Query         psy17881
Match_columns 68
No_of_seqs    25 out of 27
Neff          1.9 
Searched_HMMs 46136
Date          Fri Aug 16 16:32:21 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17881.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17881hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1044|consensus               97.9 9.2E-06   2E-10   67.8   2.7   58    1-58    461-553 (670)
  2 KOG1044|consensus               93.0   0.064 1.4E-06   45.5   2.1   47   22-68    448-494 (670)
  3 PF09832 DUF2059:  Uncharacteri  21.0      42 0.00092   18.7   0.5   11   22-32     29-39  (64)
  4 PF10629 DUF2475:  Protein of u  19.5      42 0.00092   20.6   0.3   26   15-40     12-37  (71)
  5 PHA02907 hypothetical protein;  17.3      69  0.0015   23.5   1.0   48    1-55      1-48  (182)
  6 PLN03155 cytochrome c oxidase   17.1      27  0.0006   22.1  -0.9   33    8-40     12-44  (63)
  7 PF00976 ACTH_domain:  Corticot  15.6      60  0.0013   19.0   0.3   25   19-43      6-30  (39)
  8 PF05251 UPF0197:  Uncharacteri  13.2      74  0.0016   20.4   0.3   11   21-31      6-16  (77)
  9 PF04182 B-block_TFIIIC:  B-blo  10.5 1.4E+02  0.0029   17.6   0.8   14   27-40     22-35  (75)
 10 KOG1273|consensus               10.4 1.4E+02   0.003   24.6   1.0   12   15-26     98-109 (405)

No 1  
>KOG1044|consensus
Probab=97.86  E-value=9.2e-06  Score=67.83  Aligned_cols=58  Identities=28%  Similarity=0.237  Sum_probs=52.0

Q ss_pred             CCCCCCCCCCCCCCCcceeeeccchhHH-----------------------------------HHhhhcCCCCCCCCCCC
Q psy17881          1 MDPRNASRTPSATKEPMYRLRYQSPVNA-----------------------------------LLKQSHINPRNASRTPS   45 (68)
Q Consensus         1 ~dprnasrtpsa~kep~~r~ry~~p~~A-----------------------------------S~k~~~~DPRnASRtPs   45 (68)
                      ++|++|+++++..+.+++..+|..|+++                                   +|+.-+.||||++|++.
T Consensus       461 ~~pdpas~~~~e~~~w~~~ps~~V~~~~~~~R~~~R~~eql~Kl~sgigq~ilKeeme~~r~~~~~~p~~sp~nssr~~~  540 (670)
T KOG1044|consen  461 QAPDPASTPEIETDHWPGKPSFAVPGPEMKRRSLGRQEEQLMKLNSGLGQLILKEEMEKARSSLLASPYDSPRNSSRHIP  540 (670)
T ss_pred             cCCCCCCCCcccccCCCCCCcccccCchhhhhhccchhhhhhhccchhhHHHHHHHhhhhhchhhccccCCccccccccC
Confidence            6899999999999999999999999543                                   46667789999999999


Q ss_pred             CCCCCcceecccC
Q psy17881         46 ATKEPMYRLRYQS   58 (68)
Q Consensus        46 A~kEP~~rlRY~s   58 (68)
                      |.||+.|.++|+.
T Consensus       541 aske~~~~l~~~n  553 (670)
T KOG1044|consen  541 ASKEASLPLYGEN  553 (670)
T ss_pred             ccccccccccccC
Confidence            9999999999974


No 2  
>KOG1044|consensus
Probab=93.00  E-value=0.064  Score=45.49  Aligned_cols=47  Identities=11%  Similarity=-0.007  Sum_probs=43.5

Q ss_pred             ccchhHHHHhhhcCCCCCCCCCCCCCCCCcceecccCCCccccccCC
Q psy17881         22 YQSPVNALLKQSHINPRNASRTPSATKEPMYRLRYQSPVNACEYKLV   68 (68)
Q Consensus        22 y~~p~~AS~k~~~~DPRnASRtPsA~kEP~~rlRY~sPv~Aspsr~~   68 (68)
                      |+-++-.+.-..+++|++|+++++..+.++++.+|..|+++++.|++
T Consensus       448 ~eDi~k~sk~p~~~~pdpas~~~~e~~~w~~~ps~~V~~~~~~~R~~  494 (670)
T KOG1044|consen  448 SEDIIKFSKFPAAQAPDPASTPEIETDHWPGKPSFAVPGPEMKRRSL  494 (670)
T ss_pred             ccchhhhhcCCcccCCCCCCCCcccccCCCCCCcccccCchhhhhhc
Confidence            77788888889999999999999999999999999999999999853


No 3  
>PF09832 DUF2059:  Uncharacterized protein conserved in bacteria (DUF2059);  InterPro: IPR018637  This entry contains proteins that have no known function. ; PDB: 2X3O_B 3OAO_A.
Probab=20.96  E-value=42  Score=18.70  Aligned_cols=11  Identities=27%  Similarity=0.610  Sum_probs=8.7

Q ss_pred             ccchhHHHHhh
Q psy17881         22 YQSPVNALLKQ   32 (68)
Q Consensus        22 y~~p~~AS~k~   32 (68)
                      |+||+|.++..
T Consensus        29 Y~Sp~Gqk~~~   39 (64)
T PF09832_consen   29 YESPLGQKIVA   39 (64)
T ss_dssp             HHSHHHHHHHH
T ss_pred             HCCHHhHHHHH
Confidence            78999988754


No 4  
>PF10629 DUF2475:  Protein of unknown function (DUF2475);  InterPro: IPR018902  This entry represents both UPF0573 and UPF0605 families. Both these families of proteins have no known function. 
Probab=19.52  E-value=42  Score=20.61  Aligned_cols=26  Identities=19%  Similarity=0.318  Sum_probs=22.0

Q ss_pred             CcceeeeccchhHHHHhhhcCCCCCC
Q psy17881         15 EPMYRLRYQSPVNALLKQSHINPRNA   40 (68)
Q Consensus        15 ep~~r~ry~~p~~AS~k~~~~DPRnA   40 (68)
                      -|.++++|....+....+.--|++++
T Consensus        12 vP~~~~~~G~tyg~~t~~~l~d~~~~   37 (71)
T PF10629_consen   12 VPGYKFRFGKTYGNTTRKLLQDFRNR   37 (71)
T ss_pred             CCcccccccCcHHHHHHHHHHhHHHh
Confidence            47889999999999998888888764


No 5  
>PHA02907 hypothetical protein; Provisional
Probab=17.33  E-value=69  Score=23.55  Aligned_cols=48  Identities=29%  Similarity=0.400  Sum_probs=36.9

Q ss_pred             CCCCCCCCCCCCCCCcceeeeccchhHHHHhhhcCCCCCCCCCCCCCCCCcceec
Q psy17881          1 MDPRNASRTPSATKEPMYRLRYQSPVNALLKQSHINPRNASRTPSATKEPMYRLR   55 (68)
Q Consensus         1 ~dprnasrtpsa~kep~~r~ry~~p~~AS~k~~~~DPRnASRtPsA~kEP~~rlR   55 (68)
                      ++|||+.-.=|..|.-.-+||=++-+|-+       =-.|||.-..++-|+-|+-
T Consensus         1 mnprnspekysphknsvskmrpessfnvs-------lydasriraskhyphtrfp   48 (182)
T PHA02907          1 MNPRNSPEKYSPHKNSVSKMRPESSFNVS-------LYDASRIRASKHYPHTRFP   48 (182)
T ss_pred             CCCCCCccccCccccchhhcCCcccccee-------ehhhhhhhhcccCCCCCCC
Confidence            57999988888888888899999988763       3457777777777777653


No 6  
>PLN03155 cytochrome c oxidase subunit 5C; Provisional
Probab=17.09  E-value=27  Score=22.14  Aligned_cols=33  Identities=27%  Similarity=0.300  Sum_probs=24.5

Q ss_pred             CCCCCCCCcceeeeccchhHHHHhhhcCCCCCC
Q psy17881          8 RTPSATKEPMYRLRYQSPVNALLKQSHINPRNA   40 (68)
Q Consensus         8 rtpsa~kep~~r~ry~~p~~AS~k~~~~DPRnA   40 (68)
                      +-||-.||=.|-|--.---|..||+-||+-+..
T Consensus        12 ~gPsvvKEI~iG~~LGL~AG~~WKmhHWn~qrk   44 (63)
T PLN03155         12 KGPSVVKELCIGLTLGLAAGGLWKMHHWNEQRK   44 (63)
T ss_pred             cCCchhhhHHHHhHHHHhhhhHHHHhhhhhHHH
Confidence            456777776666666666788999999987654


No 7  
>PF00976 ACTH_domain:  Corticotropin ACTH domain;  InterPro: IPR013531 Pro-opiomelanocortin is present in high levels in the pituitary and is processed into 3 major peptide families: adrenocorticotrophin (ACTH); alpha-, beta- and gamma-melanocyte- stimulating hormones (MSH); and beta-endorphin []. ACTH regulates the synthesis and release of glucocorticoids and, to some extent, aldosterone in the adrenal cortex. It is synthesised and released in response to corticotrophin-releasing factor at times of stress (i.e. heat, cold, infection, etc.), its release leading to increased metabolism. The action of MSH in man is poorly understood, but it may be involved in temperature regulation []. Full activity of ACTH resides in the first 20 N-terminal amino acids, the first 13 of which are identical to alpha-MSH [, ]. The function of this region is not known, though it is found near the centre of these proteins.
Probab=15.59  E-value=60  Score=18.98  Aligned_cols=25  Identities=20%  Similarity=0.428  Sum_probs=20.5

Q ss_pred             eeeccchhHHHHhhhcCCCCCCCCC
Q psy17881         19 RLRYQSPVNALLKQSHINPRNASRT   43 (68)
Q Consensus        19 r~ry~~p~~AS~k~~~~DPRnASRt   43 (68)
                      -||+..|++..+++..+-|..+-..
T Consensus         6 hfrwgkp~g~KRRPvKVypn~~Eee   30 (39)
T PF00976_consen    6 HFRWGKPVGRKRRPVKVYPNGAEEE   30 (39)
T ss_pred             ceeccCCCCcccCcceeCCCCcccc
Confidence            4799999999999988888776543


No 8  
>PF05251 UPF0197:  Uncharacterised protein family (UPF0197);  InterPro: IPR007915 This family of proteins is functionally uncharacterised, but is thought to be a transmembrane protein.
Probab=13.17  E-value=74  Score=20.42  Aligned_cols=11  Identities=64%  Similarity=0.924  Sum_probs=7.4

Q ss_pred             eccchhHHHHh
Q psy17881         21 RYQSPVNALLK   31 (68)
Q Consensus        21 ry~~p~~AS~k   31 (68)
                      ||.+||+.++-
T Consensus         6 ~Y~sPV~p~~~   16 (77)
T PF05251_consen    6 RYTSPVNPALY   16 (77)
T ss_pred             CcCCCCCHHHH
Confidence            67777776553


No 9  
>PF04182 B-block_TFIIIC:  B-block binding subunit of TFIIIC;  InterPro: IPR007309 Yeast transcription factor IIIC (TFIIIC) is a multisubunit protein complex that interacts with two control elements of class III promoters called the A and B blocks. This family represents the subunit within TFIIIC involved in B-block binding []. Although defined as a yeast protein, it is also found in a number of other organisms.
Probab=10.48  E-value=1.4e+02  Score=17.57  Aligned_cols=14  Identities=36%  Similarity=0.458  Sum_probs=11.0

Q ss_pred             HHHHhhhcCCCCCC
Q psy17881         27 NALLKQSHINPRNA   40 (68)
Q Consensus        27 ~AS~k~~~~DPRnA   40 (68)
                      ...|+..++|||+-
T Consensus        22 ~~L~~~~~~D~r~i   35 (75)
T PF04182_consen   22 SDLSKLLGIDPRSI   35 (75)
T ss_pred             hHHHHHhCCCchHH
Confidence            35689999999874


No 10 
>KOG1273|consensus
Probab=10.45  E-value=1.4e+02  Score=24.64  Aligned_cols=12  Identities=50%  Similarity=1.107  Sum_probs=10.9

Q ss_pred             Ccceeeeccchh
Q psy17881         15 EPMYRLRYQSPV   26 (68)
Q Consensus        15 ep~~r~ry~~p~   26 (68)
                      .|.+|+||++||
T Consensus        98 s~l~rirf~spv  109 (405)
T KOG1273|consen   98 SPLKRIRFDSPV  109 (405)
T ss_pred             CceeEEEccCcc
Confidence            489999999999


Done!