Diaphorina citri psyllid: psy178


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MGGMVFVDGLSNATGALKLKGRKASEDAPIVKILREAGAIPLCNTNVPELCTSWETTNYITGKTVNPYDFSRTPGGSSGGEVLK
cccEEccccEEccccccccccccccccHHHHHHHHHcccEEEEEccccHHcccccccccccccccccccccccccccccccccc
MGGMVFVDGLSNATGALKLKGRKASEDAPIVKILREAGAIPLCNTNVPELCTSWETTNYITGKTVNPYDFSRT***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGMVFVDGLSNATGALKLKGRKASEDAPIVKILREAGAIPLCNTNVPELCTSWETTNYITGKTVNPYDFSRTPGGSSGGEVLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071704 [BP]organic substance metabolic processprobableGO:0008150, GO:0008152
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016811 [MF]hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidesprobableGO:0016787, GO:0016810, GO:0003674, GO:0003824
GO:0044422 [CC]organelle partprobableGO:0005575, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DC0, chain A
Confidence level:very confident
Coverage over the Query: 1-84
View the alignment between query and template
View the model in PyMOL