum_probs=50.6

Q ss_pred             ccccccccccc-e-EEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHh
Q psy17880          6 CTSCKKKCSGE-V-LRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKF   61 (120)
Q Consensus         6 C~~C~~~i~~~-~-~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~   61 (120)
                      |.+|+++|.+. . +.+.|+.||++||+|+.|+++|.++.++..++++||+.||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            78999999755 3 36999999999999999999999888999999999999999875


No 12 
>KOG1700|consensus
Probab=99.50  E-value=2.4e-15  Score=101.85  Aligned_cols=117  Identities=32%  Similarity=0.625  Sum_probs=99.8

Q ss_pred             Cccccccccccc-cceEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHhCC------------------
Q psy17880          3 KAYCTSCKKKCS-GEVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGT------------------   63 (120)
Q Consensus         3 ~~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~------------------   63 (120)
                      ...|.+|++.+. .+.+...|..||..||.|..|.+.|....+..+++.+||+.+|...+++                  
T Consensus         7 ~~kc~~c~k~vy~~e~~~~~g~~~hk~c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~~~~~~~~~~~~~~~~~~~~~~~   86 (200)
T KOG1700|consen    7 TDKCNACGKTVYFVEKVQKDGVDFHKECFKCEKCKKTLTLSGYSEHEGVPYCKNCHVAQFGPKGGGFGKGFQKAGGLGKD   86 (200)
T ss_pred             cchhhhccCcchHHHHHhccCcchhhhHHhccccccccccccccccccccccccchHhhhCcccccccccccccCCCCcc
Confidence            347999999883 3344477889999999999999999988899999999999977666544                  


Q ss_pred             -----------------------CCCCCCCccc-CcEEEEeCccccccccccccCCCcCCCCceeeeCCeeeeccCCCcC
Q psy17880         64 -----------------------KCAQCGEYVE-GEVVTALGKTYHQKCFTCARCRFSKKREIYNWLGGRAYENRLGGRA  119 (120)
Q Consensus        64 -----------------------~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~~~~~  119 (120)
                                             .|..|.+.+- .+-+...+..||..||+|+.|+..|+...+...+|.+||..++.+.
T Consensus        87 ~~~~~~~~~~~~~~~~~~~g~~~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls~~~~~~~~g~l~~~~~~~~~  166 (200)
T KOG1700|consen   87 GKSLNESKPNQSAKFQVFAGEKEKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLSPKNYAALEGVLYCKHHFAQL  166 (200)
T ss_pred             cccccccccccchhHHhhhccccccccccceeeehHHHhhhhhhhhhhheeecccccccCCcchhhcCCccccchhhhee
Confidence                                   6999998884 4667888999999999999999999999999999999999887553


No 13 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=99.02  E-value=2.7e-10  Score=57.30  Aligned_cols=36  Identities=44%  Similarity=1.019  Sum_probs=32.5

Q ss_pred             CCCCCCCcccC--cEEEEeCccccccccccccCCCcCC
Q psy17880         64 KCAQCGEYVEG--EVVTALGKTYHQKCFTCARCRFSKK   99 (120)
Q Consensus        64 ~C~~C~~~i~~--~~~~~~~~~~H~~Cf~C~~C~~~l~   99 (120)
                      +|..|+++|.+  ..+.+.++.||++||+|..|+++|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            58899999976  6778999999999999999999985


No 14 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.88  E-value=1.3e-09  Score=54.76  Aligned_cols=36  Identities=42%  Similarity=0.867  Sum_probs=32.1

Q ss_pred             ccccccccccc--ceEEECCcccccccccccccccccC
Q psy17880          5 YCTSCKKKCSG--EVLRVQDKYFHITCFQCSVCKNSLA   40 (120)
Q Consensus         5 ~C~~C~~~i~~--~~~~~~~~~~H~~Cf~C~~C~~~l~   40 (120)
                      +|.+|+++|.+  ..+.+.++.||++||+|..|+++|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            48899999976  5778889999999999999999985


No 15 
>KOG4577|consensus
Probab=98.36  E-value=4.8e-09  Score=73.64  Aligned_cols=58  Identities=17%  Similarity=0.430  Sum_probs=49.4

Q ss_pred             CCCCCCCCCcccCc-EEEEeCccccccccccccCCCcCCCCceeeeCCeeeeccCCCcCC
Q psy17880         62 GTKCAQCGEYVEGE-VVTALGKTYHQKCFTCARCRFSKKREIYNWLGGRAYENRLGGRAY  120 (120)
Q Consensus        62 ~~~C~~C~~~i~~~-~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~~~~~~  120 (120)
                      .++|+.|.+.|.++ ++.+.+++||..|++|+.|..+|...=| ..+|.+||+.++-.+|
T Consensus        33 ip~CagC~q~IlDrFilKvl~R~wHs~CLkCs~C~~qL~drCF-sR~~s~yCkedFfKrf   91 (383)
T KOG4577|consen   33 IPICAGCDQHILDRFILKVLDRHWHSSCLKCSDCHDQLADRCF-SREGSVYCKEDFFKRF   91 (383)
T ss_pred             cccccchHHHHHHHHHHHHHhhhhhhhhcchhhhhhHHHHHHh-hcCCceeehHHHHHHh
Confidence            48999999999887 4579999999999999999999966544 4789999999875544


No 16 
>KOG0490|consensus
Probab=97.98  E-value=4.6e-07  Score=62.41  Aligned_cols=108  Identities=31%  Similarity=0.695  Sum_probs=82.4

Q ss_pred             cccccccc-eEEECCcccccccccccccccccC-CCCeeecCCeeccHhHHHh--HhCCCCCCCCCccc--CcEEEEeCc
Q psy17880          9 CKKKCSGE-VLRVQDKYFHITCFQCSVCKNSLA-QGGYFNKDGAYYCTSDYQK--KFGTKCAQCGEYVE--GEVVTALGK   82 (120)
Q Consensus         9 C~~~i~~~-~~~~~~~~~H~~Cf~C~~C~~~l~-~~~~~~~~~~~~C~~c~~~--~~~~~C~~C~~~i~--~~~~~~~~~   82 (120)
                      |+..|.+. .+.+.+..||..|..|..|...+. ....+..++..||..+|..  .+..+|.+|...+.  +++..+..+
T Consensus         2 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~d~~~~~~~~~rr~rt~~~~~ql~~ler~f~~   81 (235)
T KOG0490|consen    2 CGRQILDRYLLRVLDRYWHASCLKCAECDNPLGVGDTCFSKDGSIYCKRDYQREFKFSKRCARCKFTISQLDELERAFEK   81 (235)
T ss_pred             CCccccchHHhhcccHHHHHHHHhhhhhcchhccCCCcccCCCcccccccchhhhhccccccCCCCCcCHHHHHHHhhcC
Confidence            56667655 355568899999999999999997 2245555999999999998  77789999999984  345566677


Q ss_pred             cccccccccccCCCcCCC-CceeeeCC-eeeeccCCC
Q psy17880         83 TYHQKCFTCARCRFSKKR-EIYNWLGG-RAYENRLGG  117 (120)
Q Consensus        83 ~~H~~Cf~C~~C~~~l~~-~~~~~~~g-~~yC~~~~~  117 (120)
                      . |..||.|..|...+.+ ..+.+.+. +.++.++..
T Consensus        82 ~-h~Pd~~~r~~la~~~~~~e~rVqvwFqnrrak~r~  117 (235)
T KOG0490|consen   82 V-HLPCFACRECLALLLTGDEFRVQVWFQNRRAKDRK  117 (235)
T ss_pred             C-CcCccchHHHHhhcCCCCeeeeehhhhhhcHhhhh
Confidence            7 9999999999886644 44555544 777777654


No 17 
>KOG1700|consensus
Probab=97.77  E-value=4.1e-06  Score=56.98  Aligned_cols=55  Identities=29%  Similarity=0.565  Sum_probs=47.8

Q ss_pred             CCCCCCCCccc-CcEEEEeCccccccccccccCCCcCCCCceeeeCCeeeecc-CCC
Q psy17880         63 TKCAQCGEYVE-GEVVTALGKTYHQKCFTCARCRFSKKREIYNWLGGRAYENR-LGG  117 (120)
Q Consensus        63 ~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~-~~~  117 (120)
                      ..|..|++.+. .+.+...|..||..||+|..|.+.|+...+...++.+||+. ++.
T Consensus         8 ~kc~~c~k~vy~~e~~~~~g~~~hk~c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~   64 (200)
T KOG1700|consen    8 DKCNACGKTVYFVEKVQKDGVDFHKECFKCEKCKKTLTLSGYSEHEGVPYCKNCHVA   64 (200)
T ss_pred             chhhhccCcchHHHHHhccCcchhhhHHhccccccccccccccccccccccccchHh
Confidence            58999999883 45556889999999999999999999999999999999999 443


No 18 
>KOG1702|consensus
Probab=97.54  E-value=6.1e-06  Score=55.73  Aligned_cols=55  Identities=27%  Similarity=0.528  Sum_probs=46.2

Q ss_pred             CCCCCCCccc-CcEEEEeCccccccccccccCCCcCCCCceeeeCCeeeeccCCCc
Q psy17880         64 KCAQCGEYVE-GEVVTALGKTYHQKCFTCARCRFSKKREIYNWLGGRAYENRLGGR  118 (120)
Q Consensus        64 ~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~~~~  118 (120)
                      .|..|++.+- -+.|.-.++.||..||+|..|+.+|.-..+.-.|.++||+.++..
T Consensus         6 n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hYpk   61 (264)
T KOG1702|consen    6 NREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHYPK   61 (264)
T ss_pred             hhhhhccccccHHHHhhHHHHHHHHhheeeeccCChhhhhccccccCCCcCccccc
Confidence            4556777663 356777899999999999999999999998889999999999864


No 19 
>KOG1702|consensus
Probab=97.44  E-value=8e-06  Score=55.18  Aligned_cols=60  Identities=32%  Similarity=0.616  Sum_probs=50.5

Q ss_pred             CCcccccccccc-ccceEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHh
Q psy17880          2 IKAYCTSCKKKC-SGEVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKF   61 (120)
Q Consensus         2 ~~~~C~~C~~~i-~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~   61 (120)
                      ++..|..|++.+ +-+.+..+++.||..||.|..|+.+|.-.++-..+.++||..+|.+..
T Consensus         3 ~k~n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hYpkq~   63 (264)
T KOG1702|consen    3 KKCNREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHYPKQV   63 (264)
T ss_pred             ccchhhhhccccccHHHHhhHHHHHHHHhheeeeccCChhhhhccccccCCCcCcccccce
Confidence            456678888876 445677889999999999999999998878888899999999997654


No 20 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=93.27  E-value=0.079  Score=28.45  Aligned_cols=37  Identities=32%  Similarity=0.886  Sum_probs=25.8

Q ss_pred             CCCCCCCCCccc--CcEEE--EeCcccccccc----cccc--CCCcC
Q psy17880         62 GTKCAQCGEYVE--GEVVT--ALGKTYHQKCF----TCAR--CRFSK   98 (120)
Q Consensus        62 ~~~C~~C~~~i~--~~~~~--~~~~~~H~~Cf----~C~~--C~~~l   98 (120)
                      +.+|..|+++|.  +++|+  .-+..||.+|.    .|..  |+.++
T Consensus         5 ~~~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~~~~g~C~~~~c~~~~   51 (54)
T PF14446_consen    5 GCKCPVCGKKFKDGDDIVVCPECGAPYHRDCWEKAGGCINYSCGTGF   51 (54)
T ss_pred             CccChhhCCcccCCCCEEECCCCCCcccHHHHhhCCceEeccCCCCc
Confidence            478999999994  44553  45778999998    4655  55544


No 21 
>KOG0490|consensus
Probab=92.03  E-value=0.03  Score=38.38  Aligned_cols=50  Identities=24%  Similarity=0.547  Sum_probs=39.9

Q ss_pred             CCCcccCc-EEEEeCccccccccccccCCCcCC--CCceeeeCCeeeeccCCCc
Q psy17880         68 CGEYVEGE-VVTALGKTYHQKCFTCARCRFSKK--REIYNWLGGRAYENRLGGR  118 (120)
Q Consensus        68 C~~~i~~~-~~~~~~~~~H~~Cf~C~~C~~~l~--~~~~~~~~g~~yC~~~~~~  118 (120)
                      |+.+|.+. .+.+.+..||..|..|..|...+.  ...|.. +|..||..++.+
T Consensus         2 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~g~~~~~~d~~~   54 (235)
T KOG0490|consen    2 CGRQILDRYLLRVLDRYWHASCLKCAECDNPLGVGDTCFSK-DGSIYCKRDYQR   54 (235)
T ss_pred             CCccccchHHhhcccHHHHHHHHhhhhhcchhccCCCcccC-CCcccccccchh
Confidence            56667654 345568999999999999999997  555666 999999998865


No 22 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=91.84  E-value=0.13  Score=25.43  Aligned_cols=31  Identities=39%  Similarity=0.749  Sum_probs=22.3

Q ss_pred             CCCCCCcccCc--EEEEeCccccccccccccCCCcC
Q psy17880         65 CAQCGEYVEGE--VVTALGKTYHQKCFTCARCRFSK   98 (120)
Q Consensus        65 C~~C~~~i~~~--~~~~~~~~~H~~Cf~C~~C~~~l   98 (120)
                      |..|+++|.++  ++...++.|+   |.|..|.+.|
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~---fCC~tC~~~f   33 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYY---FCCPTCLSQF   33 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEE---EECHHHHHHH
Confidence            67899999775  5678888888   5556665544


No 23 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=90.94  E-value=0.16  Score=28.30  Aligned_cols=45  Identities=20%  Similarity=0.438  Sum_probs=23.1

Q ss_pred             ccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCcccC
Q psy17880         30 FQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVEG   74 (120)
Q Consensus        30 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~~   74 (120)
                      ++|+.|...|...-....=+.++|..|-.+.++..|..|..|-..
T Consensus         8 LrCs~C~~~l~~pv~l~~CeH~fCs~Ci~~~~~~~CPvC~~Paw~   52 (65)
T PF14835_consen    8 LRCSICFDILKEPVCLGGCEHIFCSSCIRDCIGSECPVCHTPAWI   52 (65)
T ss_dssp             TS-SSS-S--SS-B---SSS--B-TTTGGGGTTTB-SSS--B-S-
T ss_pred             cCCcHHHHHhcCCceeccCccHHHHHHhHHhcCCCCCCcCChHHH
Confidence            578888888765433455568899999988888889999988743


No 24 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=90.62  E-value=0.28  Score=32.06  Aligned_cols=50  Identities=24%  Similarity=0.523  Sum_probs=37.5

Q ss_pred             CeeccHhHHHhHhCCCCCCCCCcccCcE----EEEeCccccccccccccCCCcCCC
Q psy17880         49 GAYYCTSDYQKKFGTKCAQCGEYVEGEV----VTALGKTYHQKCFTCARCRFSKKR  100 (120)
Q Consensus        49 ~~~~C~~c~~~~~~~~C~~C~~~i~~~~----~~~~~~~~H~~Cf~C~~C~~~l~~  100 (120)
                      ..-||..|-.+.. ..|..|+.+|.|.+    +...+..|+.-- -|..|+++++.
T Consensus        27 ~~~fC~kCG~~tI-~~Cp~C~~~IrG~y~v~gv~~~g~~~~~Ps-YC~~CGkpyPW   80 (158)
T PF10083_consen   27 REKFCSKCGAKTI-TSCPNCSTPIRGDYHVEGVFGLGGHYEAPS-YCHNCGKPYPW   80 (158)
T ss_pred             HHHHHHHhhHHHH-HHCcCCCCCCCCceecCCeeeeCCCCCCCh-hHHhCCCCCch
Confidence            4558999988877 89999999998852    334466676543 48999998864


No 25 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=87.93  E-value=0.19  Score=30.52  Aligned_cols=28  Identities=36%  Similarity=0.717  Sum_probs=20.6

Q ss_pred             CCCCCCCcc-cCcEEEEe-Ccccccccccc
Q psy17880         64 KCAQCGEYV-EGEVVTAL-GKTYHQKCFTC   91 (120)
Q Consensus        64 ~C~~C~~~i-~~~~~~~~-~~~~H~~Cf~C   91 (120)
                      +|..|+++| .|+..++. +..-|.+||.=
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~~   33 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFRE   33 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHHH
Confidence            588899998 57776654 45779888863


No 26 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=87.24  E-value=0.47  Score=28.46  Aligned_cols=27  Identities=33%  Similarity=0.698  Sum_probs=15.9

Q ss_pred             CCCCCCCCcccCc-EEEEe-Ccccccccc
Q psy17880         63 TKCAQCGEYVEGE-VVTAL-GKTYHQKCF   89 (120)
Q Consensus        63 ~~C~~C~~~i~~~-~~~~~-~~~~H~~Cf   89 (120)
                      ..|..|+++|... ++.+. |..+|..|+
T Consensus        79 ~~C~vC~k~l~~~~f~~~p~~~v~H~~C~  107 (109)
T PF10367_consen   79 TKCSVCGKPLGNSVFVVFPCGHVVHYSCI  107 (109)
T ss_pred             CCccCcCCcCCCceEEEeCCCeEEecccc
Confidence            4688888877543 33333 445676664


No 27 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=87.12  E-value=1.5  Score=23.61  Aligned_cols=43  Identities=14%  Similarity=0.217  Sum_probs=31.7

Q ss_pred             ccccccccccCCCCeeecCCeeccHhHHHhHh--CCCCCCCCCccc
Q psy17880         30 FQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKF--GTKCAQCGEYVE   73 (120)
Q Consensus        30 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~--~~~C~~C~~~i~   73 (120)
                      |.|..|+..+.. ......|..||..+..+.+  ...|..|++++.
T Consensus         2 ~~Cpi~~~~~~~-Pv~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~~   46 (63)
T smart00504        2 FLCPISLEVMKD-PVILPSGQTYERRAIEKWLLSHGTDPVTGQPLT   46 (63)
T ss_pred             cCCcCCCCcCCC-CEECCCCCEEeHHHHHHHHHHCCCCCCCcCCCC
Confidence            567888888765 4666778999998887654  356888877774


No 28 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=86.45  E-value=0.43  Score=25.40  Aligned_cols=25  Identities=20%  Similarity=0.333  Sum_probs=15.3

Q ss_pred             ccccCCCcCCCCceeeeCCeeeecc
Q psy17880         90 TCARCRFSKKREIYNWLGGRAYENR  114 (120)
Q Consensus        90 ~C~~C~~~l~~~~~~~~~g~~yC~~  114 (120)
                      .|..|...++...-+..||+.||..
T Consensus         9 aC~~C~C~V~~~~Ai~~dGk~YCS~   33 (52)
T PF02069_consen    9 ACPSCSCVVSEEEAIQKDGKYYCSE   33 (52)
T ss_dssp             SSTT----B-TTTSEESSS-EESSH
T ss_pred             cCCCCEeEECchHhHHhCCEeeecH
Confidence            3678888888788888999999964


No 29 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=86.14  E-value=0.62  Score=22.81  Aligned_cols=25  Identities=24%  Similarity=0.404  Sum_probs=17.9

Q ss_pred             ccccCCCcCCCCceeeeCCeeeeccCCCc
Q psy17880         90 TCARCRFSKKREIYNWLGGRAYENRLGGR  118 (120)
Q Consensus        90 ~C~~C~~~l~~~~~~~~~g~~yC~~~~~~  118 (120)
                      .|..|+..    .|...||..||..++-+
T Consensus        10 ~C~~C~~~----~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen   10 PCPVCGSR----WFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             cCCCCCCe----EeEccCCEEEhhhCceE
Confidence            47777554    57778999999877643


No 30 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=85.81  E-value=0.26  Score=27.92  Aligned_cols=48  Identities=25%  Similarity=0.522  Sum_probs=20.5

Q ss_pred             CeeccHhHHHhHh-CCCCCCCCCcccCcEEEEeCccccccccccccCCCcCCCCc
Q psy17880         49 GAYYCTSDYQKKF-GTKCAQCGEYVEGEVVTALGKTYHQKCFTCARCRFSKKREI  102 (120)
Q Consensus        49 ~~~~C~~c~~~~~-~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~  102 (120)
                      +..+|..|..... ...|..|++++.  ++.+-|..    =|.|..|+..++..+
T Consensus        16 ~~~~C~~C~~~~~~~a~CPdC~~~Le--~LkACGAv----dYFC~~c~gLiSKkr   64 (70)
T PF07191_consen   16 GHYHCEACQKDYKKEAFCPDCGQPLE--VLKACGAV----DYFCNHCHGLISKKR   64 (70)
T ss_dssp             TEEEETTT--EEEEEEE-TTT-SB-E--EEEETTEE----EEE-TTTT-EE-TTT
T ss_pred             CEEECccccccceecccCCCcccHHH--HHHHhccc----ceeeccCCceeecce
Confidence            4444554443211 156777777763  45555431    145677777776654


No 31 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=85.39  E-value=0.18  Score=24.56  Aligned_cols=28  Identities=18%  Similarity=0.468  Sum_probs=18.4

Q ss_pred             ccccccccCCCCeeecCCeeccHhHHHh
Q psy17880         32 CSVCKNSLAQGGYFNKDGAYYCTSDYQK   59 (120)
Q Consensus        32 C~~C~~~l~~~~~~~~~~~~~C~~c~~~   59 (120)
                      |..|+.++.........+..+|..|..+
T Consensus         6 C~~CGe~I~~~Rl~~~p~~~~C~~C~~~   33 (36)
T PF01258_consen    6 CEDCGEPIPEERLVAVPGATLCVECQER   33 (36)
T ss_dssp             -TTTSSBEEHHHHHHCTTECS-HHHHHH
T ss_pred             ccccCChHHHHHHHhCCCcEECHHHhCc
Confidence            6777777766666666777778777654


No 32 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=84.86  E-value=2.4  Score=21.88  Aligned_cols=42  Identities=19%  Similarity=0.515  Sum_probs=28.3

Q ss_pred             cccccccccCCCCeeecCCee-ccHhHHHhHh--CCCCCCCCCccc
Q psy17880         31 QCSVCKNSLAQGGYFNKDGAY-YCTSDYQKKF--GTKCAQCGEYVE   73 (120)
Q Consensus        31 ~C~~C~~~l~~~~~~~~~~~~-~C~~c~~~~~--~~~C~~C~~~i~   73 (120)
                      .|..|...... ..+..=|.. +|..|..+..  ...|..|.++|.
T Consensus         4 ~C~iC~~~~~~-~~~~pCgH~~~C~~C~~~~~~~~~~CP~Cr~~i~   48 (50)
T PF13920_consen    4 ECPICFENPRD-VVLLPCGHLCFCEECAERLLKRKKKCPICRQPIE   48 (50)
T ss_dssp             B-TTTSSSBSS-EEEETTCEEEEEHHHHHHHHHTTSBBTTTTBB-S
T ss_pred             CCccCCccCCc-eEEeCCCChHHHHHHhHHhcccCCCCCcCChhhc
Confidence            45666665433 344556777 9999998874  478999998885


No 33 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=84.76  E-value=0.77  Score=29.22  Aligned_cols=23  Identities=17%  Similarity=0.459  Sum_probs=15.4

Q ss_pred             ccccCCCcCCCCceeeeCCeeeeccCCC
Q psy17880         90 TCARCRFSKKREIYNWLGGRAYENRLGG  117 (120)
Q Consensus        90 ~C~~C~~~l~~~~~~~~~g~~yC~~~~~  117 (120)
                      .|..|+.||    |. ++|.+||..|+.
T Consensus        30 hCp~Cg~PL----F~-KdG~v~CPvC~~   52 (131)
T COG1645          30 HCPKCGTPL----FR-KDGEVFCPVCGY   52 (131)
T ss_pred             hCcccCCcc----ee-eCCeEECCCCCc
Confidence            367777776    33 777777777764


No 34 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=83.56  E-value=0.95  Score=24.71  Aligned_cols=50  Identities=22%  Similarity=0.487  Sum_probs=28.3

Q ss_pred             CCccccccccccccceEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCC
Q psy17880          2 IKAYCTSCKKKCSGEVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCG   69 (120)
Q Consensus         2 ~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~   69 (120)
                      +.++|.+|+.+|.+.-        +.--|.|..|+..+..          -|..|-.....-+|..|+
T Consensus         6 ~~~~CtSCg~~i~~~~--------~~~~F~CPnCG~~~I~----------RC~~CRk~~~~Y~CP~CG   55 (59)
T PRK14890          6 EPPKCTSCGIEIAPRE--------KAVKFLCPNCGEVIIY----------RCEKCRKQSNPYTCPKCG   55 (59)
T ss_pred             cCccccCCCCcccCCC--------ccCEeeCCCCCCeeEe----------echhHHhcCCceECCCCC
Confidence            4567888888875321        1112677788776322          166665554444566665


No 35 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=81.47  E-value=0.97  Score=20.27  Aligned_cols=12  Identities=17%  Similarity=0.797  Sum_probs=6.5

Q ss_pred             Cccccccccccc
Q psy17880          3 KAYCTSCKKKCS   14 (120)
Q Consensus         3 ~~~C~~C~~~i~   14 (120)
                      ...|..|+..|.
T Consensus         2 ~~~Cp~Cg~~~~   13 (26)
T PF13248_consen    2 EMFCPNCGAEID   13 (26)
T ss_pred             cCCCcccCCcCC
Confidence            345666666543


No 36 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=80.18  E-value=0.99  Score=30.85  Aligned_cols=31  Identities=13%  Similarity=0.172  Sum_probs=27.5

Q ss_pred             cccccCCCcCCCCceeeeCCeeeeccCCCcC
Q psy17880         89 FTCARCRFSKKREIYNWLGGRAYENRLGGRA  119 (120)
Q Consensus        89 f~C~~C~~~l~~~~~~~~~g~~yC~~~~~~~  119 (120)
                      -+|+.|+..+....-...||++.|..|+...
T Consensus       173 v~C~kCGE~~~e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELFMEPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCcccccchhhhcCCceecccccccc
Confidence            6899999999888888999999999998754


No 37 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=80.03  E-value=0.77  Score=27.49  Aligned_cols=30  Identities=30%  Similarity=0.637  Sum_probs=20.9

Q ss_pred             CCCCCCCcc-cCcEEEEe-Ccccccccccccc
Q psy17880         64 KCAQCGEYV-EGEVVTAL-GKTYHQKCFTCAR   93 (120)
Q Consensus        64 ~C~~C~~~i-~~~~~~~~-~~~~H~~Cf~C~~   93 (120)
                      +|+.|+++| +|+..++. ...-|-+||.=+.
T Consensus         8 kC~VCg~~iieGqkFTF~~kGsVH~eCl~~s~   39 (103)
T COG4847           8 KCYVCGGTIIEGQKFTFTKKGSVHYECLAESK   39 (103)
T ss_pred             eEeeeCCEeeeccEEEEeeCCcchHHHHHHHH
Confidence            688898888 67766543 4467888885443


No 38 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=79.68  E-value=2.8  Score=21.08  Aligned_cols=39  Identities=21%  Similarity=0.562  Sum_probs=24.0

Q ss_pred             ccccccccCCC--CeeecCCeeccHhHHHhHh--CCCCCCCCC
Q psy17880         32 CSVCKNSLAQG--GYFNKDGAYYCTSDYQKKF--GTKCAQCGE   70 (120)
Q Consensus        32 C~~C~~~l~~~--~~~~~~~~~~C~~c~~~~~--~~~C~~C~~   70 (120)
                      |..|.....+.  .+...=|.++|..|..+..  ...|..|++
T Consensus         2 C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~~~~~~~~CP~C~k   44 (44)
T PF14634_consen    2 CNICFEKYSEERRPRLTSCGHIFCEKCLKKLKGKSVKCPICRK   44 (44)
T ss_pred             CcCcCccccCCCCeEEcccCCHHHHHHHHhhcCCCCCCcCCCC
Confidence            44555555221  2334557888888888776  567777753


No 39 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=78.91  E-value=2.7  Score=25.06  Aligned_cols=29  Identities=14%  Similarity=0.250  Sum_probs=22.0

Q ss_pred             ccccCCCcCCCCceeee-CCeeeeccCCCc
Q psy17880         90 TCARCRFSKKREIYNWL-GGRAYENRLGGR  118 (120)
Q Consensus        90 ~C~~C~~~l~~~~~~~~-~g~~yC~~~~~~  118 (120)
                      .|..|+++|..+.|... +|..+=..|..|
T Consensus        80 ~C~vC~k~l~~~~f~~~p~~~v~H~~C~~r  109 (109)
T PF10367_consen   80 KCSVCGKPLGNSVFVVFPCGHVVHYSCIKR  109 (109)
T ss_pred             CccCcCCcCCCceEEEeCCCeEEecccccC
Confidence            58999999998877654 788776666544


No 40 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=78.61  E-value=0.54  Score=22.97  Aligned_cols=32  Identities=22%  Similarity=0.562  Sum_probs=18.0

Q ss_pred             CCccccccccc--cccceEEECCcccccccccccccccc
Q psy17880          2 IKAYCTSCKKK--CSGEVLRVQDKYFHITCFQCSVCKNS   38 (120)
Q Consensus         2 ~~~~C~~C~~~--i~~~~~~~~~~~~H~~Cf~C~~C~~~   38 (120)
                      |...|.+|+..  |+++.+...+..     ++|+.|+..
T Consensus         1 M~i~Cp~C~~~y~i~d~~ip~~g~~-----v~C~~C~~~   34 (36)
T PF13717_consen    1 MIITCPNCQAKYEIDDEKIPPKGRK-----VRCSKCGHV   34 (36)
T ss_pred             CEEECCCCCCEEeCCHHHCCCCCcE-----EECCCCCCE
Confidence            45678888875  345444443433     466666543


No 41 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=78.27  E-value=1.1  Score=22.68  Aligned_cols=22  Identities=41%  Similarity=0.848  Sum_probs=13.8

Q ss_pred             cccccccccCCCCeeecCCeeccHhH
Q psy17880         31 QCSVCKNSLAQGGYFNKDGAYYCTSD   56 (120)
Q Consensus        31 ~C~~C~~~l~~~~~~~~~~~~~C~~c   56 (120)
                      .|..|+.||    +..++++.+|..|
T Consensus        19 ~Cp~C~~PL----~~~k~g~~~Cv~C   40 (41)
T PF06677_consen   19 HCPDCGTPL----MRDKDGKIYCVSC   40 (41)
T ss_pred             ccCCCCCee----EEecCCCEECCCC
Confidence            456677766    3356777777554


No 42 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=78.26  E-value=1.4  Score=24.05  Aligned_cols=28  Identities=21%  Similarity=0.442  Sum_probs=19.6

Q ss_pred             ccccCCCcCCC--CceeeeCCeeeeccCCC
Q psy17880         90 TCARCRFSKKR--EIYNWLGGRAYENRLGG  117 (120)
Q Consensus        90 ~C~~C~~~l~~--~~~~~~~g~~yC~~~~~  117 (120)
                      .|..|++.|..  +.|+..+.++||...-|
T Consensus        18 ~C~~C~k~L~~~~DiymYrGd~aFCS~ECR   47 (58)
T PF04570_consen   18 FCYLCKKKLDPGKDIYMYRGDKAFCSEECR   47 (58)
T ss_pred             HHHccCCCCCCCCCeeeeccccccccHHHH
Confidence            37788888873  34667788888876543


No 43 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=77.32  E-value=3.4  Score=19.90  Aligned_cols=24  Identities=25%  Similarity=0.498  Sum_probs=12.6

Q ss_pred             CCeeccHhHHHhHh---CCCCCCCCCc
Q psy17880         48 DGAYYCTSDYQKKF---GTKCAQCGEY   71 (120)
Q Consensus        48 ~~~~~C~~c~~~~~---~~~C~~C~~~   71 (120)
                      =+..+|..|..+.+   ...|..|+..
T Consensus        18 C~H~~c~~C~~~~~~~~~~~Cp~C~~~   44 (45)
T cd00162          18 CGHVFCRSCIDKWLKSGKNTCPLCRTP   44 (45)
T ss_pred             CCChhcHHHHHHHHHhCcCCCCCCCCc
Confidence            45556666665433   2356666543


No 44 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=77.25  E-value=2.6  Score=23.05  Aligned_cols=10  Identities=40%  Similarity=0.953  Sum_probs=7.3

Q ss_pred             cccccccccc
Q psy17880          4 AYCTSCKKKC   13 (120)
Q Consensus         4 ~~C~~C~~~i   13 (120)
                      ++|.+|+..|
T Consensus        10 ~~CtSCg~~i   19 (61)
T COG2888          10 PVCTSCGREI   19 (61)
T ss_pred             ceeccCCCEe
Confidence            5677777777


No 45 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=75.38  E-value=1.9  Score=25.64  Aligned_cols=42  Identities=33%  Similarity=0.682  Sum_probs=26.7

Q ss_pred             cccccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCcccC
Q psy17880         25 FHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVEG   74 (120)
Q Consensus        25 ~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~~   74 (120)
                      |-+.=-.|..|...+..      .|.-||..|-.+.  .+|+.|++.|.+
T Consensus        40 y~~~~~~C~~CK~~v~q------~g~~YCq~CAYkk--GiCamCGKki~d   81 (90)
T PF10235_consen   40 YAPYSSKCKICKTKVHQ------PGAKYCQTCAYKK--GICAMCGKKILD   81 (90)
T ss_pred             ccccCcccccccccccc------CCCccChhhhccc--CcccccCCeecc
Confidence            44434466777665543      2456888886654  588888888843


No 46 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=74.80  E-value=2  Score=18.74  Aligned_cols=6  Identities=33%  Similarity=1.066  Sum_probs=2.2

Q ss_pred             CCCCcc
Q psy17880         67 QCGEYV   72 (120)
Q Consensus        67 ~C~~~i   72 (120)
                      .|+..|
T Consensus         4 ~CG~~~    9 (23)
T PF13240_consen    4 NCGAEI    9 (23)
T ss_pred             ccCCCC
Confidence            333333


No 47 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=74.39  E-value=3.3  Score=21.85  Aligned_cols=29  Identities=28%  Similarity=0.645  Sum_probs=20.6

Q ss_pred             cccccccccCCC-CeeecCCeeccHhHHHhH
Q psy17880         31 QCSVCKNSLAQG-GYFNKDGAYYCTSDYQKK   60 (120)
Q Consensus        31 ~C~~C~~~l~~~-~~~~~~~~~~C~~c~~~~   60 (120)
                      .|+.|++.++-- .+-..|| ..|.+|+.+.
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            477888887543 2446777 6899998775


No 48 
>KOG0320|consensus
Probab=72.68  E-value=3.4  Score=27.78  Aligned_cols=48  Identities=19%  Similarity=0.530  Sum_probs=36.9

Q ss_pred             cccccccccccccCCCC-eeecCCeeccHhHHHhHh--CCCCCCCCCcccC
Q psy17880         27 ITCFQCSVCKNSLAQGG-YFNKDGAYYCTSDYQKKF--GTKCAQCGEYVEG   74 (120)
Q Consensus        27 ~~Cf~C~~C~~~l~~~~-~~~~~~~~~C~~c~~~~~--~~~C~~C~~~i~~   74 (120)
                      ..++.|-.|-.+..... +..+=|.++|..|-....  +.+|..|++.|..
T Consensus       129 ~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt~  179 (187)
T KOG0320|consen  129 EGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKITH  179 (187)
T ss_pred             ccccCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCcccccch
Confidence            35788888877776553 557889999999997654  4789999998854


No 49 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=72.37  E-value=4.6  Score=19.62  Aligned_cols=30  Identities=20%  Similarity=0.485  Sum_probs=18.0

Q ss_pred             ccccccccCCCCeeecCCeeccHhHHHhHh
Q psy17880         32 CSVCKNSLAQGGYFNKDGAYYCTSDYQKKF   61 (120)
Q Consensus        32 C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~   61 (120)
                      |..|...+.+......=|..||.+|..+..
T Consensus         1 C~iC~~~~~~~~~~~~CGH~fC~~C~~~~~   30 (39)
T PF13923_consen    1 CPICLDELRDPVVVTPCGHSFCKECIEKYL   30 (39)
T ss_dssp             ETTTTSB-SSEEEECTTSEEEEHHHHHHHH
T ss_pred             CCCCCCcccCcCEECCCCCchhHHHHHHHH
Confidence            345655554422456667888888877654


No 50 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=72.21  E-value=1.4  Score=30.09  Aligned_cols=47  Identities=26%  Similarity=0.658  Sum_probs=35.9

Q ss_pred             cccccccccccCCCCeeecCCeeccHhHHHhHh--CCCCCCCCCcccCcE
Q psy17880         29 CFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKF--GTKCAQCGEYVEGEV   76 (120)
Q Consensus        29 Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~--~~~C~~C~~~i~~~~   76 (120)
                      -|.|..|.+...+ .....-|..+|..|+.+.+  ++.|..|++...|..
T Consensus       196 PF~C~iCKkdy~s-pvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t~G~f  244 (259)
T COG5152         196 PFLCGICKKDYES-PVVTECGHSFCSLCAIRKYQKGDECGVCGKATYGRF  244 (259)
T ss_pred             ceeehhchhhccc-hhhhhcchhHHHHHHHHHhccCCcceecchhhccce
Confidence            4788888877654 4666778889999998766  478999998877654


No 51 
>PRK00420 hypothetical protein; Validated
Probab=72.11  E-value=3.1  Score=25.80  Aligned_cols=11  Identities=27%  Similarity=0.770  Sum_probs=6.4

Q ss_pred             CCCCCCCCCcc
Q psy17880         62 GTKCAQCGEYV   72 (120)
Q Consensus        62 ~~~C~~C~~~i   72 (120)
                      +..|..|+.|+
T Consensus        23 ~~~CP~Cg~pL   33 (112)
T PRK00420         23 SKHCPVCGLPL   33 (112)
T ss_pred             cCCCCCCCCcc
Confidence            34566666555


No 52 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=71.74  E-value=11  Score=25.78  Aligned_cols=50  Identities=22%  Similarity=0.451  Sum_probs=35.6

Q ss_pred             ccccccccccccCCCCeeecCCeeccHhHHHhHh------------------CCCCCCCCCcccC-cEEE
Q psy17880         28 TCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKF------------------GTKCAQCGEYVEG-EVVT   78 (120)
Q Consensus        28 ~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~------------------~~~C~~C~~~i~~-~~~~   78 (120)
                      +-|.|..|...+.+ .....=|..||..|..+-.                  .+.|..|..+|.. ..+.
T Consensus        17 ~~~~CpICld~~~d-PVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is~~~LvP   85 (193)
T PLN03208         17 GDFDCNICLDQVRD-PVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSEATLVP   85 (193)
T ss_pred             CccCCccCCCcCCC-cEEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCChhcEEE
Confidence            34788899887754 4566788999999986532                  2579999999854 3443


No 53 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=69.74  E-value=1.4  Score=30.09  Aligned_cols=31  Identities=23%  Similarity=0.385  Sum_probs=26.6

Q ss_pred             ccccccccccCCCCeeecCCeeccHhHHHhH
Q psy17880         30 FQCSVCKNSLAQGGYFNKDGAYYCTSDYQKK   60 (120)
Q Consensus        30 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~   60 (120)
                      .+|+.|+.......-...+|++.|..|+.+.
T Consensus       173 v~C~kCGE~~~e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELFMEPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCcccccchhhhcCCceecccccccc
Confidence            6899999998877778899999999998753


No 54 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=69.33  E-value=3.4  Score=22.14  Aligned_cols=24  Identities=21%  Similarity=0.398  Sum_probs=18.3

Q ss_pred             CCCCCCCCcccC-cEEEEeCccccc
Q psy17880         63 TKCAQCGEYVEG-EVVTALGKTYHQ   86 (120)
Q Consensus        63 ~~C~~C~~~i~~-~~~~~~~~~~H~   86 (120)
                      .+|..|++||.. ..+...+..-|+
T Consensus         2 ~~CvVCKqpi~~a~~v~T~~G~VH~   26 (54)
T PF10886_consen    2 EICVVCKQPIDDALVVETESGPVHP   26 (54)
T ss_pred             CeeeeeCCccCcceEEEcCCCccCc
Confidence            479999999965 566667777777


No 55 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=69.27  E-value=2.1  Score=24.59  Aligned_cols=12  Identities=50%  Similarity=1.002  Sum_probs=9.4

Q ss_pred             Cccccccccccc
Q psy17880          3 KAYCTSCKKKCS   14 (120)
Q Consensus         3 ~~~C~~C~~~i~   14 (120)
                      ...|..|++.|.
T Consensus         7 Ra~Ck~C~~~I~   18 (82)
T PF00645_consen    7 RAKCKGCKKKIA   18 (82)
T ss_dssp             TEBETTTSCBE-
T ss_pred             CccCcccCCcCC
Confidence            457999999995


No 56 
>KOG1813|consensus
Probab=68.04  E-value=2.9  Score=30.31  Aligned_cols=46  Identities=26%  Similarity=0.640  Sum_probs=34.5

Q ss_pred             cccccccccccCCCCeeecCCeeccHhHHHhHhC--CCCCCCCCcccCc
Q psy17880         29 CFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFG--TKCAQCGEYVEGE   75 (120)
Q Consensus        29 Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~--~~C~~C~~~i~~~   75 (120)
                      -|.|..|+++... .....-+..+|+.|..+.+.  ++|..|++.+.|.
T Consensus       241 Pf~c~icr~~f~~-pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g~  288 (313)
T KOG1813|consen  241 PFKCFICRKYFYR-PVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHGS  288 (313)
T ss_pred             Ccccccccccccc-chhhcCCceeehhhhccccccCCcceecccccccc
Confidence            4677788887754 46677788889999877653  6899999888653


No 57 
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=67.73  E-value=2.9  Score=24.31  Aligned_cols=28  Identities=36%  Similarity=0.778  Sum_probs=15.9

Q ss_pred             ccccccccCCCCee--ecCC---eeccHhHHHh
Q psy17880         32 CSVCKNSLAQGGYF--NKDG---AYYCTSDYQK   59 (120)
Q Consensus        32 C~~C~~~l~~~~~~--~~~~---~~~C~~c~~~   59 (120)
                      |..|+.||.....+  ..||   .-||..||..
T Consensus         3 CQSCGMPl~~~~~~Gte~dGs~s~~YC~yCy~~   35 (81)
T PF12674_consen    3 CQSCGMPLSKDEDFGTEADGSKSEDYCSYCYQN   35 (81)
T ss_pred             CCcCcCccCCccccccccCCCCchhHHHHHhcC
Confidence            66677777654422  1222   4488888764


No 58 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=66.33  E-value=1.9  Score=21.07  Aligned_cols=32  Identities=16%  Similarity=0.542  Sum_probs=16.9

Q ss_pred             CCcccccccccc--ccceEEECCcccccccccccccccc
Q psy17880          2 IKAYCTSCKKKC--SGEVLRVQDKYFHITCFQCSVCKNS   38 (120)
Q Consensus         2 ~~~~C~~C~~~i--~~~~~~~~~~~~H~~Cf~C~~C~~~   38 (120)
                      |...|.+|+...  +++.+...+..     .+|+.|+..
T Consensus         1 M~i~CP~C~~~f~v~~~~l~~~~~~-----vrC~~C~~~   34 (37)
T PF13719_consen    1 MIITCPNCQTRFRVPDDKLPAGGRK-----VRCPKCGHV   34 (37)
T ss_pred             CEEECCCCCceEEcCHHHcccCCcE-----EECCCCCcE
Confidence            456777887753  44444333332     456666543


No 59 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=64.90  E-value=1.9  Score=20.93  Aligned_cols=12  Identities=25%  Similarity=0.813  Sum_probs=7.5

Q ss_pred             CCcccccccccc
Q psy17880          2 IKAYCTSCKKKC   13 (120)
Q Consensus         2 ~~~~C~~C~~~i   13 (120)
                      |+..|..|+..+
T Consensus         1 M~~~CP~C~~~~   12 (38)
T TIGR02098         1 MRIQCPNCKTSF   12 (38)
T ss_pred             CEEECCCCCCEE
Confidence            345677777754


No 60 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=64.19  E-value=1.3  Score=20.41  Aligned_cols=12  Identities=42%  Similarity=1.093  Sum_probs=5.4

Q ss_pred             CCCCCCCCcccC
Q psy17880         63 TKCAQCGEYVEG   74 (120)
Q Consensus        63 ~~C~~C~~~i~~   74 (120)
                      .+|..|...|..
T Consensus         2 ~~C~rC~~~~~~   13 (30)
T PF06827_consen    2 EKCPRCWNYIED   13 (30)
T ss_dssp             SB-TTT--BBEE
T ss_pred             CcCccCCCcceE
Confidence            457777777643


No 61 
>PF12773 DZR:  Double zinc ribbon
Probab=63.73  E-value=6.9  Score=20.04  Aligned_cols=7  Identities=43%  Similarity=1.327  Sum_probs=3.0

Q ss_pred             CCCCCCc
Q psy17880         65 CAQCGEY   71 (120)
Q Consensus        65 C~~C~~~   71 (120)
                      |..|+..
T Consensus        32 C~~Cg~~   38 (50)
T PF12773_consen   32 CPNCGAE   38 (50)
T ss_pred             CcCCcCC
Confidence            4444443


No 62 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=63.69  E-value=17  Score=19.68  Aligned_cols=23  Identities=17%  Similarity=0.543  Sum_probs=17.9

Q ss_pred             eccHhHHHhHhCCCCCCCCCccc
Q psy17880         51 YYCTSDYQKKFGTKCAQCGEYVE   73 (120)
Q Consensus        51 ~~C~~c~~~~~~~~C~~C~~~i~   73 (120)
                      .+|.+|....+...|.-|+..+.
T Consensus        30 TFC~~C~e~~l~~~CPNCgGelv   52 (57)
T PF06906_consen   30 TFCADCAETMLNGVCPNCGGELV   52 (57)
T ss_pred             cccHHHHHHHhcCcCcCCCCccc
Confidence            37888888887888888887653


No 63 
>KOG0978|consensus
Probab=62.56  E-value=3.4  Score=33.45  Aligned_cols=44  Identities=25%  Similarity=0.641  Sum_probs=29.3

Q ss_pred             cccccccccccCCCCeeecCCeeccHhHHHhHhC---CCCCCCCCccc
Q psy17880         29 CFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFG---TKCAQCGEYVE   73 (120)
Q Consensus        29 Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~---~~C~~C~~~i~   73 (120)
                      =++|+.|+....+ ....+=+.++|..|...++.   .+|+.|+.+..
T Consensus       643 ~LkCs~Cn~R~Kd-~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFg  689 (698)
T KOG0978|consen  643 LLKCSVCNTRWKD-AVITKCGHVFCEECVQTRYETRQRKCPKCNAAFG  689 (698)
T ss_pred             ceeCCCccCchhh-HHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCC
Confidence            3577778755543 34456677888888877665   57777777663


No 64 
>KOG3002|consensus
Probab=61.51  E-value=8.6  Score=28.00  Aligned_cols=45  Identities=27%  Similarity=0.491  Sum_probs=36.7

Q ss_pred             ccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCccc
Q psy17880         28 TCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVE   73 (120)
Q Consensus        28 ~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~   73 (120)
                      +=+.|..|...|....+.=.+|.+.|..|-.++. .+|..|.++|.
T Consensus        47 ~lleCPvC~~~l~~Pi~QC~nGHlaCssC~~~~~-~~CP~Cr~~~g   91 (299)
T KOG3002|consen   47 DLLDCPVCFNPLSPPIFQCDNGHLACSSCRTKVS-NKCPTCRLPIG   91 (299)
T ss_pred             hhccCchhhccCcccceecCCCcEehhhhhhhhc-ccCCccccccc
Confidence            3467888888887766777889999999987665 89999999884


No 65 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=61.14  E-value=7.6  Score=19.60  Aligned_cols=13  Identities=23%  Similarity=0.478  Sum_probs=9.4

Q ss_pred             CCCCCCCcccCcE
Q psy17880         64 KCAQCGEYVEGEV   76 (120)
Q Consensus        64 ~C~~C~~~i~~~~   76 (120)
                      .|..|+++|.|..
T Consensus         2 ~Cd~C~~~i~G~r   14 (43)
T cd02340           2 ICDGCQGPIVGVR   14 (43)
T ss_pred             CCCCCCCcCcCCe
Confidence            5778888877654


No 66 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=61.10  E-value=6  Score=20.18  Aligned_cols=9  Identities=22%  Similarity=0.744  Sum_probs=4.2

Q ss_pred             ccccCCCcC
Q psy17880         90 TCARCRFSK   98 (120)
Q Consensus        90 ~C~~C~~~l   98 (120)
                      .|..|+..+
T Consensus         4 ~C~~Cg~~~   12 (44)
T smart00659        4 ICGECGREN   12 (44)
T ss_pred             ECCCCCCEe
Confidence            445554443


No 67 
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=60.52  E-value=8.4  Score=19.41  Aligned_cols=9  Identities=33%  Similarity=0.586  Sum_probs=6.0

Q ss_pred             eccHhHHHh
Q psy17880         51 YYCTSDYQK   59 (120)
Q Consensus        51 ~~C~~c~~~   59 (120)
                      -+|.+||.+
T Consensus        28 dlC~~Cf~~   36 (44)
T smart00291       28 DLCQSCFAK   36 (44)
T ss_pred             cchHHHHhC
Confidence            367777764


No 68 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=60.33  E-value=7.7  Score=26.43  Aligned_cols=41  Identities=24%  Similarity=0.526  Sum_probs=27.8

Q ss_pred             CCCCCCCCcccCcEEEEeCcccccccc------------------------ccccCCCcCCCCce
Q psy17880         63 TKCAQCGEYVEGEVVTALGKTYHQKCF------------------------TCARCRFSKKREIY  103 (120)
Q Consensus        63 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf------------------------~C~~C~~~l~~~~~  103 (120)
                      ..|..|...+.+.+++.-|..|+..|+                        +|-.|...++....
T Consensus        19 ~~CpICld~~~dPVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is~~~L   83 (193)
T PLN03208         19 FDCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSEATL   83 (193)
T ss_pred             cCCccCCCcCCCcEEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCChhcE
Confidence            457777777666666666766666555                        57888888866543


No 69 
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=57.27  E-value=4.4  Score=23.93  Aligned_cols=17  Identities=35%  Similarity=1.009  Sum_probs=14.2

Q ss_pred             HHHhHhCCCCCCCCCcc
Q psy17880         56 DYQKKFGTKCAQCGEYV   72 (120)
Q Consensus        56 c~~~~~~~~C~~C~~~i   72 (120)
                      -|..+|...|.+|++.+
T Consensus        48 sY~~lfs~pC~~C~klL   64 (90)
T PF11571_consen   48 SYRNLFSTPCKKCGKLL   64 (90)
T ss_pred             HHhhhccchhhHHHhHh
Confidence            46777888999999988


No 70 
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=56.07  E-value=12  Score=22.71  Aligned_cols=26  Identities=23%  Similarity=0.322  Sum_probs=20.7

Q ss_pred             ccccCCCcCCCCceeeeCCeeeeccCCCcC
Q psy17880         90 TCARCRFSKKREIYNWLGGRAYENRLGGRA  119 (120)
Q Consensus        90 ~C~~C~~~l~~~~~~~~~g~~yC~~~~~~~  119 (120)
                      .|..|    .+..|+..++.+.|+.|+.|.
T Consensus        37 aCeiC----~~~GY~q~g~~lvC~~C~~~~   62 (102)
T PF10080_consen   37 ACEIC----GPKGYYQEGDQLVCKNCGVRF   62 (102)
T ss_pred             ecccc----CCCceEEECCEEEEecCCCEE
Confidence            47777    566788999999999998764


No 71 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=55.56  E-value=8  Score=31.18  Aligned_cols=48  Identities=21%  Similarity=0.452  Sum_probs=25.4

Q ss_pred             ccccccccccccceEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHh--CCCCCCCCCcc
Q psy17880          4 AYCTSCKKKCSGEVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKF--GTKCAQCGEYV   72 (120)
Q Consensus         4 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~--~~~C~~C~~~i   72 (120)
                      .+|..|+..+.+..            --|..||.+|..         ..|..|-....  ...|..|+.++
T Consensus         2 ~~Cp~Cg~~n~~~a------------kFC~~CG~~l~~---------~~Cp~CG~~~~~~~~fC~~CG~~~   51 (645)
T PRK14559          2 LICPQCQFENPNNN------------RFCQKCGTSLTH---------KPCPQCGTEVPVDEAHCPNCGAET   51 (645)
T ss_pred             CcCCCCCCcCCCCC------------ccccccCCCCCC---------CcCCCCCCCCCcccccccccCCcc
Confidence            57888888765321            125556666632         12444443321  24677777665


No 72 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=55.44  E-value=10  Score=19.21  Aligned_cols=8  Identities=50%  Similarity=0.949  Sum_probs=4.6

Q ss_pred             ccHhHHHh
Q psy17880         52 YCTSDYQK   59 (120)
Q Consensus        52 ~C~~c~~~   59 (120)
                      +|..||..
T Consensus        25 LC~~Cf~~   32 (46)
T cd02249          25 LCSSCYAK   32 (46)
T ss_pred             CHHHHHCc
Confidence            56666653


No 73 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=55.11  E-value=2.7  Score=22.40  Aligned_cols=28  Identities=18%  Similarity=0.338  Sum_probs=18.2

Q ss_pred             ccccCCCcCCCCceeee---CCeeeeccCCC
Q psy17880         90 TCARCRFSKKREIYNWL---GGRAYENRLGG  117 (120)
Q Consensus        90 ~C~~C~~~l~~~~~~~~---~g~~yC~~~~~  117 (120)
                      +|+.|...|+++.+...   ++..+|+.+++
T Consensus        24 ~C~gC~~~l~~~~~~~i~~~~~i~~Cp~CgR   54 (56)
T PF02591_consen   24 TCSGCHMELPPQELNEIRKGDEIVFCPNCGR   54 (56)
T ss_pred             ccCCCCEEcCHHHHHHHHcCCCeEECcCCCc
Confidence            67778777776654332   45677777764


No 74 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=50.65  E-value=5.8  Score=19.87  Aligned_cols=9  Identities=22%  Similarity=0.704  Sum_probs=3.8

Q ss_pred             ccccCCCcC
Q psy17880         90 TCARCRFSK   98 (120)
Q Consensus        90 ~C~~C~~~l   98 (120)
                      +|..|+..+
T Consensus         7 ~C~~Cg~~f   15 (42)
T PF09723_consen    7 RCEECGHEF   15 (42)
T ss_pred             EeCCCCCEE
Confidence            344444333


No 75 
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.49  E-value=19  Score=22.91  Aligned_cols=48  Identities=25%  Similarity=0.585  Sum_probs=31.9

Q ss_pred             eccHhHHHhHhCCCCCCCCCcccCc----EEEEeCccccccccccccCCCcCCC
Q psy17880         51 YYCTSDYQKKFGTKCAQCGEYVEGE----VVTALGKTYHQKCFTCARCRFSKKR  100 (120)
Q Consensus        51 ~~C~~c~~~~~~~~C~~C~~~i~~~----~~~~~~~~~H~~Cf~C~~C~~~l~~  100 (120)
                      .+|..|-.... ..|..|+.+|.|+    -|...|.-|-+--| |..|++++..
T Consensus        29 afcskcgeati-~qcp~csasirgd~~vegvlglg~dye~psf-chncgs~fpw   80 (160)
T COG4306          29 AFCSKCGEATI-TQCPICSASIRGDYYVEGVLGLGGDYEPPSF-CHNCGSRFPW   80 (160)
T ss_pred             HHHhhhchHHH-hcCCccCCcccccceeeeeeccCCCCCCcch-hhcCCCCCCc
Confidence            46777666554 6789999999874    23345666666543 7788887754


No 76 
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=50.29  E-value=8.9  Score=27.57  Aligned_cols=27  Identities=26%  Similarity=0.591  Sum_probs=18.3

Q ss_pred             CCCCCCCCCcccCcEEEEeCccccccc
Q psy17880         62 GTKCAQCGEYVEGEVVTALGKTYHQKC   88 (120)
Q Consensus        62 ~~~C~~C~~~i~~~~~~~~~~~~H~~C   88 (120)
                      +..|..|+.+|....+.-.+..|.+.|
T Consensus       245 GepC~~CGt~I~k~~~~gR~t~~CP~C  271 (273)
T COG0266         245 GEPCRRCGTPIEKIKLGGRSTFYCPVC  271 (273)
T ss_pred             CCCCCccCCEeEEEEEcCCcCEeCCCC
Confidence            468999999997555555555555544


No 77 
>KOG4443|consensus
Probab=50.19  E-value=8  Score=31.09  Aligned_cols=22  Identities=23%  Similarity=0.483  Sum_probs=17.2

Q ss_pred             EeCccccccccccccCCCcCCC
Q psy17880         79 ALGKTYHQKCFTCARCRFSKKR  100 (120)
Q Consensus        79 ~~~~~~H~~Cf~C~~C~~~l~~  100 (120)
                      ..+..+.++|+.|..|+..+.+
T Consensus       106 ~sg~~~ckk~~~c~qc~~~lpg  127 (694)
T KOG4443|consen  106 PSGPWLCKKCTRCRQCDSTLPG  127 (694)
T ss_pred             cCcccccHHHHhhhhccccccc
Confidence            3466678888999999888876


No 78 
>COG2075 RPL24A Ribosomal protein L24E [Translation, ribosomal structure and biogenesis]
Probab=48.71  E-value=19  Score=20.07  Aligned_cols=21  Identities=19%  Similarity=0.382  Sum_probs=10.2

Q ss_pred             ccccCCCcCCCCc---eeeeCCee
Q psy17880         90 TCARCRFSKKREI---YNWLGGRA  110 (120)
Q Consensus        90 ~C~~C~~~l~~~~---~~~~~g~~  110 (120)
                      +|+-|+..|.++.   |+..||.+
T Consensus         5 ~CsFcG~~I~PGtG~m~Vr~Dg~v   28 (66)
T COG2075           5 VCSFCGKKIEPGTGIMYVRNDGKV   28 (66)
T ss_pred             EecCcCCccCCCceEEEEecCCeE
Confidence            3566666664331   33345553


No 79 
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=48.23  E-value=16  Score=18.59  Aligned_cols=10  Identities=20%  Similarity=0.408  Sum_probs=7.1

Q ss_pred             eeccHhHHHh
Q psy17880         50 AYYCTSDYQK   59 (120)
Q Consensus        50 ~~~C~~c~~~   59 (120)
                      --+|..||.+
T Consensus        28 ~dLC~~C~~~   37 (46)
T PF00569_consen   28 YDLCEDCFSK   37 (46)
T ss_dssp             -EEEHHHHHH
T ss_pred             CchhhHHHhC
Confidence            3478999876


No 80 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=47.55  E-value=1.3  Score=26.65  Aligned_cols=32  Identities=25%  Similarity=0.508  Sum_probs=15.5

Q ss_pred             ccccccccccccCCCcCCCCceeeeCCeeeec
Q psy17880         82 KTYHQKCFTCARCRFSKKREIYNWLGGRAYEN  113 (120)
Q Consensus        82 ~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~  113 (120)
                      ..+++.+..|..|.+.|+..+|.+.+--|||+
T Consensus        56 ~~~~~~~iiCGvC~~~LT~~EY~~~~~Cp~C~   87 (105)
T COG4357          56 QEFNPKAIICGVCRKLLTRAEYGMCGSCPYCQ   87 (105)
T ss_pred             hhcCCccEEhhhhhhhhhHHHHhhcCCCCCcC
Confidence            34455555555555555544444444444443


No 81 
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=47.01  E-value=21  Score=18.70  Aligned_cols=26  Identities=31%  Similarity=0.747  Sum_probs=19.6

Q ss_pred             CCCCCCCCcccC--c-EEEEeCccccccc
Q psy17880         63 TKCAQCGEYVEG--E-VVTALGKTYHQKC   88 (120)
Q Consensus        63 ~~C~~C~~~i~~--~-~~~~~~~~~H~~C   88 (120)
                      ..|..|+.-..+  + .+.+.+.+|+..|
T Consensus        14 ~~Cp~CGN~~vGngEG~liV~edtfkRtC   42 (49)
T PF12677_consen   14 CKCPKCGNDKVGNGEGTLIVEEDTFKRTC   42 (49)
T ss_pred             ccCcccCCcEeecCcceEEEeccceeeee
Confidence            478889887643  2 5688888998876


No 82 
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=46.16  E-value=7  Score=19.91  Aligned_cols=20  Identities=20%  Similarity=0.280  Sum_probs=12.8

Q ss_pred             cccCCCcCCCCceeeeCCeeeecc
Q psy17880         91 CARCRFSKKREIYNWLGGRAYENR  114 (120)
Q Consensus        91 C~~C~~~l~~~~~~~~~g~~yC~~  114 (120)
                      |..|.+++..    ..++.+||..
T Consensus         9 C~~Cdk~~~~----~~~~~lYCSe   28 (43)
T PF12855_consen    9 CIVCDKQIDP----PDDGSLYCSE   28 (43)
T ss_pred             HHHhhccccC----CCCCccccCH
Confidence            5666667644    3577788764


No 83 
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=45.92  E-value=18  Score=18.48  Aligned_cols=30  Identities=27%  Similarity=0.454  Sum_probs=16.6

Q ss_pred             cccccccccCCCCee-e-cCCeeccHhHHHhH
Q psy17880         31 QCSVCKNSLAQGGYF-N-KDGAYYCTSDYQKK   60 (120)
Q Consensus        31 ~C~~C~~~l~~~~~~-~-~~~~~~C~~c~~~~   60 (120)
                      .|..|+..+..-.|. . ..+..+|..||.+.
T Consensus         2 ~C~~Cg~D~t~vryh~~~~~~~dLC~~CF~~G   33 (45)
T cd02336           2 HCFTCGNDCTRVRYHNLKAKKYDLCPSCYQEG   33 (45)
T ss_pred             cccCCCCccCceEEEecCCCccccChHHHhCc
Confidence            456666666532222 1 12355888888763


No 84 
>PRK00807 50S ribosomal protein L24e; Validated
Probab=45.40  E-value=21  Score=18.85  Aligned_cols=9  Identities=33%  Similarity=1.103  Sum_probs=4.5

Q ss_pred             CCCCCCCcc
Q psy17880         64 KCAQCGEYV   72 (120)
Q Consensus        64 ~C~~C~~~i   72 (120)
                      .|+.|+..|
T Consensus         3 ~C~fcG~~I   11 (52)
T PRK00807          3 TCSFCGKEI   11 (52)
T ss_pred             ccCCCCCeE
Confidence            345555555


No 85 
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=45.35  E-value=24  Score=20.42  Aligned_cols=24  Identities=29%  Similarity=0.501  Sum_probs=9.2

Q ss_pred             CeeccHhHHHh--HhC-CCCCCCCCcc
Q psy17880         49 GAYYCTSDYQK--KFG-TKCAQCGEYV   72 (120)
Q Consensus        49 ~~~~C~~c~~~--~~~-~~C~~C~~~i   72 (120)
                      +-+.|..||+-  +-+ ..|..|+.+-
T Consensus        35 ~fPvCr~CyEYErkeg~q~CpqCkt~y   61 (80)
T PF14569_consen   35 AFPVCRPCYEYERKEGNQVCPQCKTRY   61 (80)
T ss_dssp             -----HHHHHHHHHTS-SB-TTT--B-
T ss_pred             CCccchhHHHHHhhcCcccccccCCCc
Confidence            34568888852  222 5677777543


No 86 
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=45.02  E-value=28  Score=16.65  Aligned_cols=30  Identities=17%  Similarity=0.434  Sum_probs=17.1

Q ss_pred             ccccccccCCCCeeecCCeeccHhHHHhHh
Q psy17880         32 CSVCKNSLAQGGYFNKDGAYYCTSDYQKKF   61 (120)
Q Consensus        32 C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~   61 (120)
                      |..|...+........=+..+|..|..+..
T Consensus         1 C~iC~~~~~~~~~~~~C~H~fC~~C~~~~~   30 (41)
T PF00097_consen    1 CPICLEPFEDPVILLPCGHSFCRDCLRKWL   30 (41)
T ss_dssp             ETTTSSBCSSEEEETTTSEEEEHHHHHHHH
T ss_pred             CCcCCccccCCCEEecCCCcchHHHHHHHH
Confidence            345555554433344556778888776654


No 87 
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=44.90  E-value=5.5  Score=19.31  Aligned_cols=30  Identities=23%  Similarity=0.628  Sum_probs=17.5

Q ss_pred             ccccccccccceEEECCccccccccccccccccc
Q psy17880          6 CTSCKKKCSGEVLRVQDKYFHITCFQCSVCKNSL   39 (120)
Q Consensus         6 C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l   39 (120)
                      |..|.+.+.    ...++.||..=..|..||-.+
T Consensus         2 C~~C~~Ey~----~p~~RR~~~~~isC~~CGPr~   31 (35)
T PF07503_consen    2 CDDCLKEYF----DPSNRRFHYQFISCTNCGPRY   31 (35)
T ss_dssp             -HHHHHHHC----STTSTTTT-TT--BTTCC-SC
T ss_pred             CHHHHHHHc----CCCCCcccCcCccCCCCCCCE
Confidence            555666543    235788999999999998765


No 88 
>PHA02929 N1R/p28-like protein; Provisional
Probab=44.84  E-value=12  Score=26.41  Aligned_cols=37  Identities=27%  Similarity=0.607  Sum_probs=24.9

Q ss_pred             CCCCCCCCcccCc--------EEEEeCcccccccc--------ccccCCCcCC
Q psy17880         63 TKCAQCGEYVEGE--------VVTALGKTYHQKCF--------TCARCRFSKK   99 (120)
Q Consensus        63 ~~C~~C~~~i~~~--------~~~~~~~~~H~~Cf--------~C~~C~~~l~   99 (120)
                      ..|+.|...+.+.        ++..-++.||.+|+        .|..|..++.
T Consensus       175 ~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~Wl~~~~tCPlCR~~~~  227 (238)
T PHA02929        175 KECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKKEKNTCPVCRTPFI  227 (238)
T ss_pred             CCCccCCcccccCccccccceecCCCCCcccHHHHHHHHhcCCCCCCCCCEee
Confidence            5688888876431        22345777888887        5888877664


No 89 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=44.68  E-value=7.6  Score=16.16  Aligned_cols=13  Identities=23%  Similarity=0.559  Sum_probs=9.2

Q ss_pred             cccccCCCcCCCC
Q psy17880         89 FTCARCRFSKKRE  101 (120)
Q Consensus        89 f~C~~C~~~l~~~  101 (120)
                      |.|..|++.+...
T Consensus         1 y~C~~C~~~f~~~   13 (23)
T PF00096_consen    1 YKCPICGKSFSSK   13 (23)
T ss_dssp             EEETTTTEEESSH
T ss_pred             CCCCCCCCccCCH
Confidence            5678888877554


No 90 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=44.08  E-value=11  Score=19.06  Aligned_cols=27  Identities=33%  Similarity=0.704  Sum_probs=14.6

Q ss_pred             CCCCCCCcccCcEEEEeCccccccccccccCCCcC
Q psy17880         64 KCAQCGEYVEGEVVTALGKTYHQKCFTCARCRFSK   98 (120)
Q Consensus        64 ~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l   98 (120)
                      +|..|+..+.-+     ...   .-++|..|+.++
T Consensus         5 ~C~~CG~~~~~~-----~~~---~~~~Cp~CG~~~   31 (46)
T PRK00398          5 KCARCGREVELD-----EYG---TGVRCPYCGYRI   31 (46)
T ss_pred             ECCCCCCEEEEC-----CCC---CceECCCCCCeE
Confidence            577777766311     110   025677777655


No 91 
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=42.52  E-value=12  Score=16.99  Aligned_cols=24  Identities=29%  Similarity=0.569  Sum_probs=11.2

Q ss_pred             CCCCCcccCcEEEEeCcccccccc
Q psy17880         66 AQCGEYVEGEVVTALGKTYHQKCF   89 (120)
Q Consensus        66 ~~C~~~i~~~~~~~~~~~~H~~Cf   89 (120)
                      ..|........+..-+..||.+|+
T Consensus         2 ~iC~~~~~~~~~~~C~H~~c~~C~   25 (39)
T smart00184        2 PICLEELKDPVVLPCGHTFCRSCI   25 (39)
T ss_pred             CcCccCCCCcEEecCCChHHHHHH
Confidence            344444333344445555655554


No 92 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=42.30  E-value=9.8  Score=18.42  Aligned_cols=9  Identities=33%  Similarity=1.176  Sum_probs=5.0

Q ss_pred             CCCCCCCcc
Q psy17880         64 KCAQCGEYV   72 (120)
Q Consensus        64 ~C~~C~~~i   72 (120)
                      +|..|+...
T Consensus         7 ~C~~Cg~~f   15 (41)
T smart00834        7 RCEDCGHTF   15 (41)
T ss_pred             EcCCCCCEE
Confidence            456666544


No 93 
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=41.43  E-value=14  Score=21.65  Aligned_cols=30  Identities=37%  Similarity=0.769  Sum_probs=18.4

Q ss_pred             CCCCCCCccc-Cc--EEEEeCccccccccccccCCC
Q psy17880         64 KCAQCGEYVE-GE--VVTALGKTYHQKCFTCARCRF   96 (120)
Q Consensus        64 ~C~~C~~~i~-~~--~~~~~~~~~H~~Cf~C~~C~~   96 (120)
                      .|.+|+++|+ +.  .+.+.|..   .=|.|..|..
T Consensus         2 ~C~HCg~~~p~~~~~~~~~~g~~---~~FCC~GC~~   34 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKITVEIDGEE---RPFCCPGCQA   34 (88)
T ss_pred             CCCCCCCCCCCCCCeeeeeCCCc---cccccHHHHH
Confidence            5889999995 32  33445543   2266777754


No 94 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=41.30  E-value=12  Score=18.04  Aligned_cols=10  Identities=20%  Similarity=0.796  Sum_probs=2.7

Q ss_pred             ccccccccCC
Q psy17880         32 CSVCKNSLAQ   41 (120)
Q Consensus        32 C~~C~~~l~~   41 (120)
                      |..|++++..
T Consensus         6 C~eC~~~f~d   15 (34)
T PF01286_consen    6 CDECGKPFMD   15 (34)
T ss_dssp             -TTT--EES-
T ss_pred             HhHhCCHHHH
Confidence            3444444443


No 95 
>KOG0978|consensus
Probab=41.09  E-value=5.4  Score=32.34  Aligned_cols=43  Identities=21%  Similarity=0.544  Sum_probs=30.8

Q ss_pred             CCCCCCCCcccCcEEEEeCcccccccc---------ccccCCCcCCCCceee
Q psy17880         63 TKCAQCGEYVEGEVVTALGKTYHQKCF---------TCARCRFSKKREIYNW  105 (120)
Q Consensus        63 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf---------~C~~C~~~l~~~~~~~  105 (120)
                      .+|+.|+....+.+|+--++.|..+|.         +|..|+.+|+..++..
T Consensus       644 LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFganDv~~  695 (698)
T KOG0978|consen  644 LKCSVCNTRWKDAVITKCGHVFCEECVQTRYETRQRKCPKCNAAFGANDVHR  695 (698)
T ss_pred             eeCCCccCchhhHHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCCcccccc
Confidence            589999866666666655555555555         6999999998877653


No 96 
>PRK11595 DNA utilization protein GntX; Provisional
Probab=38.63  E-value=30  Score=23.87  Aligned_cols=21  Identities=29%  Similarity=0.436  Sum_probs=12.5

Q ss_pred             ccHhHHHhHh--CCCCCCCCCcc
Q psy17880         52 YCTSDYQKKF--GTKCAQCGEYV   72 (120)
Q Consensus        52 ~C~~c~~~~~--~~~C~~C~~~i   72 (120)
                      +|..|.....  .+.|..|++++
T Consensus        22 lC~~C~~~l~~~~~~C~~Cg~~~   44 (227)
T PRK11595         22 ICSVCSRALRTLKTCCPQCGLPA   44 (227)
T ss_pred             ccHHHHhhCCcccCcCccCCCcC
Confidence            5666665432  25677777664


No 97 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=37.51  E-value=14  Score=15.02  Aligned_cols=12  Identities=33%  Similarity=0.694  Sum_probs=6.5

Q ss_pred             cccccCCCcCCC
Q psy17880         89 FTCARCRFSKKR  100 (120)
Q Consensus        89 f~C~~C~~~l~~  100 (120)
                      |.|..|+..+..
T Consensus         1 ~~C~~C~~~~~~   12 (24)
T PF13894_consen    1 FQCPICGKSFRS   12 (24)
T ss_dssp             EE-SSTS-EESS
T ss_pred             CCCcCCCCcCCc
Confidence            467778776654


No 98 
>KOG2114|consensus
Probab=37.06  E-value=18  Score=30.11  Aligned_cols=33  Identities=33%  Similarity=0.837  Sum_probs=22.8

Q ss_pred             CCCCCCCcccCcEEE-EeCccccccccc-----cccCCC
Q psy17880         64 KCAQCGEYVEGEVVT-ALGKTYHQKCFT-----CARCRF   96 (120)
Q Consensus        64 ~C~~C~~~i~~~~~~-~~~~~~H~~Cf~-----C~~C~~   96 (120)
                      +|..|..++.-..|. .-+..||..||.     |..|..
T Consensus       842 kCs~C~~~LdlP~VhF~CgHsyHqhC~e~~~~~CP~C~~  880 (933)
T KOG2114|consen  842 KCSACEGTLDLPFVHFLCGHSYHQHCLEDKEDKCPKCLP  880 (933)
T ss_pred             eecccCCccccceeeeecccHHHHHhhccCcccCCccch
Confidence            688888777655554 347778888875     767654


No 99 
>COG4393 Predicted membrane protein [Function unknown]
Probab=37.02  E-value=21  Score=26.62  Aligned_cols=26  Identities=23%  Similarity=0.326  Sum_probs=21.2

Q ss_pred             cccCCCcCCCCceeeeCCeeeeccCCCcCC
Q psy17880         91 CARCRFSKKREIYNWLGGRAYENRLGGRAY  120 (120)
Q Consensus        91 C~~C~~~l~~~~~~~~~g~~yC~~~~~~~~  120 (120)
                      |..|+.    .+|.++|+++.|.+|+.|+|
T Consensus       337 C~iCGd----~GYv~e~dqvICv~C~Vrmf  362 (405)
T COG4393         337 CDICGD----QGYVMEGDQVICVRCDVRMF  362 (405)
T ss_pred             HHhccc----cceEeECCEEEEEEccEEEE
Confidence            555643    47999999999999999875


No 100
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=36.89  E-value=29  Score=17.19  Aligned_cols=12  Identities=17%  Similarity=0.697  Sum_probs=6.3

Q ss_pred             cccccCCCcCCC
Q psy17880         89 FTCARCRFSKKR  100 (120)
Q Consensus        89 f~C~~C~~~l~~  100 (120)
                      +.|..|+..|..
T Consensus        20 ~vC~~CG~Vl~e   31 (43)
T PF08271_consen   20 LVCPNCGLVLEE   31 (43)
T ss_dssp             EEETTT-BBEE-
T ss_pred             EECCCCCCEeec
Confidence            456777666643


No 101
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=36.77  E-value=20  Score=16.27  Aligned_cols=11  Identities=18%  Similarity=0.468  Sum_probs=2.2

Q ss_pred             ccccCCCcCCC
Q psy17880         90 TCARCRFSKKR  100 (120)
Q Consensus        90 ~C~~C~~~l~~  100 (120)
                      .|..|++++.+
T Consensus         2 ~C~~C~~~~~~   12 (30)
T PF07649_consen    2 RCDACGKPIDG   12 (30)
T ss_dssp             --TTTS----S
T ss_pred             cCCcCCCcCCC
Confidence            34444444433


No 102
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=36.48  E-value=14  Score=19.00  Aligned_cols=10  Identities=40%  Similarity=1.165  Sum_probs=5.9

Q ss_pred             CCCCCCCccc
Q psy17880         64 KCAQCGEYVE   73 (120)
Q Consensus        64 ~C~~C~~~i~   73 (120)
                      +|..|+...+
T Consensus         7 ~C~~Cg~~fe   16 (52)
T TIGR02605         7 RCTACGHRFE   16 (52)
T ss_pred             EeCCCCCEeE
Confidence            5666765443


No 103
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=36.07  E-value=76  Score=22.46  Aligned_cols=55  Identities=15%  Similarity=0.342  Sum_probs=41.0

Q ss_pred             ccccccccccccccCCC-Cee--ecCCeeccHhHHHhHh-CCCCCCCCCcccC-cEEEEe
Q psy17880         26 HITCFQCSVCKNSLAQG-GYF--NKDGAYYCTSDYQKKF-GTKCAQCGEYVEG-EVVTAL   80 (120)
Q Consensus        26 H~~Cf~C~~C~~~l~~~-~~~--~~~~~~~C~~c~~~~~-~~~C~~C~~~i~~-~~~~~~   80 (120)
                      ...-|.|..-+..+.+. .|.  ..-|.++.+....+.- ...|..|+++... ++|...
T Consensus       110 ~~~~~~CPvt~~~~~~~~~fv~l~~cG~V~s~~alke~k~~~~Cp~c~~~f~~~DiI~Ln  169 (260)
T PF04641_consen  110 SEGRFICPVTGKEFNGKHKFVYLRPCGCVFSEKALKELKKSKKCPVCGKPFTEEDIIPLN  169 (260)
T ss_pred             CCceeECCCCCcccCCceeEEEEcCCCCEeeHHHHHhhcccccccccCCccccCCEEEec
Confidence            45678999999999665 333  4578999999888876 5689999999854 465544


No 104
>PHA02610 uvsY.-2 hypothetical protein; Provisional
Probab=36.04  E-value=29  Score=18.38  Aligned_cols=13  Identities=23%  Similarity=0.590  Sum_probs=9.3

Q ss_pred             ccccccccccccc
Q psy17880          4 AYCTSCKKKCSGE   16 (120)
Q Consensus         4 ~~C~~C~~~i~~~   16 (120)
                      .+|..|++||.+.
T Consensus         2 ~iCvvCK~Pi~~a   14 (53)
T PHA02610          2 KICVVCKQPIEKA   14 (53)
T ss_pred             ceeeeeCCchhhc
Confidence            4678888888544


No 105
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=35.78  E-value=8.4  Score=18.44  Aligned_cols=16  Identities=13%  Similarity=0.412  Sum_probs=10.5

Q ss_pred             cccccCCCcCCCCcee
Q psy17880         89 FTCARCRFSKKREIYN  104 (120)
Q Consensus        89 f~C~~C~~~l~~~~~~  104 (120)
                      |.|..|++++....|.
T Consensus         5 ~~C~nC~R~v~a~RfA   20 (33)
T PF08209_consen    5 VECPNCGRPVAASRFA   20 (33)
T ss_dssp             EE-TTTSSEEEGGGHH
T ss_pred             EECCCCcCCcchhhhH
Confidence            5678888887766554


No 106
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=35.28  E-value=59  Score=23.93  Aligned_cols=26  Identities=23%  Similarity=0.430  Sum_probs=18.7

Q ss_pred             CCeeccHhHHHhHhC---CCCCCCCCccc
Q psy17880         48 DGAYYCTSDYQKKFG---TKCAQCGEYVE   73 (120)
Q Consensus        48 ~~~~~C~~c~~~~~~---~~C~~C~~~i~   73 (120)
                      =|..+|..|....+.   ..|..|++++.
T Consensus        26 CGH~~C~sCv~~l~~~~~~~CP~C~~~lr   54 (309)
T TIGR00570        26 CGHTLCESCVDLLFVRGSGSCPECDTPLR   54 (309)
T ss_pred             CCCcccHHHHHHHhcCCCCCCCCCCCccc
Confidence            466778888877653   46888888774


No 107
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=35.04  E-value=17  Score=15.90  Aligned_cols=14  Identities=29%  Similarity=0.456  Sum_probs=10.1

Q ss_pred             cccccCCCcCCCCc
Q psy17880         89 FTCARCRFSKKREI  102 (120)
Q Consensus        89 f~C~~C~~~l~~~~  102 (120)
                      |.|..|++.+.+..
T Consensus         2 ~~C~~C~k~f~~~~   15 (27)
T PF12171_consen    2 FYCDACDKYFSSEN   15 (27)
T ss_dssp             CBBTTTTBBBSSHH
T ss_pred             CCcccCCCCcCCHH
Confidence            56888888876653


No 108
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger present in plant ubiquitin-associated (UBA) proteins. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=34.97  E-value=38  Score=17.25  Aligned_cols=8  Identities=25%  Similarity=0.708  Sum_probs=5.0

Q ss_pred             ccHhHHHh
Q psy17880         52 YCTSDYQK   59 (120)
Q Consensus        52 ~C~~c~~~   59 (120)
                      +|+.||.+
T Consensus        26 LC~~C~~~   33 (43)
T cd02342          26 LCTICFSR   33 (43)
T ss_pred             cHHHHhhh
Confidence            56666654


No 109
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=34.96  E-value=47  Score=16.94  Aligned_cols=12  Identities=33%  Similarity=0.672  Sum_probs=7.4

Q ss_pred             Cccccccccccc
Q psy17880          3 KAYCTSCKKKCS   14 (120)
Q Consensus         3 ~~~C~~C~~~i~   14 (120)
                      ...|..|++.|.
T Consensus        11 ~~~C~~C~~~i~   22 (53)
T PF00130_consen   11 PTYCDVCGKFIW   22 (53)
T ss_dssp             TEB-TTSSSBEC
T ss_pred             CCCCcccCcccC
Confidence            456777877773


No 110
>KOG4739|consensus
Probab=34.33  E-value=24  Score=24.78  Aligned_cols=33  Identities=12%  Similarity=0.328  Sum_probs=25.4

Q ss_pred             CCee-ecCCeeccHhHHHhHhCCCCCCCCCcccC
Q psy17880         42 GGYF-NKDGAYYCTSDYQKKFGTKCAQCGEYVEG   74 (120)
Q Consensus        42 ~~~~-~~~~~~~C~~c~~~~~~~~C~~C~~~i~~   74 (120)
                      ..|+ .-=..++|..|.....++.|..|+++|..
T Consensus        16 ~~f~LTaC~HvfC~~C~k~~~~~~C~lCkk~ir~   49 (233)
T KOG4739|consen   16 DPFFLTACRHVFCEPCLKASSPDVCPLCKKSIRI   49 (233)
T ss_pred             CceeeeechhhhhhhhcccCCccccccccceeee
Confidence            3455 45578899999888777799999999743


No 111
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=33.98  E-value=61  Score=20.44  Aligned_cols=32  Identities=25%  Similarity=0.672  Sum_probs=20.3

Q ss_pred             HHhHhCCCCCCCCCcccCcEEEEeCcccccccccc
Q psy17880         57 YQKKFGTKCAQCGEYVEGEVVTALGKTYHQKCFTC   91 (120)
Q Consensus        57 ~~~~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C   91 (120)
                      |.+.| ..|..|+.|  +..+...++.|-..|-.|
T Consensus        89 fI~~y-VlC~~C~sp--dT~l~k~~r~~~l~C~aC  120 (125)
T PF01873_consen   89 FIKEY-VLCPECGSP--DTELIKEGRLIFLKCKAC  120 (125)
T ss_dssp             HHCHH-SSCTSTSSS--SEEEEEETTCCEEEETTT
T ss_pred             HHHHE-EEcCCCCCC--ccEEEEcCCEEEEEeccc
Confidence            44444 689999876  345555578777655444


No 112
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=33.92  E-value=47  Score=14.64  Aligned_cols=9  Identities=33%  Similarity=1.139  Sum_probs=4.2

Q ss_pred             CCCCCCccc
Q psy17880         65 CAQCGEYVE   73 (120)
Q Consensus        65 C~~C~~~i~   73 (120)
                      |.+|+.+|.
T Consensus         1 C~sC~~~i~    9 (24)
T PF07754_consen    1 CTSCGRPIA    9 (24)
T ss_pred             CccCCCccc
Confidence            344555553


No 113
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=33.45  E-value=15  Score=15.60  Aligned_cols=13  Identities=38%  Similarity=0.636  Sum_probs=9.3

Q ss_pred             cccccCCCcCCCC
Q psy17880         89 FTCARCRFSKKRE  101 (120)
Q Consensus        89 f~C~~C~~~l~~~  101 (120)
                      |.|..|++.+.+.
T Consensus         1 ~~C~~C~~~f~s~   13 (25)
T PF12874_consen    1 FYCDICNKSFSSE   13 (25)
T ss_dssp             EEETTTTEEESSH
T ss_pred             CCCCCCCCCcCCH
Confidence            5688888877654


No 114
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=33.38  E-value=15  Score=22.29  Aligned_cols=30  Identities=27%  Similarity=0.329  Sum_probs=18.0

Q ss_pred             cccccccccccccCCC-CeeecCCeeccHhH
Q psy17880         27 ITCFQCSVCKNSLAQG-GYFNKDGAYYCTSD   56 (120)
Q Consensus        27 ~~Cf~C~~C~~~l~~~-~~~~~~~~~~C~~c   56 (120)
                      .+=|+|+.|-..--.+ .-...+|+++|.+|
T Consensus        68 ~DEFTCssCFLV~HRSqLa~~~~g~~iC~DC   98 (99)
T PF13834_consen   68 ADEFTCSSCFLVHHRSQLAREKDGQPICRDC   98 (99)
T ss_pred             CCceeeeeeeeEechhhhccccCCCEecccc
Confidence            4568888884433222 22356788888776


No 115
>KOG2462|consensus
Probab=33.21  E-value=17  Score=26.18  Aligned_cols=16  Identities=19%  Similarity=0.567  Sum_probs=11.7

Q ss_pred             cccccccccccccCCC
Q psy17880         27 ITCFQCSVCKNSLAQG   42 (120)
Q Consensus        27 ~~Cf~C~~C~~~l~~~   42 (120)
                      ...++|..|++.....
T Consensus       128 ~~r~~c~eCgk~ysT~  143 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTS  143 (279)
T ss_pred             CCceeccccccccccc
Confidence            3467888898888654


No 116
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=32.90  E-value=26  Score=24.21  Aligned_cols=28  Identities=21%  Similarity=0.285  Sum_probs=17.8

Q ss_pred             cccccCCCcCCCCceeeeCCeeeeccCC
Q psy17880         89 FTCARCRFSKKREIYNWLGGRAYENRLG  116 (120)
Q Consensus        89 f~C~~C~~~l~~~~~~~~~g~~yC~~~~  116 (120)
                      ..|..|++++....|...+|...|..+.
T Consensus       150 ~~C~~Cg~~~~~~~f~~~~gg~~c~~c~  177 (247)
T PRK00085        150 DHCAVCGAPGDHRYFSPKEGGAVCSECG  177 (247)
T ss_pred             hhHhcCCCCCCceEEecccCCccccccc
Confidence            3567777776644555667777776653


No 117
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=32.82  E-value=42  Score=16.91  Aligned_cols=27  Identities=22%  Similarity=0.894  Sum_probs=14.8

Q ss_pred             cccccccccc-cceEEEC--Cccccccccc
Q psy17880          5 YCTSCKKKCS-GEVLRVQ--DKYFHITCFQ   31 (120)
Q Consensus         5 ~C~~C~~~i~-~~~~~~~--~~~~H~~Cf~   31 (120)
                      +|..|++.-. +..|.-.  +..||..|..
T Consensus         1 ~C~vC~~~~~~~~~i~C~~C~~~~H~~C~~   30 (51)
T PF00628_consen    1 YCPVCGQSDDDGDMIQCDSCNRWYHQECVG   30 (51)
T ss_dssp             EBTTTTSSCTTSSEEEBSTTSCEEETTTST
T ss_pred             eCcCCCCcCCCCCeEEcCCCChhhCcccCC
Confidence            3666777333 3344433  5667877743


No 118
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=32.34  E-value=21  Score=18.88  Aligned_cols=9  Identities=22%  Similarity=0.608  Sum_probs=4.0

Q ss_pred             CCCCCCccc
Q psy17880         65 CAQCGEYVE   73 (120)
Q Consensus        65 C~~C~~~i~   73 (120)
                      |.+|.+++.
T Consensus         2 CfgC~~~~~   10 (51)
T PF07975_consen    2 CFGCQKPFP   10 (51)
T ss_dssp             ETTTTEE-T
T ss_pred             CccCCCCCC
Confidence            445555553


No 119
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=32.03  E-value=24  Score=25.17  Aligned_cols=12  Identities=42%  Similarity=1.107  Sum_probs=8.6

Q ss_pred             CCCCCCCCCccc
Q psy17880         62 GTKCAQCGEYVE   73 (120)
Q Consensus        62 ~~~C~~C~~~i~   73 (120)
                      +..|..|+.+|.
T Consensus       245 g~pC~~Cg~~I~  256 (274)
T PRK01103        245 GEPCRRCGTPIE  256 (274)
T ss_pred             CCCCCCCCCeeE
Confidence            456888887774


No 120
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=31.91  E-value=16  Score=15.81  Aligned_cols=13  Identities=23%  Similarity=0.539  Sum_probs=9.4

Q ss_pred             cccccCCCcCCCC
Q psy17880         89 FTCARCRFSKKRE  101 (120)
Q Consensus        89 f~C~~C~~~l~~~  101 (120)
                      |.|..|++.+...
T Consensus         2 ~~C~~C~~~F~~~   14 (27)
T PF13912_consen    2 FECDECGKTFSSL   14 (27)
T ss_dssp             EEETTTTEEESSH
T ss_pred             CCCCccCCccCCh
Confidence            5688888877654


No 121
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=31.86  E-value=24  Score=25.18  Aligned_cols=13  Identities=23%  Similarity=0.682  Sum_probs=9.8

Q ss_pred             CCCCCCCCCcccC
Q psy17880         62 GTKCAQCGEYVEG   74 (120)
Q Consensus        62 ~~~C~~C~~~i~~   74 (120)
                      +..|..|+.+|..
T Consensus       244 g~pCprCG~~I~~  256 (272)
T PRK14810        244 GEPCLNCKTPIRR  256 (272)
T ss_pred             CCcCCCCCCeeEE
Confidence            4678889888853


No 122
>PRK14873 primosome assembly protein PriA; Provisional
Probab=31.05  E-value=24  Score=28.64  Aligned_cols=37  Identities=22%  Similarity=0.461  Sum_probs=23.3

Q ss_pred             ccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCc
Q psy17880         32 CSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEY   71 (120)
Q Consensus        32 C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~   71 (120)
                      |..|+.+|.   +...++.+.|..|-.......|..|+..
T Consensus       395 C~~C~~~L~---~h~~~~~l~Ch~CG~~~~p~~Cp~Cgs~  431 (665)
T PRK14873        395 CRHCTGPLG---LPSAGGTPRCRWCGRAAPDWRCPRCGSD  431 (665)
T ss_pred             CCCCCCcee---EecCCCeeECCCCcCCCcCccCCCCcCC
Confidence            334444442   3334567788888665556789999875


No 123
>PRK10445 endonuclease VIII; Provisional
Probab=30.79  E-value=27  Score=24.84  Aligned_cols=12  Identities=42%  Similarity=1.176  Sum_probs=8.7

Q ss_pred             CCCCCCCCCccc
Q psy17880         62 GTKCAQCGEYVE   73 (120)
Q Consensus        62 ~~~C~~C~~~i~   73 (120)
                      +..|..|+.+|.
T Consensus       235 g~~Cp~Cg~~I~  246 (263)
T PRK10445        235 GEACERCGGIIE  246 (263)
T ss_pred             CCCCCCCCCEeE
Confidence            467888887774


No 124
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=30.46  E-value=87  Score=22.25  Aligned_cols=48  Identities=25%  Similarity=0.589  Sum_probs=26.4

Q ss_pred             ceEEECCcccccccccccccccccCCCCee--ecCCeeccHhHHHhHhCCCCCCCCC-cccCcEE
Q psy17880         16 EVLRVQDKYFHITCFQCSVCKNSLAQGGYF--NKDGAYYCTSDYQKKFGTKCAQCGE-YVEGEVV   77 (120)
Q Consensus        16 ~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~--~~~~~~~C~~c~~~~~~~~C~~C~~-~i~~~~~   77 (120)
                      .++.+-|..++..   |..|+.........  ..++           ..|+|..|+. .|..++|
T Consensus       112 ~Vi~lHGsl~~~~---C~~C~~~~~~~~~~~~~~~~-----------~~p~C~~Cg~~~lrP~VV  162 (250)
T COG0846         112 NVIELHGSLKRVR---CSKCGNQYYDEDVIKFIEDG-----------LIPRCPKCGGPVLRPDVV  162 (250)
T ss_pred             cEEEeccceeeeE---eCCCcCccchhhhhhhcccC-----------CCCcCccCCCccccCCEE
Confidence            4666667777754   45676655432211  1111           2378999988 4544443


No 125
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=30.43  E-value=51  Score=16.90  Aligned_cols=8  Identities=13%  Similarity=0.505  Sum_probs=4.9

Q ss_pred             ccHhHHHh
Q psy17880         52 YCTSDYQK   59 (120)
Q Consensus        52 ~C~~c~~~   59 (120)
                      +|.+||..
T Consensus        26 LC~~Cf~~   33 (49)
T cd02335          26 LCLECFSA   33 (49)
T ss_pred             hhHHhhhC
Confidence            56666654


No 126
>KOG2932|consensus
Probab=30.37  E-value=27  Score=25.81  Aligned_cols=42  Identities=19%  Similarity=0.369  Sum_probs=21.2

Q ss_pred             cccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCcc
Q psy17880         31 QCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYV   72 (120)
Q Consensus        31 ~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i   72 (120)
                      -|..|+.+|..=.-.+--+.++|.+|-...-...|..|..+|
T Consensus        92 fCd~Cd~PI~IYGRmIPCkHvFCl~CAr~~~dK~Cp~C~d~V  133 (389)
T KOG2932|consen   92 FCDRCDFPIAIYGRMIPCKHVFCLECARSDSDKICPLCDDRV  133 (389)
T ss_pred             eecccCCcceeeecccccchhhhhhhhhcCccccCcCcccHH
Confidence            355666665321111223455666665544345677776665


No 127
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg). All proteins in the FPG family with known functions are FAPY-DNA glycosylases that function in base excision repair. Homologous to endonuclease VIII (nei). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=30.28  E-value=27  Score=24.90  Aligned_cols=26  Identities=27%  Similarity=0.597  Sum_probs=14.1

Q ss_pred             CCCCCCCCCcccCcEEEEeCcccccc
Q psy17880         62 GTKCAQCGEYVEGEVVTALGKTYHQK   87 (120)
Q Consensus        62 ~~~C~~C~~~i~~~~~~~~~~~~H~~   87 (120)
                      +..|..|+.+|.-..+.-.+..|.+.
T Consensus       245 g~pC~~Cg~~I~~~~~~gR~t~~CP~  270 (272)
T TIGR00577       245 GEPCRRCGTPIEKIKVGGRGTHFCPQ  270 (272)
T ss_pred             CCCCCCCCCeeEEEEECCCCCEECCC
Confidence            45788888888543333233334433


No 128
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=29.84  E-value=21  Score=18.73  Aligned_cols=9  Identities=44%  Similarity=0.907  Sum_probs=4.2

Q ss_pred             ccccCCCcC
Q psy17880         90 TCARCRFSK   98 (120)
Q Consensus        90 ~C~~C~~~l   98 (120)
                      +|+.|++.+
T Consensus         8 ~C~~Cg~~~   16 (49)
T COG1996           8 KCARCGREV   16 (49)
T ss_pred             EhhhcCCee
Confidence            344444444


No 129
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=29.79  E-value=27  Score=24.90  Aligned_cols=13  Identities=38%  Similarity=1.020  Sum_probs=10.2

Q ss_pred             CCCCCCCCCcccC
Q psy17880         62 GTKCAQCGEYVEG   74 (120)
Q Consensus        62 ~~~C~~C~~~i~~   74 (120)
                      +..|..|+.+|.-
T Consensus       235 g~pC~~Cg~~I~~  247 (269)
T PRK14811        235 GQPCPRCGTPIEK  247 (269)
T ss_pred             cCCCCcCCCeeEE
Confidence            4679999998853


No 130
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=29.42  E-value=14  Score=17.77  Aligned_cols=10  Identities=20%  Similarity=0.810  Sum_probs=3.2

Q ss_pred             cccccccccc
Q psy17880          5 YCTSCKKKCS   14 (120)
Q Consensus         5 ~C~~C~~~i~   14 (120)
                      .|..|+.++.
T Consensus         2 fC~~CG~~l~   11 (34)
T PF14803_consen    2 FCPQCGGPLE   11 (34)
T ss_dssp             B-TTT--B-E
T ss_pred             ccccccChhh
Confidence            4556666543


No 131
>PHA00080 DksA-like zinc finger domain containing protein
Probab=29.29  E-value=21  Score=20.22  Aligned_cols=28  Identities=18%  Similarity=0.403  Sum_probs=17.8

Q ss_pred             cccccccccCCCCeeecCCeeccHhHHH
Q psy17880         31 QCSVCKNSLAQGGYFNKDGAYYCTSDYQ   58 (120)
Q Consensus        31 ~C~~C~~~l~~~~~~~~~~~~~C~~c~~   58 (120)
                      .|..|+.+|+........+-.+|..|..
T Consensus        33 ~C~~Cg~~Ip~~Rl~a~P~~~~Cv~Cq~   60 (72)
T PHA00080         33 HCEECGDPIPEARREAVPGCRTCVSCQE   60 (72)
T ss_pred             EecCCCCcCcHHHHHhCCCccCcHHHHH
Confidence            5777788776654444555666766654


No 132
>PF11331 DUF3133:  Protein of unknown function (DUF3133);  InterPro: IPR021480  This eukaryotic family of proteins has no known function. 
Probab=29.25  E-value=38  Score=17.48  Aligned_cols=6  Identities=50%  Similarity=1.514  Sum_probs=2.5

Q ss_pred             CCCCCC
Q psy17880         65 CAQCGE   70 (120)
Q Consensus        65 C~~C~~   70 (120)
                      |..|++
T Consensus        34 CGaCs~   39 (46)
T PF11331_consen   34 CGACSE   39 (46)
T ss_pred             CCCCce
Confidence            444443


No 133
>COG1381 RecO Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair]
Probab=29.05  E-value=32  Score=24.20  Aligned_cols=26  Identities=19%  Similarity=0.332  Sum_probs=16.4

Q ss_pred             ccccCCCcCCCCceeeeCCeeeeccC
Q psy17880         90 TCARCRFSKKREIYNWLGGRAYENRL  115 (120)
Q Consensus        90 ~C~~C~~~l~~~~~~~~~g~~yC~~~  115 (120)
                      .|+.|+++.+...++...|...|.++
T Consensus       156 ~Ca~cg~~~~~~~~s~~~~~~~C~~~  181 (251)
T COG1381         156 SCARCGTPVDPVYFSPKSGGFLCSKC  181 (251)
T ss_pred             HHhCcCCcCCCcceeeccCcccchhc
Confidence            46666666666666666666666554


No 134
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=28.80  E-value=18  Score=19.17  Aligned_cols=10  Identities=20%  Similarity=1.006  Sum_probs=7.5

Q ss_pred             CCCCCCCCcc
Q psy17880         63 TKCAQCGEYV   72 (120)
Q Consensus        63 ~~C~~C~~~i   72 (120)
                      .+|..|++.+
T Consensus         5 iRC~~CnklL   14 (51)
T PF10122_consen    5 IRCGHCNKLL   14 (51)
T ss_pred             eeccchhHHH
Confidence            4688888777


No 135
>PRK14891 50S ribosomal protein L24e/unknown domain fusion protein; Provisional
Probab=28.63  E-value=36  Score=21.68  Aligned_cols=23  Identities=30%  Similarity=0.511  Sum_probs=16.7

Q ss_pred             CCCCCCCCcc-cC---cEEEEeCcccc
Q psy17880         63 TKCAQCGEYV-EG---EVVTALGKTYH   85 (120)
Q Consensus        63 ~~C~~C~~~i-~~---~~~~~~~~~~H   85 (120)
                      ..|..|+.+| +|   .+|...|+.|+
T Consensus         5 e~CsFcG~kIyPG~G~~fVR~DGkvf~   31 (131)
T PRK14891          5 RTCDYTGEEIEPGTGTMFVRKDGTVLH   31 (131)
T ss_pred             eeecCcCCcccCCCCcEEEecCCCEEE
Confidence            4688999999 44   36667777776


No 136
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional
Probab=28.56  E-value=30  Score=24.86  Aligned_cols=13  Identities=38%  Similarity=1.002  Sum_probs=9.2

Q ss_pred             CCCCCCCCCcccC
Q psy17880         62 GTKCAQCGEYVEG   74 (120)
Q Consensus        62 ~~~C~~C~~~i~~   74 (120)
                      +..|..|+.+|.-
T Consensus       254 g~pC~~Cg~~I~~  266 (282)
T PRK13945        254 GKPCRKCGTPIER  266 (282)
T ss_pred             cCCCCcCCCeeEE
Confidence            4678888888753


No 137
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=28.31  E-value=24  Score=26.83  Aligned_cols=44  Identities=16%  Similarity=0.476  Sum_probs=29.1

Q ss_pred             cccccccccccCCCCeeecCCeeccHhHHHhHhC--CCCCCCCCccc
Q psy17880         29 CFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFG--TKCAQCGEYVE   73 (120)
Q Consensus        29 Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~--~~C~~C~~~i~   73 (120)
                      -+.|..|...+.. .....=+..||..|....+.  ..|..|..++.
T Consensus        26 ~l~C~IC~d~~~~-PvitpCgH~FCs~CI~~~l~~~~~CP~Cr~~~~   71 (397)
T TIGR00599        26 SLRCHICKDFFDV-PVLTSCSHTFCSLCIRRCLSNQPKCPLCRAEDQ   71 (397)
T ss_pred             ccCCCcCchhhhC-ccCCCCCCchhHHHHHHHHhCCCCCCCCCCccc
Confidence            4678888777754 33455577888888775443  35777777663


No 138
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=28.24  E-value=71  Score=15.20  Aligned_cols=28  Identities=18%  Similarity=0.242  Sum_probs=12.6

Q ss_pred             ccccccccCCCCeeecCCee-ccHhHHHh
Q psy17880         32 CSVCKNSLAQGGYFNKDGAY-YCTSDYQK   59 (120)
Q Consensus        32 C~~C~~~l~~~~~~~~~~~~-~C~~c~~~   59 (120)
                      |+.|+..-...-....++.. +|..|...
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~~   29 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGLY   29 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHHH
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHHH
Confidence            44555544332222335555 89888753


No 139
>smart00746 TRASH metallochaperone-like domain.
Probab=27.96  E-value=57  Score=14.08  Aligned_cols=9  Identities=33%  Similarity=0.995  Sum_probs=5.1

Q ss_pred             CCCCCCccc
Q psy17880         65 CAQCGEYVE   73 (120)
Q Consensus        65 C~~C~~~i~   73 (120)
                      |..|+..|.
T Consensus         1 c~~C~~~~~    9 (39)
T smart00746        1 CSFCGKDIY    9 (39)
T ss_pred             CCCCCCCcc
Confidence            455666663


No 140
>PRK13715 conjugal transfer protein TraR; Provisional
Probab=27.52  E-value=22  Score=20.22  Aligned_cols=29  Identities=17%  Similarity=0.388  Sum_probs=18.7

Q ss_pred             ccccccccccCCCCeeecCCeeccHhHHH
Q psy17880         30 FQCSVCKNSLAQGGYFNKDGAYYCTSDYQ   58 (120)
Q Consensus        30 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~   58 (120)
                      +-|..|+.+|+........+-.+|..|..
T Consensus        35 ~~C~~Cg~~Ip~~Rl~a~p~~~~Cv~Cq~   63 (73)
T PRK13715         35 YLCEACGNPIPEARRKIFPGVTLCVECQA   63 (73)
T ss_pred             ccHhhcCCcCCHHHHhcCCCcCCCHHHHH
Confidence            35777888887655555556666766654


No 141
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=27.15  E-value=54  Score=16.76  Aligned_cols=8  Identities=13%  Similarity=0.870  Sum_probs=5.1

Q ss_pred             ccHhHHHh
Q psy17880         52 YCTSDYQK   59 (120)
Q Consensus        52 ~C~~c~~~   59 (120)
                      +|+.||..
T Consensus        26 LC~~Cf~~   33 (45)
T cd02344          26 FCENCFKT   33 (45)
T ss_pred             chHHhhCC
Confidence            57777654


No 142
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=26.57  E-value=74  Score=18.87  Aligned_cols=37  Identities=24%  Similarity=0.584  Sum_probs=23.7

Q ss_pred             CCccccccccccccceEEECCcccccccccccccccccCCCCeee
Q psy17880          2 IKAYCTSCKKKCSGEVLRVQDKYFHITCFQCSVCKNSLAQGGYFN   46 (120)
Q Consensus         2 ~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~   46 (120)
                      ++..|..|+.+.-   -.+....|     .|..|+..+.+..|..
T Consensus        34 ~~~~Cp~C~~~~V---kR~a~GIW-----~C~kCg~~fAGgay~P   70 (89)
T COG1997          34 AKHVCPFCGRTTV---KRIATGIW-----KCRKCGAKFAGGAYTP   70 (89)
T ss_pred             cCCcCCCCCCcce---eeeccCeE-----EcCCCCCeeccccccc
Confidence            3567888888742   22334455     6888888887765543


No 143
>KOG2186|consensus
Probab=26.26  E-value=15  Score=26.21  Aligned_cols=44  Identities=16%  Similarity=0.371  Sum_probs=28.0

Q ss_pred             CCCccccccccccccceEEECCcccccccccccccccccCCCCe
Q psy17880          1 MIKAYCTSCKKKCSGEVLRVQDKYFHITCFQCSVCKNSLAQGGY   44 (120)
Q Consensus         1 ~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~   44 (120)
                      |+.-.|..|++.|...-+.---..-|...|.|-+|++.+.+..|
T Consensus         1 MV~FtCnvCgEsvKKp~vekH~srCrn~~fSCIDC~k~F~~~sY   44 (276)
T KOG2186|consen    1 MVFFTCNVCGESVKKPQVEKHMSRCRNAYFSCIDCGKTFERVSY   44 (276)
T ss_pred             CeEEehhhhhhhccccchHHHHHhccCCeeEEeecccccccchh
Confidence            55668999999885432211111235578999999998866443


No 144
>KOG3816|consensus
Probab=26.00  E-value=25  Score=26.78  Aligned_cols=49  Identities=16%  Similarity=0.295  Sum_probs=31.8

Q ss_pred             ccHhHHHhHhCCCCCCCCCcccCcEEEEe---------CccccccccccccCCCcCCC
Q psy17880         52 YCTSDYQKKFGTKCAQCGEYVEGEVVTAL---------GKTYHQKCFTCARCRFSKKR  100 (120)
Q Consensus        52 ~C~~c~~~~~~~~C~~C~~~i~~~~~~~~---------~~~~H~~Cf~C~~C~~~l~~  100 (120)
                      .|.+|-.......|..|+++..|...+..         ...-.+.=|+|..|.++|..
T Consensus       429 vC~~CL~g~~sI~C~~Ck~~wDGss~vLGTmY~YDI~aa~pCC~~R~~C~~C~k~l~~  486 (526)
T KOG3816|consen  429 VCARCLWGDWSIICKNCKKDWDGSSFVLGTMYYYDIVAAGPCCPVRLVCQSCRKSLGV  486 (526)
T ss_pred             HHHHHhcccchHHHhhcCCCCCCcceeechhhhhhhhhcCCcchhhhhhhhhcccccc
Confidence            46677776666789999999876422211         11224455789999998864


No 145
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=25.92  E-value=48  Score=23.06  Aligned_cols=24  Identities=25%  Similarity=0.564  Sum_probs=15.0

Q ss_pred             ccccccccCCCCeeecCCeeccHhHHHhHh
Q psy17880         32 CSVCKNSLAQGGYFNKDGAYYCTSDYQKKF   61 (120)
Q Consensus        32 C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~   61 (120)
                      |..||.+....    .  .-+|.+||.+.+
T Consensus         1 C~~CG~~~~~~----~--~~lC~~C~~~~~   24 (236)
T PF04981_consen    1 CPRCGREIEPL----I--DGLCPDCYLKRF   24 (236)
T ss_pred             CCCCCCCCCCc----c--cccChHHhcccC
Confidence            56677755431    1  137999998765


No 146
>PF10892 DUF2688:  Protein of unknown function (DUF2688);  InterPro: IPR024392 Members of this protein family are annotated as KleB, and may play a role in the regulation of transcription in plasmids.
Probab=25.71  E-value=20  Score=19.40  Aligned_cols=37  Identities=22%  Similarity=0.383  Sum_probs=22.3

Q ss_pred             cccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCcc
Q psy17880         31 QCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYV   72 (120)
Q Consensus        31 ~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i   72 (120)
                      .|..|+++|...+..     ++=.+.-...++.+|..|-.|-
T Consensus        12 ~CrRCGk~i~tl~~S-----L~Gad~lr~klG~IC~~CitpE   48 (60)
T PF10892_consen   12 PCRRCGKSIRTLSRS-----LIGADDLRVKLGGICGDCITPE   48 (60)
T ss_pred             hhhhhCccHHHHHHH-----hhChHHHHHHHcchhhccCCHH
Confidence            467788877543221     2223455667788888886553


No 147
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=25.70  E-value=53  Score=16.08  Aligned_cols=29  Identities=17%  Similarity=0.435  Sum_probs=10.7

Q ss_pred             ccccccccccccc-eEEECCccccccccccccccc
Q psy17880          4 AYCTSCKKKCSGE-VLRVQDKYFHITCFQCSVCKN   37 (120)
Q Consensus         4 ~~C~~C~~~i~~~-~~~~~~~~~H~~Cf~C~~C~~   37 (120)
                      .+|..|+--|..- .+...++.|     +|..|+.
T Consensus         3 ~rC~~C~aylNp~~~~~~~~~~w-----~C~~C~~   32 (40)
T PF04810_consen    3 VRCRRCRAYLNPFCQFDDGGKTW-----ICNFCGT   32 (40)
T ss_dssp             -B-TTT--BS-TTSEEETTTTEE-----EETTT--
T ss_pred             cccCCCCCEECCcceEcCCCCEE-----ECcCCCC
Confidence            4566676666543 222233443     5555544


No 148
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=25.31  E-value=46  Score=23.56  Aligned_cols=9  Identities=33%  Similarity=0.888  Sum_probs=4.6

Q ss_pred             CCCCCCCcc
Q psy17880         64 KCAQCGEYV   72 (120)
Q Consensus        64 ~C~~C~~~i   72 (120)
                      .|..|+.++
T Consensus       101 fC~~CG~~~  109 (256)
T PRK00241        101 FCGYCGHPM  109 (256)
T ss_pred             cccccCCCC
Confidence            455555544


No 149
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=25.31  E-value=44  Score=26.10  Aligned_cols=13  Identities=31%  Similarity=0.835  Sum_probs=7.3

Q ss_pred             cccccccCCCcCC
Q psy17880         87 KCFTCARCRFSKK   99 (120)
Q Consensus        87 ~Cf~C~~C~~~l~   99 (120)
                      +||.|-.|..+|.
T Consensus        51 ~Cf~CP~C~~~L~   63 (483)
T PF05502_consen   51 NCFDCPICFSPLS   63 (483)
T ss_pred             ccccCCCCCCcce
Confidence            5555555555553


No 150
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=25.09  E-value=39  Score=15.93  Aligned_cols=8  Identities=25%  Similarity=0.796  Sum_probs=3.8

Q ss_pred             cccCCCcC
Q psy17880         91 CARCRFSK   98 (120)
Q Consensus        91 C~~C~~~l   98 (120)
                      |..|+...
T Consensus         3 C~~Cg~~~   10 (32)
T PF03604_consen    3 CGECGAEV   10 (32)
T ss_dssp             ESSSSSSE
T ss_pred             CCcCCCee
Confidence            44554443


No 151
>TIGR02419 C4_traR_proteo phage/conjugal plasmid C-4 type zinc finger protein, TraR family. Members of this family are putative C4-type zinc finger proteins found almost exclusively in prophage regions, actual phage, or conjugal transfer regions of the Proteobactia. This small protein (about 70 amino acids) appears homologous to but is smaller than DksA (DnaK suppressor protein), found to be critical for regulating transcription of ribosomal RNA.
Probab=25.08  E-value=19  Score=19.78  Aligned_cols=27  Identities=19%  Similarity=0.365  Sum_probs=14.5

Q ss_pred             cccccccccCCCCeeecCCeeccHhHH
Q psy17880         31 QCSVCKNSLAQGGYFNKDGAYYCTSDY   57 (120)
Q Consensus        31 ~C~~C~~~l~~~~~~~~~~~~~C~~c~   57 (120)
                      .|..|+.+|+........+-.+|..|.
T Consensus        33 ~C~~Cg~~Ip~~Rl~a~p~~~~Cv~Cq   59 (63)
T TIGR02419        33 ECEDCGEPIPEARREALPGVTRCVSCQ   59 (63)
T ss_pred             eeccCCCcChHHHHhhcCCcCCcHHHH
Confidence            466677776654433444445555553


No 152
>PF03854 zf-P11:  P-11 zinc finger;  InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The RING-finger is a specialised type of Zn-finger of 40 to 60 residues that binds two atoms of zinc, and is probably involved in mediating protein-protein interactions [, , ]. There are two different variants, the C3HC4-type and a C3H2C3-type, which is clearly related despite the different cysteine/histidine pattern. The latter type is sometimes referred to as 'RING-H2 finger'. The RING domain is a protein interaction domain which has been implicated in a range of diverse biological processes. Several 3D-structures for RING-fingers are known [, ]. The 3D structure of the zinc ligation system is unique to the RING domain and is referred to as the 'cross-brace' motif. The spacing of the cysteines in such a domain is:  C-x(2)-C-x(9 to 39)-C-x(1 to 3)-H-x(2 to 3)-C-x(2)-C-x(4 to 48)-C-x(2)-C  Metal ligand pairs one and three co-ordinate to bind one zinc ion, whilst pairs two and four bind the second. This entry represents RING finger protein Z, a small polypeptide found in some negative-strand RNA viruses including Lassa fever virus, which plays a crucial role in virion assembly and budding. RING finger Z has been shown to interact with several host proteins, including promyelocytic leukemia protein and the eukaryotic translation initiation factor 4E [, ]. It is sufficient in the absence of any other viral proteins to release virus-like particles from the infected cell []. This protein is also responsible for arenavirus superinfection exclusion; expression of this protein in a host cell strongly and specifically inhibits areanavirus transcription and replication []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003723 RNA binding, 0008270 zinc ion binding; PDB: 2KO5_A.
Probab=24.78  E-value=43  Score=17.50  Aligned_cols=26  Identities=19%  Similarity=0.551  Sum_probs=13.9

Q ss_pred             CeeccHhHHHhHhC--CCCCCCCCcccC
Q psy17880         49 GAYYCTSDYQKKFG--TKCAQCGEYVEG   74 (120)
Q Consensus        49 ~~~~C~~c~~~~~~--~~C~~C~~~i~~   74 (120)
                      +..+|..|-..+.+  ..|..|+++++.
T Consensus        20 dHYLCl~CLt~ml~~s~~C~iC~~~LPt   47 (50)
T PF03854_consen   20 DHYLCLNCLTLMLSRSDRCPICGKPLPT   47 (50)
T ss_dssp             S-EEEHHHHHHT-SSSSEETTTTEE---
T ss_pred             chhHHHHHHHHHhccccCCCcccCcCcc
Confidence            34456666555443  678888888753


No 153
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger present in Drosophila Mind bomb (D-mib) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Mind bomb is an E3 ubiqitin ligase that has been shown to regulate signaling by the Notch ligand Delta in Drosophila melanogaster.
Probab=24.68  E-value=66  Score=16.34  Aligned_cols=13  Identities=23%  Similarity=0.503  Sum_probs=8.3

Q ss_pred             CCCCCC-CcccCcE
Q psy17880         64 KCAQCG-EYVEGEV   76 (120)
Q Consensus        64 ~C~~C~-~~i~~~~   76 (120)
                      .|..|+ .+|.|..
T Consensus         2 ~Cd~C~~~~i~G~R   15 (45)
T cd02339           2 ICDTCRKQGIIGIR   15 (45)
T ss_pred             CCCCCCCCCcccCe
Confidence            477787 4666644


No 154
>KOG2114|consensus
Probab=24.51  E-value=31  Score=28.88  Aligned_cols=46  Identities=24%  Similarity=0.431  Sum_probs=26.6

Q ss_pred             CcccccccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCC
Q psy17880         22 DKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGE   70 (120)
Q Consensus        22 ~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~   70 (120)
                      .+.+|.  .+|+.|+..|+-......=+..|...|..+. ...|..|.-
T Consensus       835 a~i~q~--skCs~C~~~LdlP~VhF~CgHsyHqhC~e~~-~~~CP~C~~  880 (933)
T KOG2114|consen  835 AQIFQV--SKCSACEGTLDLPFVHFLCGHSYHQHCLEDK-EDKCPKCLP  880 (933)
T ss_pred             cceeee--eeecccCCccccceeeeecccHHHHHhhccC-cccCCccch
Confidence            344444  5677777777654444555666666666632 256666654


No 155
>PRK12495 hypothetical protein; Provisional
Probab=24.36  E-value=53  Score=22.95  Aligned_cols=28  Identities=21%  Similarity=0.587  Sum_probs=19.0

Q ss_pred             CCCCCCCCcccCcEEEEeCccccccccccccCCCcCCC
Q psy17880         63 TKCAQCGEYVEGEVVTALGKTYHQKCFTCARCRFSKKR  100 (120)
Q Consensus        63 ~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~~C~~~l~~  100 (120)
                      ..|..|+.||.         . ++.+-.|..|+.....
T Consensus        43 ~hC~~CG~PIp---------a-~pG~~~Cp~CQ~~~~~   70 (226)
T PRK12495         43 AHCDECGDPIF---------R-HDGQEFCPTCQQPVTE   70 (226)
T ss_pred             hhcccccCccc---------C-CCCeeECCCCCCcccc
Confidence            47889999996         1 1445567888776543


No 156
>PHA02768 hypothetical protein; Provisional
Probab=24.35  E-value=12  Score=20.17  Aligned_cols=12  Identities=8%  Similarity=0.207  Sum_probs=6.2

Q ss_pred             ccccccCCCcCC
Q psy17880         88 CFTCARCRFSKK   99 (120)
Q Consensus        88 Cf~C~~C~~~l~   99 (120)
                      =++|..|++.+.
T Consensus        31 ~~kc~~C~k~f~   42 (55)
T PHA02768         31 NLKLSNCKRISL   42 (55)
T ss_pred             cccCCcccceec
Confidence            345555555543


No 157
>PF15121 TMEM71:  TMEM71 protein family
Probab=24.26  E-value=85  Score=20.21  Aligned_cols=30  Identities=20%  Similarity=0.268  Sum_probs=24.8

Q ss_pred             ccccccCCCcCCCCceeeeCCeeeeccCCC
Q psy17880         88 CFTCARCRFSKKREIYNWLGGRAYENRLGG  117 (120)
Q Consensus        88 Cf~C~~C~~~l~~~~~~~~~g~~yC~~~~~  117 (120)
                      .+.|-+=.+.|.++.|.+.++...|.++|.
T Consensus        55 ~~~CRRSPRLLtNGYYi~TEDSFl~D~dGN   84 (149)
T PF15121_consen   55 HCTCRRSPRLLTNGYYIWTEDSFLCDEDGN   84 (149)
T ss_pred             ccccccCchhhcCccEEEeccceeecCCCC
Confidence            466777778889999999999999988874


No 158
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=24.07  E-value=44  Score=15.81  Aligned_cols=10  Identities=20%  Similarity=0.298  Sum_probs=4.2

Q ss_pred             ecCCeeccHh
Q psy17880         46 NKDGAYYCTS   55 (120)
Q Consensus        46 ~~~~~~~C~~   55 (120)
                      ..++..+|..
T Consensus        17 ~~~~~~~C~~   26 (33)
T PF08792_consen   17 KEDDYEVCIF   26 (33)
T ss_pred             ecCCeEEccc
Confidence            3444444443


No 159
>PRK04023 DNA polymerase II large subunit; Validated
Probab=23.57  E-value=61  Score=27.91  Aligned_cols=36  Identities=19%  Similarity=0.483  Sum_probs=19.9

Q ss_pred             ccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCccc
Q psy17880         30 FQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVE   73 (120)
Q Consensus        30 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~   73 (120)
                      |.|..|+..-        .....|..|-.......|..|+..+.
T Consensus       639 frCP~CG~~T--------e~i~fCP~CG~~~~~y~CPKCG~El~  674 (1121)
T PRK04023        639 RRCPFCGTHT--------EPVYRCPRCGIEVEEDECEKCGREPT  674 (1121)
T ss_pred             ccCCCCCCCC--------CcceeCccccCcCCCCcCCCCCCCCC
Confidence            5566665541        11235666655544456777777664


No 160
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E. coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. CobB is a bacterial sirtuin that deacetylates acetyl-CoA synthetase at an active site lysine to stimulate its enzymatic activity.
Probab=23.54  E-value=1.5e+02  Score=20.19  Aligned_cols=47  Identities=21%  Similarity=0.523  Sum_probs=25.9

Q ss_pred             ceEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCcccCcEE
Q psy17880         16 EVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVEGEVV   77 (120)
Q Consensus        16 ~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~~~~~   77 (120)
                      +++.+-|...+..|   ..|+.......            -......|.|..|+..+...++
T Consensus        99 ~v~e~HG~~~~~~C---~~C~~~~~~~~------------~~~~~~~p~C~~Cgg~lrp~Vv  145 (224)
T cd01412          99 NVIELHGSLFRVRC---SSCGYVGENNE------------EIPEEELPRCPKCGGLLRPGVV  145 (224)
T ss_pred             ceEeeCCCcCcccc---CCCCCCCCcch------------hhhccCCCCCCCCCCccCCceE
Confidence            45666677666555   45655443220            0111124788888887766554


No 161
>smart00355 ZnF_C2H2 zinc finger.
Probab=23.45  E-value=44  Score=13.43  Aligned_cols=13  Identities=23%  Similarity=0.621  Sum_probs=8.2

Q ss_pred             cccccCCCcCCCC
Q psy17880         89 FTCARCRFSKKRE  101 (120)
Q Consensus        89 f~C~~C~~~l~~~  101 (120)
                      +.|..|++.+...
T Consensus         1 ~~C~~C~~~f~~~   13 (26)
T smart00355        1 YRCPECGKVFKSK   13 (26)
T ss_pred             CCCCCCcchhCCH
Confidence            4577777776543


No 162
>PF13771 zf-HC5HC2H:  PHD-like zinc-binding domain
Probab=23.43  E-value=1.1e+02  Score=17.31  Aligned_cols=54  Identities=17%  Similarity=0.332  Sum_probs=29.2

Q ss_pred             HhHhCCCCCCCCCcccCcEEE----EeCccccccccccccCCCcCCCCceeeeCCeeeeccC
Q psy17880         58 QKKFGTKCAQCGEYVEGEVVT----ALGKTYHQKCFTCARCRFSKKREIYNWLGGRAYENRL  115 (120)
Q Consensus        58 ~~~~~~~C~~C~~~i~~~~~~----~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~  115 (120)
                      .+.....|..|+++ .|-.|.    --...||+.|-.=+.+...+..   ....-.+||++|
T Consensus        32 ~~~~~~~C~~C~~~-~Ga~i~C~~~~C~~~fH~~CA~~~~~~~~~~~---~~~~~~~~C~~H   89 (90)
T PF13771_consen   32 KRRRKLKCSICKKK-GGACIGCSHPGCSRSFHVPCARKAGCFIEFDE---DNGKFRIFCPKH   89 (90)
T ss_pred             HHHhCCCCcCCCCC-CCeEEEEeCCCCCcEEChHHHccCCeEEEEcc---CCCceEEEChhc
Confidence            34455789999877 343332    2256788877543333222221   111346788776


No 163
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=22.69  E-value=76  Score=14.36  Aligned_cols=12  Identities=25%  Similarity=0.343  Sum_probs=6.1

Q ss_pred             ccccCCCcCCCC
Q psy17880         90 TCARCRFSKKRE  101 (120)
Q Consensus        90 ~C~~C~~~l~~~  101 (120)
                      .|..|.+.+++.
T Consensus         2 ~C~~C~~~~~~~   13 (30)
T PF03107_consen    2 WCDVCRRKIDGF   13 (30)
T ss_pred             CCCCCCCCcCCC
Confidence            455555555443


No 164
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=22.64  E-value=61  Score=16.74  Aligned_cols=13  Identities=38%  Similarity=0.871  Sum_probs=7.6

Q ss_pred             CCCCCCC-cccCcE
Q psy17880         64 KCAQCGE-YVEGEV   76 (120)
Q Consensus        64 ~C~~C~~-~i~~~~   76 (120)
                      .|..|+. ||.|..
T Consensus         2 ~Cd~C~~~pI~G~R   15 (48)
T cd02341           2 KCDSCGIEPIPGTR   15 (48)
T ss_pred             CCCCCCCCccccce
Confidence            4667766 665443


No 165
>PF05864 Chordopox_RPO7:  Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7);  InterPro: IPR008448 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of several Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide sequences. DNA-dependent RNA polymerase catalyses the transcription of DNA into RNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=22.52  E-value=20  Score=19.50  Aligned_cols=17  Identities=24%  Similarity=0.573  Sum_probs=12.2

Q ss_pred             cccccCCCcCCCCceee
Q psy17880         89 FTCARCRFSKKREIYNW  105 (120)
Q Consensus        89 f~C~~C~~~l~~~~~~~  105 (120)
                      ..|+.|++-|+.+.|..
T Consensus         5 lvCSTCGrDlSeeRy~L   21 (63)
T PF05864_consen    5 LVCSTCGRDLSEERYRL   21 (63)
T ss_pred             eeecccCCcchHHHHHH
Confidence            35888888888776543


No 166
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=22.48  E-value=2.3e+02  Score=20.94  Aligned_cols=10  Identities=20%  Similarity=0.909  Sum_probs=5.8

Q ss_pred             Cccccccccc
Q psy17880          3 KAYCTSCKKK   12 (120)
Q Consensus         3 ~~~C~~C~~~   12 (120)
                      ++.|..|+..
T Consensus       187 ~~~CPvCGs~  196 (309)
T PRK03564        187 RQFCPVCGSM  196 (309)
T ss_pred             CCCCCCCCCc
Confidence            3566666653


No 167
>KOG3039|consensus
Probab=22.47  E-value=1.7e+02  Score=21.10  Aligned_cols=51  Identities=10%  Similarity=0.116  Sum_probs=39.7

Q ss_pred             cccccccccccccccCCC-C--eeecCCeeccHhHHHhHhC--CCCCCCCCcccCc
Q psy17880         25 FHITCFQCSVCKNSLAQG-G--YFNKDGAYYCTSDYQKKFG--TKCAQCGEYVEGE   75 (120)
Q Consensus        25 ~H~~Cf~C~~C~~~l~~~-~--~~~~~~~~~C~~c~~~~~~--~~C~~C~~~i~~~   75 (120)
                      -|..-+.|..+...|... .  +....|.+++.+|.+++..  ..+..+++++.++
T Consensus       217 a~s~ryiCpvtrd~LtNt~~ca~Lr~sg~Vv~~ecvEklir~D~v~pv~d~plkdr  272 (303)
T KOG3039|consen  217 AASKRYICPVTRDTLTNTTPCAVLRPSGHVVTKECVEKLIRKDMVDPVTDKPLKDR  272 (303)
T ss_pred             hhccceecccchhhhcCccceEEeccCCcEeeHHHHHHhccccccccCCCCcCccc
Confidence            455778999999999765 2  3356789999999998764  5799999999664


No 168
>PF13832 zf-HC5HC2H_2:  PHD-zinc-finger like domain
Probab=22.12  E-value=69  Score=19.14  Aligned_cols=29  Identities=28%  Similarity=0.780  Sum_probs=18.3

Q ss_pred             HhCCCCCCCCCcccCcEEEE----eCcccccccc
Q psy17880         60 KFGTKCAQCGEYVEGEVVTA----LGKTYHQKCF   89 (120)
Q Consensus        60 ~~~~~C~~C~~~i~~~~~~~----~~~~~H~~Cf   89 (120)
                      ++..+|..|++. .|-.|.=    -...||+.|-
T Consensus        53 ~~~~~C~iC~~~-~G~~i~C~~~~C~~~fH~~CA   85 (110)
T PF13832_consen   53 RFKLKCSICGKS-GGACIKCSHPGCSTAFHPTCA   85 (110)
T ss_pred             hcCCcCcCCCCC-CceeEEcCCCCCCcCCCHHHH
Confidence            456789999887 3333321    2467888764


No 169
>PRK11019 hypothetical protein; Provisional
Probab=21.92  E-value=34  Score=20.26  Aligned_cols=29  Identities=17%  Similarity=0.374  Sum_probs=19.0

Q ss_pred             ccccccccccCCCCeeecCCeeccHhHHH
Q psy17880         30 FQCSVCKNSLAQGGYFNKDGAYYCTSDYQ   58 (120)
Q Consensus        30 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~   58 (120)
                      ..|..|+.+|+........+-.+|.+|-.
T Consensus        37 g~C~~CG~~Ip~~Rl~A~P~a~~Cv~Cq~   65 (88)
T PRK11019         37 TECEECGEPIPEARRKAIPGVRLCVACQQ   65 (88)
T ss_pred             CeeCcCCCcCcHHHHhhcCCccccHHHHH
Confidence            36788888887654445556667776654


No 170
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=21.88  E-value=49  Score=18.02  Aligned_cols=12  Identities=25%  Similarity=0.783  Sum_probs=8.7

Q ss_pred             CCCCCCCCcccC
Q psy17880         63 TKCAQCGEYVEG   74 (120)
Q Consensus        63 ~~C~~C~~~i~~   74 (120)
                      ..|..|++||+.
T Consensus         4 kHC~~CG~~Ip~   15 (59)
T PF09889_consen    4 KHCPVCGKPIPP   15 (59)
T ss_pred             CcCCcCCCcCCc
Confidence            468888888864


No 171
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=21.86  E-value=89  Score=21.33  Aligned_cols=17  Identities=29%  Similarity=0.745  Sum_probs=12.7

Q ss_pred             CCCCCCCCCcccCcEEE
Q psy17880         62 GTKCAQCGEYVEGEVVT   78 (120)
Q Consensus        62 ~~~C~~C~~~i~~~~~~   78 (120)
                      .|.|..|+.++...++-
T Consensus       133 ~p~C~~Cg~~lrP~Vv~  149 (218)
T cd01407         133 VPRCPKCGGLLRPDVVF  149 (218)
T ss_pred             CCcCCCCCCccCCCeEE
Confidence            47899998888766553


No 172
>PF11077 DUF2616:  Protein of unknown function (DUF2616);  InterPro: IPR020201 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf52; it is a family of uncharacterised viral proteins.
Probab=21.79  E-value=31  Score=23.13  Aligned_cols=35  Identities=17%  Similarity=0.254  Sum_probs=19.4

Q ss_pred             cccccccccccccCCCCeeecCCeeccHhHHHhHh
Q psy17880         27 ITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKF   61 (120)
Q Consensus        27 ~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~   61 (120)
                      ..|++|+.=....+...++..+.+++|..|...+|
T Consensus       137 ~kC~QC~~~~~~~~~~~~~~F~~~lFC~~ClFPLF  171 (173)
T PF11077_consen  137 DKCVQCSQKCENVGAKIFTYFNFNLFCKNCLFPLF  171 (173)
T ss_pred             cccCcCCCCcccccceeEEecChhhcccccCcccc
Confidence            34555554322332223666777778877765544


No 173
>KOG2879|consensus
Probab=21.57  E-value=1.2e+02  Score=22.15  Aligned_cols=43  Identities=30%  Similarity=0.498  Sum_probs=23.4

Q ss_pred             ccccccccccCCCCee-ecCCeeccHhHHHhHhC----CCCCCCCCccc
Q psy17880         30 FQCSVCKNSLAQGGYF-NKDGAYYCTSDYQKKFG----TKCAQCGEYVE   73 (120)
Q Consensus        30 f~C~~C~~~l~~~~~~-~~~~~~~C~~c~~~~~~----~~C~~C~~~i~   73 (120)
                      ..|..|+.+-.. .+. ..=+.+||-.|-.....    -.|..|+.+..
T Consensus       240 ~~C~~Cg~~Pti-P~~~~~C~HiyCY~Ci~ts~~~~asf~Cp~Cg~~~~  287 (298)
T KOG2879|consen  240 TECPVCGEPPTI-PHVIGKCGHIYCYYCIATSRLWDASFTCPLCGENVE  287 (298)
T ss_pred             ceeeccCCCCCC-CeeeccccceeehhhhhhhhcchhhcccCccCCCCc
Confidence            345566654433 233 22456777777665543    36777766553


No 174
>PF07750 GcrA:  GcrA cell cycle regulator;  InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator. These bacterial regulators are involved in controlling the progression and asymmetric polar morphogenesis []. During this process, there are temporal and spatial variations in the concentrations of GcrA and CtrA. The variation in concentration produces time and space dependent transcriptional regulation of modular functions that implement cell-cycle processes []. More specifically, GcrA acts as an activator of components of the replisome and the segregation machinery [].
Probab=21.48  E-value=17  Score=24.03  Aligned_cols=28  Identities=21%  Similarity=0.417  Sum_probs=18.3

Q ss_pred             cCCCcCCC---Cceee-----eCCeeeeccCCCcCC
Q psy17880         93 RCRFSKKR---EIYNW-----LGGRAYENRLGGRAY  120 (120)
Q Consensus        93 ~C~~~l~~---~~~~~-----~~g~~yC~~~~~~~~  120 (120)
                      .|.=+|++   .+|.+     .+|.+||..|.+.+|
T Consensus       117 ~CrwPiGdp~~~~f~FCG~~~~~g~~YC~~H~~~ay  152 (162)
T PF07750_consen  117 TCRWPIGDPGEPDFHFCGAPTQPGSPYCAAHARIAY  152 (162)
T ss_pred             CccCcCCCCCCCCccccCCcCCCCCchhHHHHHHhc
Confidence            45556642   23443     458899999988776


No 175
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=21.33  E-value=1.9e+02  Score=19.95  Aligned_cols=17  Identities=24%  Similarity=0.530  Sum_probs=12.5

Q ss_pred             CCCCCCCCCcccCcEEE
Q psy17880         62 GTKCAQCGEYVEGEVVT   78 (120)
Q Consensus        62 ~~~C~~C~~~i~~~~~~   78 (120)
                      .|.|..|+.++...++-
T Consensus       136 ~p~C~~Cgg~lrP~vv~  152 (225)
T cd01411         136 SPYHAKCGGVIRPDIVL  152 (225)
T ss_pred             CCCCCCCCCEeCCCEEE
Confidence            37888898888666553


No 176
>KOG3970|consensus
Probab=21.28  E-value=82  Score=22.26  Aligned_cols=49  Identities=16%  Similarity=0.329  Sum_probs=30.3

Q ss_pred             CcccccccccccccccccCCCCee-ecCCeeccHhHHHhHhC----------CCCCCCCCccc
Q psy17880         22 DKYFHITCFQCSVCKNSLAQGGYF-NKDGAYYCTSDYQKKFG----------TKCAQCGEYVE   73 (120)
Q Consensus        22 ~~~~H~~Cf~C~~C~~~l~~~~~~-~~~~~~~C~~c~~~~~~----------~~C~~C~~~i~   73 (120)
                      +.-|.++   |..|+.+|.++... ..--.++.-.|..++-+          -.|..|+.+|.
T Consensus        46 DsDY~pN---C~LC~t~La~gdt~RLvCyhlfHW~ClneraA~lPanTAPaGyqCP~Cs~eiF  105 (299)
T KOG3970|consen   46 DSDYNPN---CRLCNTPLASGDTTRLVCYHLFHWKCLNERAANLPANTAPAGYQCPCCSQEIF  105 (299)
T ss_pred             hcCCCCC---CceeCCccccCcceeehhhhhHHHHHhhHHHhhCCCcCCCCcccCCCCCCccC
Confidence            4456655   47788999876432 22223455566665532          37999999884


No 177
>PF04945 YHS:  YHS domain;  InterPro: IPR007029 This short presumed domain is about 50 amino acid residues long. It often contains two cysteines that may be functionally important. This domain is found in copper transporting ATPases, some phenol hydroxylases and in a set of uncharacterised membrane proteins including Q9CNI0 from SWISSPROT. This domain is named after three of the most conserved amino acids it contains. The domain may be metal binding, possibly copper ions. This domain is duplicated in some copper transporting ATPases.; PDB: 3U52_B 2INN_A 2INP_B 1T0Q_A 2RDB_A 1T0R_A 2IND_A 1T0S_A 2INC_A 3DHI_A ....
Probab=21.27  E-value=11  Score=19.11  Aligned_cols=30  Identities=30%  Similarity=0.453  Sum_probs=15.3

Q ss_pred             CCCCCccc---CcEEEEeCccccccccccccCCCcC
Q psy17880         66 AQCGEYVE---GEVVTALGKTYHQKCFTCARCRFSK   98 (120)
Q Consensus        66 ~~C~~~i~---~~~~~~~~~~~H~~Cf~C~~C~~~l   98 (120)
                      ..|+..|.   ...++..|+.|+   |.+..|...+
T Consensus         4 Pvcg~~v~~~~~~~~~y~G~~Y~---FCS~~C~~~F   36 (47)
T PF04945_consen    4 PVCGMKVPGNAAYSVEYNGRTYY---FCSEGCKEKF   36 (47)
T ss_dssp             -GGG-BE-----EEEEETTEEEE---ESSHHHHHHH
T ss_pred             CCCCCEEccCccEEEEECCEEEE---EcCHHHHHHH
Confidence            34566662   235567777776   5555555444


No 178
>PHA03082 DNA-dependent RNA polymerase subunit; Provisional
Probab=21.07  E-value=21  Score=19.37  Aligned_cols=16  Identities=25%  Similarity=0.623  Sum_probs=11.7

Q ss_pred             cccccCCCcCCCCcee
Q psy17880         89 FTCARCRFSKKREIYN  104 (120)
Q Consensus        89 f~C~~C~~~l~~~~~~  104 (120)
                      ..|+.|++-|+.+.|.
T Consensus         5 lVCsTCGrDlSeeRy~   20 (63)
T PHA03082          5 LVCSTCGRDLSEERYR   20 (63)
T ss_pred             eeecccCcchhHHHHH
Confidence            3588888888776654


No 179
>PLN03123 poly [ADP-ribose] polymerase; Provisional
Probab=20.79  E-value=69  Score=27.46  Aligned_cols=30  Identities=23%  Similarity=0.603  Sum_probs=19.8

Q ss_pred             CccccccccccccceEEE---------CC---cccccccccc
Q psy17880          3 KAYCTSCKKKCSGEVLRV---------QD---KYFHITCFQC   32 (120)
Q Consensus         3 ~~~C~~C~~~i~~~~~~~---------~~---~~~H~~Cf~C   32 (120)
                      ...|..|+++|....+.+         .|   ..||..||.=
T Consensus        17 Rs~Ck~C~~~I~K~~lRi~~~v~~~~~dg~~~~W~H~~Cf~~   58 (981)
T PLN03123         17 RSSCKTCKSPIDKDELRLGKMVQSTQFDGFMPMWNHASCILK   58 (981)
T ss_pred             CccccccCCcccCCCeEEEEeecccccCCCCCeeeccccccc
Confidence            467999999996433222         12   3579999863


No 180
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=20.71  E-value=1.2e+02  Score=14.63  Aligned_cols=9  Identities=22%  Similarity=0.246  Sum_probs=3.7

Q ss_pred             CeeccHhHH
Q psy17880         49 GAYYCTSDY   57 (120)
Q Consensus        49 ~~~~C~~c~   57 (120)
                      +..++..|.
T Consensus        22 ~H~fh~~Ci   30 (44)
T PF13639_consen   22 GHVFHRSCI   30 (44)
T ss_dssp             SEEEEHHHH
T ss_pred             CCeeCHHHH
Confidence            334444443


No 181
>KOG0823|consensus
Probab=20.64  E-value=1.6e+02  Score=20.72  Aligned_cols=55  Identities=20%  Similarity=0.397  Sum_probs=38.3

Q ss_pred             ccccccccccccccCCCCeeecCCeeccHhHHHhHh-----CCCCCCCCCcccC-cEEEEeC
Q psy17880         26 HITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKF-----GTKCAQCGEYVEG-EVVTALG   81 (120)
Q Consensus        26 H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~-----~~~C~~C~~~i~~-~~~~~~~   81 (120)
                      -...|.|..|-..- .+.....=|.+||..|..+-.     ...|.+|+-.|.. ++|-.-|
T Consensus        44 ~~~~FdCNICLd~a-kdPVvTlCGHLFCWpClyqWl~~~~~~~~cPVCK~~Vs~~~vvPlYG  104 (230)
T KOG0823|consen   44 DGGFFDCNICLDLA-KDPVVTLCGHLFCWPCLYQWLQTRPNSKECPVCKAEVSIDTVVPLYG  104 (230)
T ss_pred             CCCceeeeeecccc-CCCEEeecccceehHHHHHHHhhcCCCeeCCccccccccceEEeeec
Confidence            34568888885544 336888889999999987643     2468999998865 4554433


No 182
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=20.45  E-value=1.1e+02  Score=18.74  Aligned_cols=24  Identities=21%  Similarity=0.551  Sum_probs=13.3

Q ss_pred             CCCCCCCCcccCcEEEEeCccccccc
Q psy17880         63 TKCAQCGEYVEGEVVTALGKTYHQKC   88 (120)
Q Consensus        63 ~~C~~C~~~i~~~~~~~~~~~~H~~C   88 (120)
                      ..|..|+.|=  ..+...++.|=..|
T Consensus        81 VlC~~C~spd--T~l~k~~r~~~l~C  104 (110)
T smart00653       81 VLCPECGSPD--TELIKENRLFFLKC  104 (110)
T ss_pred             EECCCCCCCC--cEEEEeCCeEEEEc
Confidence            5788888772  23333355554444


No 184
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=20.28  E-value=76  Score=20.42  Aligned_cols=43  Identities=21%  Similarity=0.673  Sum_probs=27.2

Q ss_pred             ccccccccccCCCCeeecC---CeeccHhHHHhHhC-----CCCCCCCCcc
Q psy17880         30 FQCSVCKNSLAQGGYFNKD---GAYYCTSDYQKKFG-----TKCAQCGEYV   72 (120)
Q Consensus        30 f~C~~C~~~l~~~~~~~~~---~~~~C~~c~~~~~~-----~~C~~C~~~i   72 (120)
                      ..|..|.....++.|.-.+   |--.|..||..++.     |.|..|+...
T Consensus        81 YeCnIC~etS~ee~FLKPneCCgY~iCn~Cya~LWK~~~~ypvCPvCkTSF  131 (140)
T PF05290_consen   81 YECNICKETSAEERFLKPNECCGYSICNACYANLWKFCNLYPVCPVCKTSF  131 (140)
T ss_pred             eeccCcccccchhhcCCcccccchHHHHHHHHHHHHHcccCCCCCcccccc
Confidence            4778887766655444222   45579999988762     5666665443


No 185
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=20.06  E-value=40  Score=17.82  Aligned_cols=10  Identities=20%  Similarity=0.604  Sum_probs=6.0

Q ss_pred             cccccccccc
Q psy17880          5 YCTSCKKKCS   14 (120)
Q Consensus         5 ~C~~C~~~i~   14 (120)
                      .|..|+++|.
T Consensus         2 ~CPyCge~~~   11 (52)
T PF14255_consen    2 QCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCeeE
Confidence            4666666654


No 186
>PF14570 zf-RING_4:  RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B.
Probab=20.03  E-value=93  Score=16.20  Aligned_cols=20  Identities=30%  Similarity=0.733  Sum_probs=10.6

Q ss_pred             ccHhHHHhHh---CCCCCCCCCc
Q psy17880         52 YCTSDYQKKF---GTKCAQCGEY   71 (120)
Q Consensus        52 ~C~~c~~~~~---~~~C~~C~~~   71 (120)
                      +|..||.+..   +.+|..|.++
T Consensus        24 IC~~C~~~i~~~~~g~CPgCr~~   46 (48)
T PF14570_consen   24 ICRFCYHDILENEGGRCPGCREP   46 (48)
T ss_dssp             --HHHHHHHTTSS-SB-TTT--B
T ss_pred             HHHHHHHHHHhccCCCCCCCCCC
Confidence            5888887765   3688888765


Done!