Query         psy17913
Match_columns 121
No_of_seqs    188 out of 1133
Neff          5.0 
Searched_HMMs 46136
Date          Fri Aug 16 17:20:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17913.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17913hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0336|consensus               99.0 5.2E-10 1.1E-14   97.2   4.6   46    2-47    557-602 (629)
  2 KOG0335|consensus               98.9 1.5E-09 3.2E-14   94.5   5.7   48    2-49    429-476 (482)
  3 KOG0339|consensus               98.9 4.3E-09 9.3E-14   93.2   7.2   49    1-49    559-607 (731)
  4 PTZ00110 helicase; Provisional  98.8 8.7E-09 1.9E-13   89.7   6.1   49    1-49    468-516 (545)
  5 KOG0331|consensus               98.6 7.3E-08 1.6E-12   84.7   4.9   48    2-49    433-480 (519)
  6 KOG0341|consensus               98.4 2.3E-07   5E-12   80.6   4.3   45    2-46    513-558 (610)
  7 PLN00206 DEAD-box ATP-dependen  98.3 8.9E-07 1.9E-11   76.5   4.9   46    2-47    460-505 (518)
  8 KOG0334|consensus               97.9 2.2E-05 4.8E-10   73.4   5.8   45    2-46    705-749 (997)
  9 KOG0344|consensus               97.8 2.9E-05 6.4E-10   69.2   4.9   44    2-45    480-523 (593)
 10 KOG0333|consensus               97.7 2.8E-05 6.1E-10   69.4   3.8   45    2-46    609-654 (673)
 11 KOG0328|consensus               96.0  0.0069 1.5E-07   51.4   3.5   42    2-43    358-399 (400)
 12 PRK10590 ATP-dependent RNA hel  95.7   0.037 7.9E-07   47.0   6.7   32    2-33    337-368 (456)
 13 COG0513 SrmB Superfamily II DN  95.1   0.025 5.4E-07   49.4   3.9   42    1-42    364-409 (513)
 14 KOG0327|consensus               94.5    0.02 4.3E-07   49.4   1.7   42    2-43    355-396 (397)
 15 PRK04837 ATP-dependent RNA hel  93.7   0.055 1.2E-06   45.2   2.9   32    2-33    347-378 (423)
 16 PRK01297 ATP-dependent RNA hel  93.2   0.089 1.9E-06   44.8   3.3   41    2-42    427-469 (475)
 17 PF14475 Mso1_Sec1_bdg:  Sec1-b  92.4    0.11 2.5E-06   31.6   2.1   25   16-40     17-41  (41)
 18 PTZ00424 helicase 45; Provisio  92.1    0.12 2.6E-06   42.2   2.6   39    2-40    359-397 (401)
 19 KOG0326|consensus               90.8    0.19 4.1E-06   43.5   2.6   39    2-40    414-452 (459)
 20 PRK11634 ATP-dependent RNA hel  90.7     0.2 4.4E-06   45.0   2.8   31    1-31    336-366 (629)
 21 PRK04537 ATP-dependent RNA hel  90.2    0.23   5E-06   44.0   2.7   31    2-32    349-379 (572)
 22 KOG0340|consensus               90.0    0.31 6.8E-06   42.4   3.3   29    2-30    346-374 (442)
 23 PRK11776 ATP-dependent RNA hel  87.2    0.56 1.2E-05   39.7   2.9   33    2-34    334-366 (460)
 24 KOG0329|consensus               86.2    0.34 7.3E-06   41.0   1.1   39    2-40    340-379 (387)
 25 KOG0330|consensus               85.6     1.4 2.9E-05   38.9   4.5   34    2-35    392-425 (476)
 26 KOG0338|consensus               85.5     0.8 1.7E-05   41.7   3.1   29    2-30    518-546 (691)
 27 PRK11192 ATP-dependent RNA hel  83.4       1 2.3E-05   37.6   2.8   31    2-32    337-367 (434)
 28 KOG0332|consensus               83.3     1.8 3.8E-05   38.2   4.2   43    2-44    428-472 (477)
 29 KOG0346|consensus               83.3    0.88 1.9E-05   40.7   2.4   31    2-32    395-425 (569)
 30 COG4371 Predicted membrane pro  78.6     3.3 7.1E-05   34.7   4.1   12   34-45     36-47  (334)
 31 PF08158 NUC130_3NT:  NUC130/3N  76.0     4.2 9.2E-05   25.6   3.2   26   18-43     13-38  (52)
 32 PF05903 Peptidase_C97:  PPPDE   71.9     1.9 4.1E-05   32.0   1.0   40    7-48     99-138 (151)
 33 KOG0921|consensus               69.5      15 0.00031   36.0   6.4   18   13-30   1121-1138(1282)
 34 TIGR00614 recQ_fam ATP-depende  69.3     3.2 6.9E-05   35.5   1.9   29    2-30    318-346 (470)
 35 smart00581 PSP proline-rich do  68.2     3.3 7.1E-05   26.6   1.4   27   20-46      8-34  (54)
 36 KOG0350|consensus               68.2       7 0.00015   35.6   3.8   37    2-38    525-565 (620)
 37 KOG0337|consensus               68.1     3.8 8.1E-05   36.6   2.1   28    3-30    354-381 (529)
 38 KOG0324|consensus               67.7     6.3 0.00014   31.7   3.2   39    7-47    102-140 (214)
 39 PF04046 PSP:  PSP;  InterPro:   67.3     3.7 7.9E-05   25.8   1.4   26   21-46      5-30  (48)
 40 PF08880 QLQ:  QLQ;  InterPro:   65.7     5.7 0.00012   23.4   1.9   31   14-44      3-35  (37)
 41 KOG3703|consensus               64.8     5.6 0.00012   36.9   2.6   22   23-44    848-869 (873)
 42 PF14658 EF-hand_9:  EF-hand do  60.5      12 0.00026   24.8   3.0   40   10-49      3-46  (66)
 43 KOG3023|consensus               59.1      11 0.00024   31.4   3.1   17   31-47    203-219 (285)
 44 cd02116 ACT ACT domains are co  57.0      13 0.00028   19.7   2.4   26   12-37      2-27  (60)
 45 COG4371 Predicted membrane pro  53.6      22 0.00047   29.9   4.1   14   64-77     49-62  (334)
 46 PRK12900 secA preprotein trans  52.8      15 0.00032   35.6   3.4   36    1-36    695-734 (1025)
 47 TIGR00789 flhB_rel flhB C-term  52.7      15 0.00033   25.0   2.6   27   17-45     45-71  (82)
 48 TIGR03629 arch_S13P archaeal r  49.6      20 0.00044   26.8   3.1   25   18-42     53-77  (144)
 49 PF10689 DUF2496:  Protein of u  49.1      18  0.0004   22.3   2.2   17   16-32      6-22  (44)
 50 cd04873 ACT_UUR-ACR-like ACT d  48.1      25 0.00053   21.1   2.8   26   11-36      3-28  (70)
 51 KOG3973|consensus               47.0 1.4E+02  0.0031   26.3   8.1   11   65-75    376-386 (465)
 52 PRK09200 preprotein translocas  47.0      44 0.00096   31.5   5.4   18    2-19    526-543 (790)
 53 PRK12898 secA preprotein trans  46.8      34 0.00074   31.6   4.6   19    1-19    570-588 (656)
 54 COG2257 Uncharacterized homolo  45.8      31 0.00067   24.4   3.3   21   25-45     54-76  (92)
 55 PRK11038 hypothetical protein;  44.5      22 0.00048   22.3   2.1   21   16-38      7-27  (47)
 56 cd02067 B12-binding B12 bindin  44.4      35 0.00076   23.3   3.4   28    9-36     54-82  (119)
 57 TIGR02663 nifX nitrogen fixati  43.9      25 0.00055   24.6   2.7   23   21-43     95-118 (119)
 58 PF06883 RNA_pol_Rpa2_4:  RNA p  43.9     9.7 0.00021   24.4   0.5   30   13-42      3-33  (58)
 59 PF08862 DUF1829:  Domain of un  43.5      26 0.00056   23.9   2.6   31    9-39     55-85  (88)
 60 PRK11057 ATP-dependent DNA hel  42.6      21 0.00046   31.8   2.6   25    2-26    328-352 (607)
 61 cd04903 ACT_LSD C-terminal ACT  42.1      40 0.00087   19.8   3.1   27   11-37      2-28  (71)
 62 PF12279 DUF3619:  Protein of u  40.2      29 0.00062   25.7   2.6   25   17-41      2-26  (131)
 63 PF11051 Mannosyl_trans3:  Mann  40.1      28  0.0006   27.9   2.7   33    7-40      2-34  (271)
 64 PF10978 DUF2785:  Protein of u  40.1      16 0.00036   27.6   1.3   37   10-46    107-146 (175)
 65 cd04926 ACT_ACR_4 C-terminal    39.9      40 0.00087   21.4   3.0   29    8-36      1-29  (72)
 66 PF06012 DUF908:  Domain of Unk  39.1      30 0.00064   28.6   2.8   28   17-45    262-289 (329)
 67 TIGR03714 secA2 accessory Sec   38.8      75  0.0016   30.0   5.6   19    1-19    521-539 (762)
 68 COG2169 Ada Adenosine deaminas  36.9      37  0.0008   26.7   2.9   29   18-48     80-108 (187)
 69 cd04879 ACT_3PGDH-like ACT_3PG  36.6      53  0.0012   19.1   3.0   25   12-36      3-27  (71)
 70 cd04901 ACT_3PGDH C-terminal A  36.6      48   0.001   19.9   2.9   26   11-36      2-27  (69)
 71 PF07905 PucR:  Purine cataboli  36.3      83  0.0018   22.1   4.4   31   18-48     57-99  (123)
 72 PRK08561 rps15p 30S ribosomal   36.1      39 0.00085   25.8   2.8   25   22-46     68-94  (151)
 73 cd04883 ACT_AcuB C-terminal AC  35.9      56  0.0012   19.9   3.1   29    8-36      1-29  (72)
 74 TIGR00643 recG ATP-dependent D  35.9      71  0.0015   28.7   4.8   35    2-36    551-585 (630)
 75 PF09345 DUF1987:  Domain of un  35.4      42 0.00092   23.5   2.7   24    9-32     49-72  (99)
 76 KOG0345|consensus               35.4      29 0.00062   31.5   2.2   18    2-19    349-366 (567)
 77 cd02071 MM_CoA_mut_B12_BD meth  35.2      41  0.0009   23.5   2.7   27    8-34     53-79  (122)
 78 PF05105 Phage_holin_4:  Holin   34.8      57  0.0012   22.8   3.4   25   22-46     89-113 (118)
 79 PF06479 Ribonuc_2-5A:  Ribonuc  34.8      54  0.0012   24.0   3.3   28   18-45     59-89  (129)
 80 KOG4700|consensus               34.7      66  0.0014   25.7   3.9   22   11-32    117-138 (207)
 81 COG3092 Uncharacterized protei  34.3      21 0.00045   27.1   1.0   30    9-38     91-120 (149)
 82 KOG4284|consensus               34.0      29 0.00064   32.9   2.1   39    2-40    364-410 (980)
 83 PRK10917 ATP-dependent DNA hel  33.9      77  0.0017   28.8   4.8   33    2-34    574-606 (681)
 84 PRK02261 methylaspartate mutas  33.9      54  0.0012   23.8   3.2   27    8-34     57-83  (137)
 85 cd04882 ACT_Bt0572_2 C-termina  33.8      63  0.0014   19.0   3.0   26   11-36      2-27  (65)
 86 cd04874 ACT_Af1403 N-terminal   33.5      62  0.0014   19.1   3.0   27   10-36      2-28  (72)
 87 PF01913 FTR:  Formylmethanofur  33.4      66  0.0014   24.5   3.6   33    5-37     68-100 (144)
 88 cd04875 ACT_F4HF-DF N-terminal  33.0      67  0.0014   20.1   3.2   26   11-36      2-27  (74)
 89 PF06348 DUF1059:  Protein of u  33.0 1.3E+02  0.0027   18.9   4.4   38    9-46     13-52  (57)
 90 PF11784 DUF3320:  Protein of u  32.4      57  0.0012   20.1   2.7   28   12-39      3-30  (52)
 91 PRK00194 hypothetical protein;  32.3      80  0.0017   20.5   3.6   29    9-37      4-32  (90)
 92 PF05673 DUF815:  Protein of un  32.3      96  0.0021   25.4   4.6   41    6-46    184-225 (249)
 93 PRK08156 type III secretion sy  32.3      45 0.00097   28.6   2.8   26   17-43    302-327 (361)
 94 TIGR03817 DECH_helic helicase/  32.2      47   0.001   30.6   3.2   30    2-31    371-402 (742)
 95 cd02069 methionine_synthase_B1  31.7      56  0.0012   25.5   3.1   30    8-37    142-171 (213)
 96 PRK09108 type III secretion sy  31.7      37  0.0008   28.8   2.3   26   17-44    309-334 (353)
 97 TIGR01404 FlhB_rel_III type II  31.5      44 0.00095   28.2   2.7   27   17-44    306-332 (342)
 98 COG1938 Archaeal enzymes of AT  31.5      80  0.0017   25.9   4.1   35   11-45    178-214 (244)
 99 PRK13109 flhB flagellar biosyn  31.5      45 0.00098   28.4   2.7   26   17-43    316-341 (358)
100 COG2166 sufE Cysteine desulfur  31.1      59  0.0013   24.6   3.0   24    9-32     70-93  (144)
101 cd02518 GT2_SpsF SpsF is a gly  31.0      41 0.00089   25.4   2.2   37   11-47    187-224 (233)
102 PF12853 NADH_u_ox_C:  C-termin  30.9      59  0.0013   22.9   2.8   26   23-48      2-32  (90)
103 PRK13741 conjugal transfer ent  30.5      36 0.00079   26.6   1.8   29   14-42      2-31  (171)
104 cd04905 ACT_CM-PDT C-terminal   30.5      84  0.0018   20.0   3.4   28    9-36      2-29  (80)
105 cd04899 ACT_ACR-UUR-like_2 C-t  30.4      72  0.0016   19.3   2.9   27   10-36      2-28  (70)
106 cd04411 Ribosomal_P1_P2_L12p R  30.4      78  0.0017   22.5   3.4   28   19-46     16-44  (105)
107 cd04925 ACT_ACR_2 ACT domain-c  30.3      73  0.0016   20.3   3.0   27   10-36      2-28  (74)
108 COG3084 Uncharacterized protei  29.7      67  0.0015   22.3   2.8   28   22-49      6-38  (88)
109 cd04893 ACT_GcvR_1 ACT domains  29.4      83  0.0018   20.2   3.2   27   10-36      3-29  (77)
110 KOG0342|consensus               29.2      43 0.00093   30.4   2.3   27    2-28    422-448 (543)
111 cd04884 ACT_CBS C-terminal ACT  29.1      66  0.0014   20.0   2.6   26   11-36      2-27  (72)
112 PF07894 DUF1669:  Protein of u  29.0      56  0.0012   27.3   2.8   28    9-36    120-150 (284)
113 PTZ00095 40S ribosomal protein  28.7      54  0.0012   25.5   2.5   24   18-41     33-57  (169)
114 PF11848 DUF3368:  Domain of un  28.7      93   0.002   18.7   3.1   24   21-44     20-43  (48)
115 KOG0348|consensus               28.5      50  0.0011   30.7   2.6   25    2-26    539-563 (708)
116 cd04909 ACT_PDH-BS C-terminal   28.2 1.2E+02  0.0026   18.3   3.7   27   10-36      3-29  (69)
117 COG5182 CUS1 Splicing factor 3  28.1      42 0.00091   29.3   2.0   29   20-48    282-310 (429)
118 PRK05298 excinuclease ABC subu  28.0      76  0.0017   28.8   3.7   38    2-39    540-588 (652)
119 cd02070 corrinoid_protein_B12-  27.8      80  0.0017   24.0   3.3   29    9-37    137-167 (201)
120 PRK06298 type III secretion sy  27.8      53  0.0011   28.0   2.5   26   17-43    308-333 (356)
121 PRK13689 hypothetical protein;  27.4   1E+02  0.0022   21.1   3.4   24   19-42     13-36  (75)
122 cd04886 ACT_ThrD-II-like C-ter  27.2      69  0.0015   18.8   2.4   24   13-36      3-26  (73)
123 cd00271 Chemokine_C Chemokine_  26.7   1E+02  0.0022   20.4   3.3   26    9-34     35-68  (72)
124 PRK12721 secretion system appa  26.6      59  0.0013   27.6   2.6   26   17-43    307-332 (349)
125 COG3082 Uncharacterized protei  26.5 1.1E+02  0.0023   20.8   3.3   25   19-43     13-37  (74)
126 PF05014 Nuc_deoxyrib_tr:  Nucl  26.3      14  0.0003   25.4  -1.1   27   10-36      4-30  (113)
127 COG4840 Uncharacterized protei  26.2 1.3E+02  0.0028   20.3   3.6   30   18-47     37-66  (71)
128 KOG1283|consensus               26.1      57  0.0012   28.5   2.4   24    8-31     82-111 (414)
129 PF07197 DUF1409:  Protein of u  25.6      37  0.0008   21.5   0.9   20   27-46     19-38  (51)
130 cd04889 ACT_PDH-BS-like C-term  25.5      82  0.0018   18.4   2.5   26   12-37      2-27  (56)
131 PF04877 Hairpins:  HrpZ;  Inte  25.3      52  0.0011   27.9   2.0   36    8-44    154-194 (308)
132 cd04900 ACT_UUR-like_1 ACT dom  25.3   1E+02  0.0022   19.4   3.0   28    9-36      2-29  (73)
133 TIGR02764 spore_ybaN_pdaB poly  25.2 1.4E+02   0.003   22.0   4.2   27    8-34      7-33  (191)
134 COG4824 Phage-related holin (L  24.8      53  0.0011   24.7   1.8   26   21-46     95-123 (133)
135 TIGR01389 recQ ATP-dependent D  24.5      60  0.0013   28.6   2.4   25    3-27    317-341 (591)
136 PF13625 Helicase_C_3:  Helicas  24.2 1.1E+02  0.0025   21.5   3.4   26   22-47     57-83  (129)
137 PTZ00373 60S Acidic ribosomal   24.1 1.1E+02  0.0025   22.1   3.4   28   19-46     19-47  (112)
138 cd04878 ACT_AHAS N-terminal AC  24.0 1.1E+02  0.0023   17.8   2.8   26   11-36      3-28  (72)
139 TIGR02433 lysidine_TilS_C tRNA  24.0 1.1E+02  0.0024   17.5   2.8   20   22-43     20-39  (47)
140 KOG1891|consensus               23.9      40 0.00087   27.8   1.1   14   33-46    195-208 (271)
141 PRK12773 flhB flagellar biosyn  23.8      66  0.0014   29.9   2.5   28   17-45    606-633 (646)
142 cd00274 Chemokine_CX3C Chemoki  23.7      62  0.0013   21.9   1.8   25    9-33     37-69  (76)
143 PLN00138 large subunit ribosom  23.6 1.1E+02  0.0025   22.0   3.3   28   19-46     17-45  (113)
144 KOG0002|consensus               23.5   1E+02  0.0023   19.3   2.7   21   23-44      8-28  (48)
145 KOG3200|consensus               23.5      50  0.0011   26.5   1.5   14   33-46     63-76  (224)
146 PRK00254 ski2-like helicase; P  23.2 1.4E+02   0.003   27.2   4.4   18    1-18    367-389 (720)
147 PF03444 HrcA_DNA-bdg:  Winged   23.2      63  0.0014   22.1   1.8   25   14-38      2-26  (78)
148 PF13740 ACT_6:  ACT domain; PD  23.1      49  0.0011   21.2   1.2   27   10-36      4-30  (76)
149 PF01312 Bac_export_2:  FlhB Hr  22.8      52  0.0011   27.6   1.6   26   17-43    309-334 (343)
150 PF09350 DUF1992:  Domain of un  22.4 1.3E+02  0.0028   19.7   3.1   20   23-43     39-58  (71)
151 KOG0983|consensus               22.4 1.1E+02  0.0024   26.4   3.5   30   12-41    159-193 (391)
152 cd04908 ACT_Bt0572_1 N-termina  22.1 1.2E+02  0.0026   18.5   2.9   26   11-36      4-29  (66)
153 cd04872 ACT_1ZPV ACT domain pr  22.0 1.3E+02  0.0029   19.5   3.2   27   10-36      3-29  (88)
154 COG5094 TAF9 Transcription ini  22.0      96  0.0021   23.4   2.7   32   15-46     13-46  (145)
155 PTZ00072 40S ribosomal protein  21.8 1.1E+02  0.0024   23.3   3.1   25   22-46     65-91  (148)
156 PF01842 ACT:  ACT domain;  Int  21.7      87  0.0019   18.3   2.1   27   10-36      2-28  (66)
157 KOG0542|consensus               21.6 1.7E+02  0.0036   24.6   4.3   35   11-45    155-189 (280)
158 PF09814 HECT_2:  HECT-like Ubi  21.5      75  0.0016   25.9   2.3   26   19-44    324-349 (354)
159 TIGR02370 pyl_corrinoid methyl  21.4 1.2E+02  0.0025   23.2   3.2   25    9-33    139-163 (197)
160 cd05111 PTK_HER3 Pseudokinase   21.3      44 0.00095   25.4   0.8   22   19-40    255-276 (279)
161 PF10281 Ish1:  Putative stress  21.3 1.7E+02  0.0037   16.5   3.2   16   23-38      7-22  (38)
162 PF01894 UPF0047:  Uncharacteri  21.2 1.4E+02  0.0031   21.5   3.4   18   15-32     35-53  (118)
163 PF00725 3HCDH:  3-hydroxyacyl-  21.2      74  0.0016   20.9   1.8   16   34-49     71-86  (97)
164 PF01090 Ribosomal_S19e:  Ribos  21.1      36 0.00078   25.6   0.3   23   19-41      9-32  (139)
165 smart00229 RasGEFN Guanine nuc  21.1 1.4E+02  0.0031   20.4   3.3   28   18-45     93-121 (127)
166 cd04868 ACT_AK-like ACT domain  20.6 1.7E+02  0.0036   16.1   3.2   26   11-36      3-31  (60)
167 PF02310 B12-binding:  B12 bind  20.6 1.2E+02  0.0026   20.2   2.9   28    9-36     55-82  (121)
168 PF15606 Toxin_55:  Putative to  20.5 1.4E+02  0.0031   20.4   3.1   30   17-46     16-51  (77)
169 cd05833 Ribosomal_P2 Ribosomal  20.5 1.5E+02  0.0032   21.2   3.4   28   19-46     17-45  (109)
170 PF02603 Hpr_kinase_N:  HPr Ser  20.3      72  0.0016   22.8   1.7   18   31-48     88-105 (127)
171 PF11698 V-ATPase_H_C:  V-ATPas  20.2      56  0.0012   23.9   1.1   20   14-33     37-56  (119)
172 PRK09333 30S ribosomal protein  20.2      84  0.0018   23.9   2.1   23   19-41     10-33  (150)
173 PRK06719 precorrin-2 dehydroge  20.1 1.5E+02  0.0033   21.8   3.5   37    9-48    119-156 (157)
174 PF10551 MULE:  MULE transposas  20.0 1.9E+02  0.0042   18.4   3.6   27    9-35     29-55  (93)

No 1  
>KOG0336|consensus
Probab=98.97  E-value=5.2e-10  Score=97.23  Aligned_cols=46  Identities=26%  Similarity=0.341  Sum_probs=44.4

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHHHHHHHhc
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQSVTPALSEMSQMS   47 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L~~~a~~~   47 (121)
                      +|||++|++|||||.+|..+|.+||++|++++|+||++|..||+..
T Consensus       557 GRaGr~G~sis~lt~~D~~~a~eLI~ILe~aeQevPdeL~~mAery  602 (629)
T KOG0336|consen  557 GRAGRTGTSISFLTRNDWSMAEELIQILERAEQEVPDELVRMAERY  602 (629)
T ss_pred             ccCCCCcceEEEEehhhHHHHHHHHHHHHHhhhhCcHHHHHHHHHH
Confidence            7999999999999999999999999999999999999999999864


No 2  
>KOG0335|consensus
Probab=98.92  E-value=1.5e-09  Score=94.49  Aligned_cols=48  Identities=40%  Similarity=0.439  Sum_probs=44.9

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHHHHHHHhccC
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQSVTPALSEMSQMSAM   49 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L~~~a~~~~~   49 (121)
                      +|+|+.|.||+||+.++..++++|+++|+|++|+||+||.+|+.+...
T Consensus       429 GR~Gn~G~atsf~n~~~~~i~~~L~~~l~ea~q~vP~wl~~~~~~~~~  476 (482)
T KOG0335|consen  429 GRVGNGGRATSFFNEKNQNIAKALVEILTEANQEVPQWLSELSREREL  476 (482)
T ss_pred             ccCCCCceeEEEeccccchhHHHHHHHHHHhcccCcHHHHhhhhhccc
Confidence            799999999999999999999999999999999999999998877543


No 3  
>KOG0339|consensus
Probab=98.88  E-value=4.3e-09  Score=93.22  Aligned_cols=49  Identities=29%  Similarity=0.310  Sum_probs=46.2

Q ss_pred             CCCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHHHHHHHhccC
Q psy17913          1 MSSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQSVTPALSEMSQMSAM   49 (121)
Q Consensus         1 ~~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L~~~a~~~~~   49 (121)
                      |+|||.+|+|+|++|++|.++|-+||++|+.++|.||++|.+||...++
T Consensus       559 tgRag~kGvayTlvTeKDa~fAG~LVnnLe~agQnVP~~l~dlamk~s~  607 (731)
T KOG0339|consen  559 TGRAGEKGVAYTLVTEKDAEFAGHLVNNLEGAGQNVPDELMDLAMKSSW  607 (731)
T ss_pred             cccccccceeeEEechhhHHHhhHHHHHHhhccccCChHHHHHHhhhhh
Confidence            6899999999999999999999999999999999999999999986543


No 4  
>PTZ00110 helicase; Provisional
Probab=98.79  E-value=8.7e-09  Score=89.65  Aligned_cols=49  Identities=37%  Similarity=0.531  Sum_probs=45.5

Q ss_pred             CCCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHHHHHHHhccC
Q psy17913          1 MSSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQSVTPALSEMSQMSAM   49 (121)
Q Consensus         1 ~~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L~~~a~~~~~   49 (121)
                      .+|+|++|+||+||+++|..++++|+++|++++|+||+||++|+.....
T Consensus       468 tGR~G~~G~ai~~~~~~~~~~~~~l~~~l~~~~q~vp~~l~~~~~~~~~  516 (545)
T PTZ00110        468 TGRAGAKGASYTFLTPDKYRLARDLVKVLREAKQPVPPELEKLSNERSN  516 (545)
T ss_pred             cccCCCCceEEEEECcchHHHHHHHHHHHHHccCCCCHHHHHHHHHhcC
Confidence            3688889999999999999999999999999999999999999987654


No 5  
>KOG0331|consensus
Probab=98.56  E-value=7.3e-08  Score=84.72  Aligned_cols=48  Identities=42%  Similarity=0.553  Sum_probs=45.0

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHHHHHHHhccC
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQSVTPALSEMSQMSAM   49 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L~~~a~~~~~   49 (121)
                      +||+++|+|+||||+.|..++++|+++|+|++|+||+.|.+++.....
T Consensus       433 GRa~~~G~A~tfft~~~~~~a~~l~~~l~e~~q~v~~~l~~~~~~~~~  480 (519)
T KOG0331|consen  433 GRAGKKGTAITFFTSDNAKLARELIKVLREAGQTVPPDLLEYARVSGS  480 (519)
T ss_pred             ccCCCCceEEEEEeHHHHHHHHHHHHHHHHccCCCChHHHHHHhhccc
Confidence            688889999999999999999999999999999999999999987654


No 6  
>KOG0341|consensus
Probab=98.42  E-value=2.3e-07  Score=80.63  Aligned_cols=45  Identities=27%  Similarity=0.319  Sum_probs=41.2

Q ss_pred             CCCCCceeEEEeeCCC-ChhHHHHHHHHHHHcCCCCChHHHHHHHh
Q psy17913          2 SSQCFIGTAYAFFTPG-NARHAKQLVDVLIEANQSVTPALSEMSQM   46 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~-n~~~a~dLv~lL~ea~QeVP~~L~~~a~~   46 (121)
                      +|+|++|+|+||+|.+ +..++-||..||.|++|+|||.|.+++.+
T Consensus       513 GRsg~~GiATTfINK~~~esvLlDLK~LL~EakQ~vP~~L~~L~~~  558 (610)
T KOG0341|consen  513 GRSGKTGIATTFINKNQEESVLLDLKHLLQEAKQEVPPVLAELAGP  558 (610)
T ss_pred             CCCCCcceeeeeecccchHHHHHHHHHHHHHhhccCCHHHHHhCCC
Confidence            7999999999999987 56789999999999999999999999854


No 7  
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional
Probab=98.29  E-value=8.9e-07  Score=76.48  Aligned_cols=46  Identities=20%  Similarity=0.223  Sum_probs=42.1

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHHHHHHHhc
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQSVTPALSEMSQMS   47 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L~~~a~~~   47 (121)
                      +|+|++|+||+|++++|..++.+|+++|++++|+||+||+++..-.
T Consensus       460 GR~g~~G~ai~f~~~~~~~~~~~l~~~l~~~~~~vp~~l~~~~~~~  505 (518)
T PLN00206        460 SRMGEKGTAIVFVNEEDRNLFPELVALLKSSGAAIPRELANSRYLG  505 (518)
T ss_pred             ccCCCCeEEEEEEchhHHHHHHHHHHHHHHcCCCCCHHHHhChhhh
Confidence            5777789999999999999999999999999999999999988543


No 8  
>KOG0334|consensus
Probab=97.88  E-value=2.2e-05  Score=73.44  Aligned_cols=45  Identities=27%  Similarity=0.307  Sum_probs=42.8

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHHHHHHHh
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQSVTPALSEMSQM   46 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L~~~a~~   46 (121)
                      +|||++|.|+||++|.+..++.||++.|..+.|.+|..|+.|+..
T Consensus       705 gragrkg~AvtFi~p~q~~~a~dl~~al~~~~~~~P~~l~~l~~~  749 (997)
T KOG0334|consen  705 GRAGRKGAAVTFITPDQLKYAGDLCKALELSKQPVPKLLQALSER  749 (997)
T ss_pred             ccCCccceeEEEeChHHhhhHHHHHHHHHhccCCCchHHHHHHHH
Confidence            689999999999999999999999999999999999999999865


No 9  
>KOG0344|consensus
Probab=97.79  E-value=2.9e-05  Score=69.24  Aligned_cols=44  Identities=14%  Similarity=0.271  Sum_probs=42.4

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHHHHHHH
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQSVTPALSEMSQ   45 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L~~~a~   45 (121)
                      +|||+.|.||||||+.|....+-|+++++.+++|||.|+..|..
T Consensus       480 gRag~~g~Aitfytd~d~~~ir~iae~~~~sG~evpe~~m~~~k  523 (593)
T KOG0344|consen  480 GRAGRSGKAITFYTDQDMPRIRSIAEVMEQSGCEVPEKIMGIKK  523 (593)
T ss_pred             CCCCCCcceEEEeccccchhhhhHHHHHHHcCCcchHHHHhhhh
Confidence            79999999999999999999999999999999999999999885


No 10 
>KOG0333|consensus
Probab=97.73  E-value=2.8e-05  Score=69.43  Aligned_cols=45  Identities=24%  Similarity=0.324  Sum_probs=40.3

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHH-cCCCCChHHHHHHHh
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIE-ANQSVTPALSEMSQM   46 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~e-a~QeVP~~L~~~a~~   46 (121)
                      +|||+.|+||||+|+.|..+.+||+++|.+ .+..+|++|....+.
T Consensus       609 gRAGk~GtaiSflt~~dt~v~ydLkq~l~es~~s~~P~Ela~h~~a  654 (673)
T KOG0333|consen  609 GRAGKSGTAISFLTPADTAVFYDLKQALRESVKSHCPPELANHPDA  654 (673)
T ss_pred             cccccCceeEEEeccchhHHHHHHHHHHHHhhhccCChhhccChhh
Confidence            799999999999999999999999998884 577899999877653


No 11 
>KOG0328|consensus
Probab=95.99  E-value=0.0069  Score=51.36  Aligned_cols=42  Identities=10%  Similarity=0.131  Sum_probs=39.3

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHHHHH
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQSVTPALSEM   43 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L~~~   43 (121)
                      +|.|++|+||.|++.+|.++++|+.+.+..+..|+|..+.++
T Consensus       358 GRFGRkGvainFVk~~d~~~lrdieq~yst~i~emp~nvad~  399 (400)
T KOG0328|consen  358 GRFGRKGVAINFVKSDDLRILRDIEQYYSTQIDEMPMNVADL  399 (400)
T ss_pred             cccCCcceEEEEecHHHHHHHHHHHHHHhhhcccccchhhhc
Confidence            688999999999999999999999999999999999987664


No 12 
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional
Probab=95.68  E-value=0.037  Score=47.05  Aligned_cols=32  Identities=9%  Similarity=0.151  Sum_probs=27.4

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcC
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEAN   33 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~   33 (121)
                      +|++++|.||+|++++|..++++|.++|....
T Consensus       337 GR~g~~G~ai~l~~~~d~~~~~~ie~~l~~~~  368 (456)
T PRK10590        337 GRAAATGEALSLVCVDEHKLLRDIEKLLKKEI  368 (456)
T ss_pred             ccCCCCeeEEEEecHHHHHHHHHHHHHhcCCC
Confidence            57778899999999999999999998876543


No 13 
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]
Probab=95.11  E-value=0.025  Score=49.39  Aligned_cols=42  Identities=17%  Similarity=0.120  Sum_probs=34.1

Q ss_pred             CCCCCCceeEEEeeCCC-ChhHHHHHHHHHHHc---CCCCChHHHH
Q psy17913          1 MSSQCFIGTAYAFFTPG-NARHAKQLVDVLIEA---NQSVTPALSE   42 (121)
Q Consensus         1 ~~RaG~~G~AiTFft~~-n~~~a~dLv~lL~ea---~QeVP~~L~~   42 (121)
                      .+|||++|+||+|+++. +...+++|.+.+...   .+++|.+...
T Consensus       364 TgRaG~~G~ai~fv~~~~e~~~l~~ie~~~~~~~~~~~~~~~~~~~  409 (513)
T COG0513         364 TGRAGRKGVAISFVTEEEEVKKLKRIEKRLERKLPSAVLLPLDEPE  409 (513)
T ss_pred             cccCCCCCeEEEEeCcHHHHHHHHHHHHHHhccccccccCCcchhh
Confidence            37999999999999986 889999999988665   4577765443


No 14 
>KOG0327|consensus
Probab=94.48  E-value=0.02  Score=49.40  Aligned_cols=42  Identities=14%  Similarity=0.204  Sum_probs=37.7

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHHHHH
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQSVTPALSEM   43 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L~~~   43 (121)
                      ||+|++|+||+|+++.|.+.++++.+.+...-.|+|....++
T Consensus       355 gr~grkg~~in~v~~~d~~~lk~ie~~y~~~i~e~p~~~~~l  396 (397)
T KOG0327|consen  355 GRFGRKGVAINFVTEEDVRDLKDIEKFYNTPIEELPSNFADL  396 (397)
T ss_pred             cccCCCceeeeeehHhhHHHHHhHHHhcCCcceecccchhhc
Confidence            789999999999999999999999999988888999766543


No 15 
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional
Probab=93.73  E-value=0.055  Score=45.21  Aligned_cols=32  Identities=6%  Similarity=-0.056  Sum_probs=26.5

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcC
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEAN   33 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~   33 (121)
                      +|+|++|+||||+++++....+.|.+.+....
T Consensus       347 gR~G~~G~ai~~~~~~~~~~~~~i~~~~~~~~  378 (423)
T PRK04837        347 GRAGASGHSISLACEEYALNLPAIETYIGHSI  378 (423)
T ss_pred             cCCCCCeeEEEEeCHHHHHHHHHHHHHhCCCC
Confidence            67888999999999998888888877765554


No 16 
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional
Probab=93.21  E-value=0.089  Score=44.81  Aligned_cols=41  Identities=15%  Similarity=0.165  Sum_probs=33.1

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcC-CCCCh-HHHH
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEAN-QSVTP-ALSE   42 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~-QeVP~-~L~~   42 (121)
                      +|+|+.|++|+|++++|..++++|.++|.... +++|+ +|.+
T Consensus       427 GR~g~~g~~i~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~  469 (475)
T PRK01297        427 GRAGASGVSISFAGEDDAFQLPEIEELLGRKISCEMPPAELLK  469 (475)
T ss_pred             CCCCCCceEEEEecHHHHHHHHHHHHHhCCCCcccCCcHHHhh
Confidence            56677899999999999999999999987664 67654 6655


No 17 
>PF14475 Mso1_Sec1_bdg:  Sec1-binding region of Mso1
Probab=92.38  E-value=0.11  Score=31.64  Aligned_cols=25  Identities=12%  Similarity=0.092  Sum_probs=22.2

Q ss_pred             CCChhHHHHHHHHHHHcCCCCChHH
Q psy17913         16 PGNARHAKQLVDVLIEANQSVTPAL   40 (121)
Q Consensus        16 ~~n~~~a~dLv~lL~ea~QeVP~~L   40 (121)
                      +++.-+.+.|++...+..|..|+||
T Consensus        17 eddT~v~r~l~~yY~~k~~~~P~WL   41 (41)
T PF14475_consen   17 EDDTHVHRVLRKYYTEKGRPFPGWL   41 (41)
T ss_pred             cchhHHHHHHHHHHHHcCCCCCCcC
Confidence            4566789999999999999999997


No 18 
>PTZ00424 helicase 45; Provisional
Probab=92.07  E-value=0.12  Score=42.24  Aligned_cols=39  Identities=15%  Similarity=0.156  Sum_probs=31.8

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHH
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQSVTPAL   40 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L   40 (121)
                      +|.+++|.||+|+++++...++.|.+.+...-+++|+..
T Consensus       359 gR~g~~G~~i~l~~~~~~~~~~~~e~~~~~~~~~~~~~~  397 (401)
T PTZ00424        359 GRFGRKGVAINFVTPDDIEQLKEIERHYNTQIEEMPMEV  397 (401)
T ss_pred             ccCCCCceEEEEEcHHHHHHHHHHHHHHCCcccccCcch
Confidence            455678999999999999999999888887777777654


No 19 
>KOG0326|consensus
Probab=90.78  E-value=0.19  Score=43.46  Aligned_cols=39  Identities=10%  Similarity=0.078  Sum_probs=35.7

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHH
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQSVTPAL   40 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L   40 (121)
                      +|.|..|+||+++|.+|...+.++.+-|-...++||+.+
T Consensus       414 GRFGhlGlAInLityedrf~L~~IE~eLGtEI~pip~~i  452 (459)
T KOG0326|consen  414 GRFGHLGLAINLITYEDRFNLYRIEQELGTEIKPIPSNI  452 (459)
T ss_pred             ccCCCcceEEEEEehhhhhhHHHHHHHhccccccCCCcC
Confidence            678889999999999999999999999999999999754


No 20 
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional
Probab=90.75  E-value=0.2  Score=45.00  Aligned_cols=31  Identities=13%  Similarity=0.109  Sum_probs=25.0

Q ss_pred             CCCCCCceeEEEeeCCCChhHHHHHHHHHHH
Q psy17913          1 MSSQCFIGTAYAFFTPGNARHAKQLVDVLIE   31 (121)
Q Consensus         1 ~~RaG~~G~AiTFft~~n~~~a~dLv~lL~e   31 (121)
                      .+|+|++|+||+|+++.+..+++.|.+.++.
T Consensus       336 tGRaGr~G~ai~~v~~~e~~~l~~ie~~~~~  366 (629)
T PRK11634        336 TGRAGRAGRALLFVENRERRLLRNIERTMKL  366 (629)
T ss_pred             ccCCCCcceEEEEechHHHHHHHHHHHHhCC
Confidence            3688899999999999888888877766543


No 21 
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional
Probab=90.20  E-value=0.23  Score=43.97  Aligned_cols=31  Identities=13%  Similarity=0.023  Sum_probs=26.0

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHc
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEA   32 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea   32 (121)
                      +|+|++|+||||+++.+...+++|.+.|...
T Consensus       349 GR~G~~G~ai~~~~~~~~~~l~~i~~~~~~~  379 (572)
T PRK04537        349 ARLGEEGDAISFACERYAMSLPDIEAYIEQK  379 (572)
T ss_pred             ccCCCCceEEEEecHHHHHHHHHHHHHHcCC
Confidence            5778889999999999888888888876544


No 22 
>KOG0340|consensus
Probab=90.05  E-value=0.31  Score=42.39  Aligned_cols=29  Identities=10%  Similarity=0.066  Sum_probs=25.0

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHH
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLI   30 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~   30 (121)
                      -|||+.|.||||||+.|..++..|.+.+-
T Consensus       346 ARAGR~G~aiSivt~rDv~l~~aiE~~ig  374 (442)
T KOG0340|consen  346 ARAGRKGMAISIVTQRDVELLQAIEEEIG  374 (442)
T ss_pred             hcccCCcceEEEechhhHHHHHHHHHHHh
Confidence            48999999999999999988888776554


No 23 
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional
Probab=87.16  E-value=0.56  Score=39.66  Aligned_cols=33  Identities=18%  Similarity=0.188  Sum_probs=27.0

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCC
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQ   34 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~Q   34 (121)
                      +|+|+.|.||+|++++|...+++|.++|...-+
T Consensus       334 GR~g~~G~ai~l~~~~e~~~~~~i~~~~~~~~~  366 (460)
T PRK11776        334 GRAGSKGLALSLVAPEEMQRANAIEDYLGRKLN  366 (460)
T ss_pred             cCCCCcceEEEEEchhHHHHHHHHHHHhCCCCc
Confidence            577778999999999998888888887765433


No 24 
>KOG0329|consensus
Probab=86.17  E-value=0.34  Score=40.96  Aligned_cols=39  Identities=13%  Similarity=0.118  Sum_probs=31.9

Q ss_pred             CCCCCceeEEEeeCCC-ChhHHHHHHHHHHHcCCCCChHH
Q psy17913          2 SSQCFIGTAYAFFTPG-NARHAKQLVDVLIEANQSVTPAL   40 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~-n~~~a~dLv~lL~ea~QeVP~~L   40 (121)
                      +|.|.+|+||||+..+ |..++.++-+-++...+|+|+++
T Consensus       340 grfGtkglaitfvs~e~da~iLn~vqdRf~v~i~eLpdei  379 (387)
T KOG0329|consen  340 GRFGTKGLAITFVSDENDAKILNPVQDRFEVNIKELPDEI  379 (387)
T ss_pred             hccccccceeehhcchhhHHHhchhhHhhhccHhhcCccc
Confidence            6788899999999764 67788888887777788888873


No 25 
>KOG0330|consensus
Probab=85.63  E-value=1.4  Score=38.92  Aligned_cols=34  Identities=12%  Similarity=0.058  Sum_probs=30.4

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCC
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQS   35 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~Qe   35 (121)
                      .|||+.|+||||+|.-|..+...|..+|...-.+
T Consensus       392 aRaGrsG~~ItlVtqyDve~~qrIE~~~gkkl~~  425 (476)
T KOG0330|consen  392 ARAGRSGKAITLVTQYDVELVQRIEHALGKKLPE  425 (476)
T ss_pred             cccCCCcceEEEEehhhhHHHHHHHHHHhcCCCc
Confidence            6899999999999999999999999888877666


No 26 
>KOG0338|consensus
Probab=85.48  E-value=0.8  Score=41.71  Aligned_cols=29  Identities=7%  Similarity=0.133  Sum_probs=26.3

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHH
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLI   30 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~   30 (121)
                      -|||+.|.||||+.++|..+++++++.-.
T Consensus       518 ARAGRaGrsVtlvgE~dRkllK~iik~~~  546 (691)
T KOG0338|consen  518 ARAGRAGRSVTLVGESDRKLLKEIIKSST  546 (691)
T ss_pred             hhcccCcceEEEeccccHHHHHHHHhhhh
Confidence            48999999999999999999999998753


No 27 
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional
Probab=83.37  E-value=1  Score=37.58  Aligned_cols=31  Identities=13%  Similarity=0.061  Sum_probs=26.0

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHc
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEA   32 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea   32 (121)
                      +|+|++|+||+|+++.|..++.+|.+.|.+.
T Consensus       337 gR~g~~g~ai~l~~~~d~~~~~~i~~~~~~~  367 (434)
T PRK11192        337 GRAGRKGTAISLVEAHDHLLLGKIERYIEEP  367 (434)
T ss_pred             ccCCCCceEEEEecHHHHHHHHHHHHHHhcc
Confidence            5778889999999999998888888776543


No 28 
>KOG0332|consensus
Probab=83.33  E-value=1.8  Score=38.16  Aligned_cols=43  Identities=9%  Similarity=0.012  Sum_probs=31.4

Q ss_pred             CCCCCceeEEEeeCCC-ChhHHHHHHHHHHHc-CCCCChHHHHHH
Q psy17913          2 SSQCFIGTAYAFFTPG-NARHAKQLVDVLIEA-NQSVTPALSEMS   44 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~-n~~~a~dLv~lL~ea-~QeVP~~L~~~a   44 (121)
                      +|.|++|+||.|+..+ +.+++..|.+.+... .+-+|+.++++-
T Consensus       428 GRFGkkG~a~n~v~~~~s~~~mn~iq~~F~~~i~~~~~~d~~E~e  472 (477)
T KOG0332|consen  428 GRFGKKGLAINLVDDKDSMNIMNKIQKHFNMKIKRLDPDDLDELE  472 (477)
T ss_pred             ccccccceEEEeecccCcHHHHHHHHHHHhhcceecCCccHHHHH
Confidence            7899999999999876 567777787777544 445566555553


No 29 
>KOG0346|consensus
Probab=83.26  E-value=0.88  Score=40.73  Aligned_cols=31  Identities=23%  Similarity=0.305  Sum_probs=27.1

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHc
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEA   32 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea   32 (121)
                      .|++++|+|+||+.|++.....+|.++|++.
T Consensus       395 aRg~n~GtalSfv~P~e~~g~~~le~~~~d~  425 (569)
T KOG0346|consen  395 ARGNNKGTALSFVSPKEEFGKESLESILKDE  425 (569)
T ss_pred             ccCCCCCceEEEecchHHhhhhHHHHHHhhH
Confidence            5889999999999999887778888888875


No 30 
>COG4371 Predicted membrane protein [Function unknown]
Probab=78.62  E-value=3.3  Score=34.73  Aligned_cols=12  Identities=17%  Similarity=0.075  Sum_probs=5.6

Q ss_pred             CCCChHHHHHHH
Q psy17913         34 QSVTPALSEMSQ   45 (121)
Q Consensus        34 QeVP~~L~~~a~   45 (121)
                      --+||-.++.++
T Consensus        36 l~~~p~~~a~aa   47 (334)
T COG4371          36 LFVPPLSVAAAA   47 (334)
T ss_pred             HcCCchHHHHHH
Confidence            345555444443


No 31 
>PF08158 NUC130_3NT:  NUC130/3NT domain;  InterPro: IPR012977 This N-terminal domain is found in a novel nucleolar protein family defined by NUC130/133 [].
Probab=75.98  E-value=4.2  Score=25.62  Aligned_cols=26  Identities=19%  Similarity=0.363  Sum_probs=22.6

Q ss_pred             ChhHHHHHHHHHHHcCCCCChHHHHH
Q psy17913         18 NARHAKQLVDVLIEANQSVTPALSEM   43 (121)
Q Consensus        18 n~~~a~dLv~lL~ea~QeVP~~L~~~   43 (121)
                      -+.+..+|+++|++..+.++|+|..-
T Consensus        13 ~~~Fp~~L~~lL~~~~~~L~p~lR~~   38 (52)
T PF08158_consen   13 TKDFPQELIDLLRNHHTVLDPDLRMK   38 (52)
T ss_pred             HHHHHHHHHHHHHhccccCCHHHHHH
Confidence            46788999999999999999998753


No 32 
>PF05903 Peptidase_C97:  PPPDE putative peptidase domain;  InterPro: IPR008580 This domain consists of the N-terminal portion of several eukaryotic sequences. The function of this domain is unknown.; PDB: 2WP7_A 3EBQ_A.
Probab=71.87  E-value=1.9  Score=32.02  Aligned_cols=40  Identities=10%  Similarity=0.339  Sum_probs=27.9

Q ss_pred             ceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHHHHHHHhcc
Q psy17913          7 IGTAYAFFTPGNARHAKQLVDVLIEANQSVTPALSEMSQMSA   48 (121)
Q Consensus         7 ~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L~~~a~~~~   48 (121)
                      ++.+|.+++.+.-.++.+|++.|.  ...||.|+.++|....
T Consensus        99 ~~~~Y~Ll~~NCNhFs~~l~~~L~--g~~iP~~i~~~a~~~~  138 (151)
T PF05903_consen   99 TGDSYHLLNRNCNHFSDALCQFLT--GKPIPSWINRLARIAL  138 (151)
T ss_dssp             SGGG-BTTTBSHHHHHHHHHHHHH--S----HHHHTHHHHHH
T ss_pred             cCCcchhhhhhhhHHHHHHHHHhC--CCCCCHHHHhhhHHhc
Confidence            455677788777889999999996  4689999999987643


No 33 
>KOG0921|consensus
Probab=69.52  E-value=15  Score=35.97  Aligned_cols=18  Identities=28%  Similarity=0.287  Sum_probs=8.2

Q ss_pred             eeCCCChhHHHHHHHHHH
Q psy17913         13 FFTPGNARHAKQLVDVLI   30 (121)
Q Consensus        13 Fft~~n~~~a~dLv~lL~   30 (121)
                      =++|-|.+|+.-|.+|-+
T Consensus      1121 qLdpvnarllnmiRdIs~ 1138 (1282)
T KOG0921|consen 1121 QLDPVNARLLNMIRDISR 1138 (1282)
T ss_pred             ccCchhHHHHHHHHHhcc
Confidence            344555555444444333


No 34 
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=69.30  E-value=3.2  Score=35.52  Aligned_cols=29  Identities=10%  Similarity=0.203  Sum_probs=22.7

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHH
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLI   30 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~   30 (121)
                      +|.|+.+.|++|+++.|...++.|+....
T Consensus       318 GR~G~~~~~~~~~~~~d~~~~~~~~~~~~  346 (470)
T TIGR00614       318 GRDGLPSECHLFYAPADINRLRRLLMEEP  346 (470)
T ss_pred             CCCCCCceEEEEechhHHHHHHHHHhcCC
Confidence            45666789999999999888888776443


No 35 
>smart00581 PSP proline-rich domain in spliceosome associated proteins.
Probab=68.25  E-value=3.3  Score=26.61  Aligned_cols=27  Identities=22%  Similarity=0.238  Sum_probs=22.0

Q ss_pred             hHHHHHHHHHHHcCCCCChHHHHHHHh
Q psy17913         20 RHAKQLVDVLIEANQSVTPALSEMSQM   46 (121)
Q Consensus        20 ~~a~dLv~lL~ea~QeVP~~L~~~a~~   46 (121)
                      .+..+|.+.|--...++|+||..|.+-
T Consensus         8 ~lS~~LR~ALG~~~~~pPPWl~~Mq~~   34 (54)
T smart00581        8 RISDELREALGLPPGQPPPWLYRMRRL   34 (54)
T ss_pred             cCCHHHHHHcCCCCCCCChHHHHHHHH
Confidence            456788888888888999999999764


No 36 
>KOG0350|consensus
Probab=68.16  E-value=7  Score=35.62  Aligned_cols=37  Identities=14%  Similarity=0.019  Sum_probs=27.8

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHH----cCCCCCh
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIE----ANQSVTP   38 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~e----a~QeVP~   38 (121)
                      .|||..|.|||.++..+.++..+|++.+..    ..|.+|.
T Consensus       525 ARAgq~G~a~tll~~~~~r~F~klL~~~~~~d~~~i~~~e~  565 (620)
T KOG0350|consen  525 ARAGQDGYAITLLDKHEKRLFSKLLKKTNLWDGVEIQPIEY  565 (620)
T ss_pred             ccccCCceEEEeeccccchHHHHHHHHhcccCCcceeecCc
Confidence            589999999999999998887777665443    3455554


No 37 
>KOG0337|consensus
Probab=68.14  E-value=3.8  Score=36.61  Aligned_cols=28  Identities=18%  Similarity=0.097  Sum_probs=23.1

Q ss_pred             CCCCceeEEEeeCCCChhHHHHHHHHHH
Q psy17913          3 SQCFIGTAYAFFTPGNARHAKQLVDVLI   30 (121)
Q Consensus         3 RaG~~G~AiTFft~~n~~~a~dLv~lL~   30 (121)
                      |||++|+||+|+++.+...+-||-..|-
T Consensus       354 ragrtg~aYs~V~~~~~~yl~DL~lflg  381 (529)
T KOG0337|consen  354 RAGRTGRAYSLVASTDDPYLLDLQLFLG  381 (529)
T ss_pred             hccccceEEEEEecccchhhhhhhhhcC
Confidence            7899999999999988877777765443


No 38 
>KOG0324|consensus
Probab=67.69  E-value=6.3  Score=31.73  Aligned_cols=39  Identities=13%  Similarity=0.296  Sum_probs=30.2

Q ss_pred             ceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHHHHHHHhc
Q psy17913          7 IGTAYAFFTPGNARHAKQLVDVLIEANQSVTPALSEMSQMS   47 (121)
Q Consensus         7 ~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L~~~a~~~   47 (121)
                      +|.+|.+++.+--.+..+|...|  +..+||.|+.+||...
T Consensus       102 ~G~~YhL~~kNCNHFsn~la~~L--tgk~IP~winrLa~~~  140 (214)
T KOG0324|consen  102 RGNSYHLLTKNCNHFSNELALQL--TGKKIPSWVNRLARAG  140 (214)
T ss_pred             CCceehhhhhccchhHHHHHHHH--cCCCccHHHHHHHHHh
Confidence            57788888877666777776655  6789999999998764


No 39 
>PF04046 PSP:  PSP;  InterPro: IPR006568 PSP is a proline-rich domain of unknown function found in spliceosome associated proteins.
Probab=67.35  E-value=3.7  Score=25.76  Aligned_cols=26  Identities=19%  Similarity=0.243  Sum_probs=21.0

Q ss_pred             HHHHHHHHHHHcCCCCChHHHHHHHh
Q psy17913         21 HAKQLVDVLIEANQSVTPALSEMSQM   46 (121)
Q Consensus        21 ~a~dLv~lL~ea~QeVP~~L~~~a~~   46 (121)
                      +..+|.+.|--...++|+||..|..-
T Consensus         5 lS~~LR~ALg~~~~~~PPwl~~M~~~   30 (48)
T PF04046_consen    5 LSDELREALGMQENDPPPWLYRMRRL   30 (48)
T ss_pred             cCHHHHHHcCCCCCCCChHHHHHHhc
Confidence            45678888877788899999999764


No 40 
>PF08880 QLQ:  QLQ;  InterPro: IPR014978 QLQ is named after the conserved Gln, Leu, Gln motif. QLQ is found at the N terminus of SWI2/SNF2 protein, which has been shown to be involved in protein-protein interactions. QLQ has been postulated to be involved in mediating protein interactions []. ; GO: 0005524 ATP binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=65.70  E-value=5.7  Score=23.42  Aligned_cols=31  Identities=26%  Similarity=0.393  Sum_probs=18.6

Q ss_pred             eCCCChhHHHHHHHHHH--HcCCCCChHHHHHH
Q psy17913         14 FTPGNARHAKQLVDVLI--EANQSVTPALSEMS   44 (121)
Q Consensus        14 ft~~n~~~a~dLv~lL~--ea~QeVP~~L~~~a   44 (121)
                      ||+.....++.=+.+++  .+++.||++|+...
T Consensus         3 FT~~Ql~~L~~Qi~ayK~l~~~~pVP~~l~~~I   35 (37)
T PF08880_consen    3 FTPAQLQELRAQILAYKYLARNQPVPPQLQQAI   35 (37)
T ss_pred             CCHHHHHHHHHHHHHHHHHHcCCCCCHHHHHhh
Confidence            55554444444333332  56999999998653


No 41 
>KOG3703|consensus
Probab=64.77  E-value=5.6  Score=36.88  Aligned_cols=22  Identities=23%  Similarity=0.213  Sum_probs=18.8

Q ss_pred             HHHHHHHHHcCCCCChHHHHHH
Q psy17913         23 KQLVDVLIEANQSVTPALSEMS   44 (121)
Q Consensus        23 ~dLv~lL~ea~QeVP~~L~~~a   44 (121)
                      -+|.++|..-.|+||.||++--
T Consensus       848 ~eLsKlL~klgqpiPsWLre~l  869 (873)
T KOG3703|consen  848 VELSKLLHKLGQPIPSWLREEL  869 (873)
T ss_pred             HHHHHHHHHcCCCCcHHHHHHh
Confidence            3688999999999999998743


No 42 
>PF14658 EF-hand_9:  EF-hand domain
Probab=60.45  E-value=12  Score=24.78  Aligned_cols=40  Identities=15%  Similarity=0.198  Sum_probs=27.9

Q ss_pred             EEEeeCCCCh-hH-HHHHHHHHHHcCCCCCh--HHHHHHHhccC
Q psy17913         10 AYAFFTPGNA-RH-AKQLVDVLIEANQSVTP--ALSEMSQMSAM   49 (121)
Q Consensus        10 AiTFft~~n~-~~-a~dLv~lL~ea~QeVP~--~L~~~a~~~~~   49 (121)
                      ++..|++++. .+ +++|+.+|+...+.-|+  .|++|+.+.-.
T Consensus         3 ~F~~fD~~~tG~V~v~~l~~~Lra~~~~~p~e~~Lq~l~~elDP   46 (66)
T PF14658_consen    3 AFDAFDTQKTGRVPVSDLITYLRAVTGRSPEESELQDLINELDP   46 (66)
T ss_pred             chhhcCCcCCceEeHHHHHHHHHHHcCCCCcHHHHHHHHHHhCC
Confidence            3455665543 33 78999999999885553  68899887643


No 43 
>KOG3023|consensus
Probab=59.10  E-value=11  Score=31.43  Aligned_cols=17  Identities=18%  Similarity=0.208  Sum_probs=14.2

Q ss_pred             HcCCCCChHHHHHHHhc
Q psy17913         31 EANQSVTPALSEMSQMS   47 (121)
Q Consensus        31 ea~QeVP~~L~~~a~~~   47 (121)
                      ..|+.|||+|+++|..+
T Consensus       203 ~~cCvvPpdLqafa~~h  219 (285)
T KOG3023|consen  203 GQCCVVPPDLQAFADRH  219 (285)
T ss_pred             cccccCCHHHHHHhhhc
Confidence            34889999999999865


No 44 
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. Members of this CD belong to the superfamily of ACT regulatory domains. Pairs of ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. The ACT domain has been detected in a number of diverse proteins; some of these proteins are involved in amino acid and purine biosynthesis, phenylalanine hydroxylation, regulation of bacterial metabolism and transcription, and many remain to be characterized. ACT domain-containing enzymes involved in amino acid and purine synthesis are in many cases allosteric enzymes with complex regulation enforced by the binding of ligands. The ACT domain is commonly involved in the binding of a small regulatory molecule, such as the amino acids L-Ser and L-Phe in the case of D-3-phosphoglycerate dehydrogenase and the bifunctional chorismate mutase-p
Probab=57.03  E-value=13  Score=19.71  Aligned_cols=26  Identities=23%  Similarity=0.307  Sum_probs=20.1

Q ss_pred             EeeCCCChhHHHHHHHHHHHcCCCCC
Q psy17913         12 AFFTPGNARHAKQLVDVLIEANQSVT   37 (121)
Q Consensus        12 TFft~~n~~~a~dLv~lL~ea~QeVP   37 (121)
                      ++..++++.++.+|+++|.+.+..|.
T Consensus         2 ~i~~~~~~~~l~~i~~~l~~~~~~i~   27 (60)
T cd02116           2 TVSGPDRPGLLAKVLSVLAEAGINIT   27 (60)
T ss_pred             EEEecCCCchHHHHHHHHHHCCCcEE
Confidence            55666777889999999998776653


No 45 
>COG4371 Predicted membrane protein [Function unknown]
Probab=53.63  E-value=22  Score=29.94  Aligned_cols=14  Identities=43%  Similarity=0.895  Sum_probs=9.5

Q ss_pred             CCCCCCCCCCCCCC
Q psy17913         64 SGGGGGGGGYKRKN   77 (121)
Q Consensus        64 ggg~fg~rd~r~~~   77 (121)
                      +|+++|+..||-.+
T Consensus        49 SGGriGGgSfraps   62 (334)
T COG4371          49 SGGRIGGGSFRAPS   62 (334)
T ss_pred             hCCCccCCCCCCCC
Confidence            55567777787665


No 46 
>PRK12900 secA preprotein translocase subunit SecA; Reviewed
Probab=52.82  E-value=15  Score=35.63  Aligned_cols=36  Identities=8%  Similarity=0.086  Sum_probs=26.2

Q ss_pred             CCCCCCceeEEEeeCCCChhH---H-HHHHHHHHHcCCCC
Q psy17913          1 MSSQCFIGTAYAFFTPGNARH---A-KQLVDVLIEANQSV   36 (121)
Q Consensus         1 ~~RaG~~G~AiTFft~~n~~~---a-~dLv~lL~ea~QeV   36 (121)
                      .+|+|..|+|++|++.+|.=+   . ..|.++|.....+.
T Consensus       695 tGRqGdpGsS~ffvSleD~Lmr~f~~~~i~~~~~~~~~~e  734 (1025)
T PRK12900        695 AGRQGDPGESVFYVSLEDELMRLFGSDRVISVMDRLGHEE  734 (1025)
T ss_pred             hhcCCCCcceEEEechhHHHHHhhCcHHHHHHHHHcCCCC
Confidence            378999999999999887532   2 25777887766533


No 47 
>TIGR00789 flhB_rel flhB C-terminus-related protein. This model describes a short protein (80-93 residues) homologous to the C-terminus of the flagellar biosynthetic protein FlhB. It is found so far only in species that also have FlhB. In a phylogenetic tree based on alignment of both this family and the homologous region of FlhB and its homologs, the members of this family form a monophyletic set.
Probab=52.66  E-value=15  Score=25.01  Aligned_cols=27  Identities=11%  Similarity=0.265  Sum_probs=18.6

Q ss_pred             CChhHHHHHHHHHHHcCCCCChHHHHHHH
Q psy17913         17 GNARHAKQLVDVLIEANQSVTPALSEMSQ   45 (121)
Q Consensus        17 ~n~~~a~dLv~lL~ea~QeVP~~L~~~a~   45 (121)
                      .|..+|+.|.+  .+.+|+||++|-+...
T Consensus        45 ~~~~LAr~L~~--~~ig~~IP~~ly~aVA   71 (82)
T TIGR00789        45 EDPDLVDVLLK--LDLDDEIPEELYEVVA   71 (82)
T ss_pred             eCHHHHHHHHh--CCCCCccCHHHHHHHH
Confidence            46777777763  4678999987765443


No 48 
>TIGR03629 arch_S13P archaeal ribosomal protein S13P. This model describes exclusively the archaeal ribosomal protein S13P. It excludes the homologous eukaryotic 40S ribosomal protein S18 and bacterial 30S ribosomal protein S13.
Probab=49.56  E-value=20  Score=26.83  Aligned_cols=25  Identities=8%  Similarity=0.131  Sum_probs=19.7

Q ss_pred             ChhHHHHHHHHHHHcCCCCChHHHH
Q psy17913         18 NARHAKQLVDVLIEANQSVTPALSE   42 (121)
Q Consensus        18 n~~~a~dLv~lL~ea~QeVP~~L~~   42 (121)
                      +...+..|.++|++....||.||.+
T Consensus        53 t~~qi~~l~~~i~~~~~~iP~w~~N   77 (144)
T TIGR03629        53 DDEEIEKLEEAVENYEYGIPSWLLN   77 (144)
T ss_pred             CHHHHHHHHHHHHhccccCCHHHhh
Confidence            4556788888888877899999964


No 49 
>PF10689 DUF2496:  Protein of unknown function (DUF2496);  InterPro: IPR019630  This family consists of proteins from Gammaproteobacteria species. Many members are annotated as being like the Escherichia coli protein; YbaM. 
Probab=49.12  E-value=18  Score=22.34  Aligned_cols=17  Identities=24%  Similarity=0.362  Sum_probs=13.7

Q ss_pred             CCChhHHHHHHHHHHHc
Q psy17913         16 PGNARHAKQLVDVLIEA   32 (121)
Q Consensus        16 ~~n~~~a~dLv~lL~ea   32 (121)
                      |.+.++|-|||-+|++.
T Consensus         6 p~evkLAVDLI~LLE~n   22 (44)
T PF10689_consen    6 PDEVKLAVDLIYLLESN   22 (44)
T ss_pred             cHHHHHHHHHHHHHHhc
Confidence            45678999999988765


No 50 
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD. This ACT domain family, ACT_UUR_ACR-like, includes the two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; including those enzymes similar to the GlnD found in enteric Escherichia coli and those found in photosynthetic, nitrogen-fixing bacterium Rhodospirillum rubrum. Also included in this CD are the four ACT domains of a novel protein composed almost entirely of ACT domain repeats (the ACR protein) and like proteins. These ACR proteins, found in Arabidopsis and Oryza, are proposed to function as novel regulatory or sensor proteins in plants. This CD also includes the first of the two ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein and related domains, as well as, the N-terminal ACT domain of a yet characterized Arabidopsis/Oryza predicted t
Probab=48.07  E-value=25  Score=21.08  Aligned_cols=26  Identities=12%  Similarity=0.294  Sum_probs=22.3

Q ss_pred             EEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         11 YAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        11 iTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      +++..++.+.++.+|..+|.+.+..|
T Consensus         3 l~i~~~d~~g~l~~i~~~l~~~~~~I   28 (70)
T cd04873           3 VEVYAPDRPGLLADITRVLADLGLNI   28 (70)
T ss_pred             EEEEeCCCCCHHHHHHHHHHHCCCeE
Confidence            56777888889999999999988766


No 51 
>KOG3973|consensus
Probab=46.99  E-value=1.4e+02  Score=26.28  Aligned_cols=11  Identities=73%  Similarity=1.694  Sum_probs=5.6

Q ss_pred             CCCCCCCCCCC
Q psy17913         65 GGGGGGGGYKR   75 (121)
Q Consensus        65 gg~fg~rd~r~   75 (121)
                      +++.|++.|-|
T Consensus       376 gG~GGGggyqq  386 (465)
T KOG3973|consen  376 GGRGGGGGYQQ  386 (465)
T ss_pred             CCCCCCCCCcC
Confidence            33345566654


No 52 
>PRK09200 preprotein translocase subunit SecA; Reviewed
Probab=46.99  E-value=44  Score=31.50  Aligned_cols=18  Identities=17%  Similarity=0.137  Sum_probs=15.8

Q ss_pred             CCCCCceeEEEeeCCCCh
Q psy17913          2 SSQCFIGTAYAFFTPGNA   19 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~   19 (121)
                      +|+|++|+|++|++.+|.
T Consensus       526 GR~G~~G~s~~~is~eD~  543 (790)
T PRK09200        526 GRQGDPGSSQFFISLEDD  543 (790)
T ss_pred             cCCCCCeeEEEEEcchHH
Confidence            688899999999998764


No 53 
>PRK12898 secA preprotein translocase subunit SecA; Reviewed
Probab=46.77  E-value=34  Score=31.58  Aligned_cols=19  Identities=16%  Similarity=0.034  Sum_probs=16.3

Q ss_pred             CCCCCCceeEEEeeCCCCh
Q psy17913          1 MSSQCFIGTAYAFFTPGNA   19 (121)
Q Consensus         1 ~~RaG~~G~AiTFft~~n~   19 (121)
                      .+|+|++|++++|++.+|.
T Consensus       570 TGRqG~~G~s~~~is~eD~  588 (656)
T PRK12898        570 CGRQGDPGSYEAILSLEDD  588 (656)
T ss_pred             ccCCCCCeEEEEEechhHH
Confidence            3788999999999998764


No 54 
>COG2257 Uncharacterized homolog of the cytoplasmic domain of flagellar protein FhlB [Function unknown]
Probab=45.77  E-value=31  Score=24.44  Aligned_cols=21  Identities=29%  Similarity=0.499  Sum_probs=12.1

Q ss_pred             HHHHHH--HcCCCCChHHHHHHH
Q psy17913         25 LVDVLI--EANQSVTPALSEMSQ   45 (121)
Q Consensus        25 Lv~lL~--ea~QeVP~~L~~~a~   45 (121)
                      |+++|.  +-+.+||++|-+...
T Consensus        54 Lv~~L~~lelg~~IPeelY~vVA   76 (92)
T COG2257          54 LVELLLKLELGDEIPEELYEVVA   76 (92)
T ss_pred             HHHHHHhccccccCCHHHHHHHH
Confidence            444443  336778887766544


No 55 
>PRK11038 hypothetical protein; Provisional
Probab=44.47  E-value=22  Score=22.26  Aligned_cols=21  Identities=29%  Similarity=0.521  Sum_probs=15.4

Q ss_pred             CCChhHHHHHHHHHHHcCCCCCh
Q psy17913         16 PGNARHAKQLVDVLIEANQSVTP   38 (121)
Q Consensus        16 ~~n~~~a~dLv~lL~ea~QeVP~   38 (121)
                      |.+.++|-|||-+|++.  +|+|
T Consensus         7 p~evkLAVDLI~LLE~n--~i~p   27 (47)
T PRK11038          7 PDEVKLAVDLIYLLEEN--EIPP   27 (47)
T ss_pred             cHHHHHHHHHHHHHHhc--CCCH
Confidence            45678999999988765  3444


No 56 
>cd02067 B12-binding B12 binding domain (B12-BD). This domain binds different cobalamid derivates, like B12 (adenosylcobamide) or methylcobalamin or methyl-Co(III) 5-hydroxybenzimidazolylcobamide, it is found in several enzymes, such as glutamate mutase, methionine synthase and methylmalonyl-CoA mutase. Cobalamin undergoes a conformational change on binding the protein; the dimethylbenzimidazole group, which is coordinated to the cobalt in the free cofactor, moves away from the corrin and is replaced by a histidine contributed by the protein. The sequence Asp-X-His-X-X-Gly, which contains this histidine ligand, is conserved in many cobalamin-binding proteins.
Probab=44.38  E-value=35  Score=23.31  Aligned_cols=28  Identities=14%  Similarity=0.170  Sum_probs=20.3

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHcCC-CC
Q psy17913          9 TAYAFFTPGNARHAKQLVDVLIEANQ-SV   36 (121)
Q Consensus         9 ~AiTFft~~n~~~a~dLv~lL~ea~Q-eV   36 (121)
                      +++|+........+++|++.|++... .|
T Consensus        54 V~iS~~~~~~~~~~~~~i~~l~~~~~~~~   82 (119)
T cd02067          54 IGLSGLLTTHMTLMKEVIEELKEAGLDDI   82 (119)
T ss_pred             EEEeccccccHHHHHHHHHHHHHcCCCCC
Confidence            45666666677788888888888765 44


No 57 
>TIGR02663 nifX nitrogen fixation protein NifX. Members of this family are NifX proteins encoded within operons for nitrogen fixation in a number of bacteria. NifX, NafY, and the C-terminal region of NifB all belong to the Pfam family pfam02579 and are involved in MoFe cofactor biosynthesis. NifX is a nitrogenase accessory protein with a role in expression of the MoFe cofactor.
Probab=43.94  E-value=25  Score=24.63  Aligned_cols=23  Identities=17%  Similarity=0.196  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHcC-CCCChHHHHH
Q psy17913         21 HAKQLVDVLIEAN-QSVTPALSEM   43 (121)
Q Consensus        21 ~a~dLv~lL~ea~-QeVP~~L~~~   43 (121)
                      .+.|+++.|++.- ...|+||+..
T Consensus        95 ~v~eal~~l~~~~~~~~~~w~~~~  118 (119)
T TIGR02663        95 SISELLERLQKMLKGNPPPWLRKA  118 (119)
T ss_pred             cHHHHHHHHHHHHcCCCCHHHHhh
Confidence            4566666666554 5788999863


No 58 
>PF06883 RNA_pol_Rpa2_4:  RNA polymerase I, Rpa2 specific domain ;  InterPro: IPR009674 This domain is found between domain 3 and domain 5, but shows no homology to domain 4 of Rpb2. The external domains in multisubunit RNA polymerase (those most distant from the active site) are known to demonstrate more sequence variability [].; GO: 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent, 0005634 nucleus
Probab=43.90  E-value=9.7  Score=24.44  Aligned_cols=30  Identities=20%  Similarity=0.358  Sum_probs=16.3

Q ss_pred             eeCCCChhHHHHHHHHHHHcC-CCCChHHHH
Q psy17913         13 FFTPGNARHAKQLVDVLIEAN-QSVTPALSE   42 (121)
Q Consensus        13 Fft~~n~~~a~dLv~lL~ea~-QeVP~~L~~   42 (121)
                      ++++++...+.+-++.||... ..||++||-
T Consensus         3 ~~~~~~a~~~~~~LR~~Kv~~~~~vP~~lEI   33 (58)
T PF06883_consen    3 YVSPEEAEQIADQLRYLKVEGEHGVPPTLEI   33 (58)
T ss_pred             eecHHHHHHHHHHHHHHHHcCCCCCCCceEE
Confidence            344444444444444444444 689988863


No 59 
>PF08862 DUF1829:  Domain of unknown function DUF1829;  InterPro: IPR014961 This short protein is usually associated with IPR014960 from INTERPRO. 
Probab=43.53  E-value=26  Score=23.90  Aligned_cols=31  Identities=13%  Similarity=0.230  Sum_probs=24.8

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHcCCCCChH
Q psy17913          9 TAYAFFTPGNARHAKQLVDVLIEANQSVTPA   39 (121)
Q Consensus         9 ~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~   39 (121)
                      ..+.|+++.+.++..+++++|++.+-+|=+|
T Consensus        55 ~~~ii~ND~e~~i~~~~~~a~~~y~I~~i~w   85 (88)
T PF08862_consen   55 KFYIILNDSEKPISEDIINALEQYNIKPIPW   85 (88)
T ss_pred             eEEEEECCCCCccCHHHHHHHHHCCCceecC
Confidence            3467788888889899999999888776665


No 60 
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional
Probab=42.61  E-value=21  Score=31.81  Aligned_cols=25  Identities=12%  Similarity=0.315  Sum_probs=18.5

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHH
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLV   26 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv   26 (121)
                      +|.|..+.||+||++.|...++.|+
T Consensus       328 GR~G~~~~~ill~~~~d~~~~~~~~  352 (607)
T PRK11057        328 GRDGLPAEAMLFYDPADMAWLRRCL  352 (607)
T ss_pred             cCCCCCceEEEEeCHHHHHHHHHHH
Confidence            4555567899999998876666554


No 61 
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit. The C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit, found in various bacterial anaerobes such as Clostridium, Bacillis, and Treponema species. These enzymes catalyze the deamination of L-serine, producing pyruvate and ammonia. Unlike the eukaryotic L-serine dehydratase, which requires the pyridoxal-5'-phosphate (PLP) cofactor, the prokaryotic L-serine dehydratase contains an [4Fe-4S] cluster instead of a PLP active site. The LSD alpha and beta subunits of the 'clostridial' enzyme are encoded by the sdhA and sdhB genes. The single subunit bacterial homologs of L-serine dehydratase (LSD1, LSD2, TdcG) present in Escherichia coli, and other enterobacterials, lack the ACT domain described here. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=42.08  E-value=40  Score=19.82  Aligned_cols=27  Identities=7%  Similarity=0.158  Sum_probs=21.4

Q ss_pred             EEeeCCCChhHHHHHHHHHHHcCCCCC
Q psy17913         11 YAFFTPGNARHAKQLVDVLIEANQSVT   37 (121)
Q Consensus        11 iTFft~~n~~~a~dLv~lL~ea~QeVP   37 (121)
                      ++++.++.+.++.+|.++|.+++..|.
T Consensus         2 l~i~~~d~~g~l~~i~~~l~~~~~~I~   28 (71)
T cd04903           2 LIVVHKDKPGAIAKVTSVLADHEINIA   28 (71)
T ss_pred             EEEEeCCCCChHHHHHHHHHHcCcCee
Confidence            456677777889999999998887763


No 62 
>PF12279 DUF3619:  Protein of unknown function (DUF3619);  InterPro: IPR022064  This protein is found in bacteria. Proteins in this family are about 140 amino acids in length. This protein has two conserved sequence motifs: AAR and DDLP. 
Probab=40.17  E-value=29  Score=25.68  Aligned_cols=25  Identities=24%  Similarity=0.469  Sum_probs=21.4

Q ss_pred             CChhHHHHHHHHHHHcCCCCChHHH
Q psy17913         17 GNARHAKQLVDVLIEANQSVTPALS   41 (121)
Q Consensus        17 ~n~~~a~dLv~lL~ea~QeVP~~L~   41 (121)
                      ++.++++.|...|.+..++||+...
T Consensus         2 ~E~~fa~~i~~~Ld~~a~~Lp~~i~   26 (131)
T PF12279_consen    2 NEDRFARRIARALDESADDLPPDIS   26 (131)
T ss_pred             cHHHHHHHHHHHhhcccccCCHHHH
Confidence            4567899999999999999998643


No 63 
>PF11051 Mannosyl_trans3:  Mannosyltransferase putative;  InterPro: IPR022751 Alpha-mannosyltransferase is responsible for the addition of residues to the outer chain of core N-linked polysaccharides and to O-linked mannotriose. It is implicated in late Golgi modifications [][][]. The proteins matching this entry are conserved in fungi and also found in some phototrophic organisms.; GO: 0006486 protein glycosylation
Probab=40.14  E-value=28  Score=27.94  Aligned_cols=33  Identities=15%  Similarity=0.067  Sum_probs=25.4

Q ss_pred             ceeEEEeeCCCChhHHHHHHHHHHHcCCCCChHH
Q psy17913          7 IGTAYAFFTPGNARHAKQLVDVLIEANQSVTPAL   40 (121)
Q Consensus         7 ~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP~~L   40 (121)
                      +|+.|+.-. +...+|..||++|++.++++|-+|
T Consensus         2 rGIVi~~g~-~~~~~a~~lI~~LR~~g~~LPIEI   34 (271)
T PF11051_consen    2 RGIVITAGD-KYLWLALRLIRVLRRLGNTLPIEI   34 (271)
T ss_pred             CEEEEEecC-ccHHHHHHHHHHHHHhCCCCCEEE
Confidence            466666655 667788899999999999887543


No 64 
>PF10978 DUF2785:  Protein of unknown function (DUF2785);  InterPro: IPR021247  Some members in this family are annotated as hypothetical membrane spanning proteins however this cannot be confirmed. The family has no known function. 
Probab=40.12  E-value=16  Score=27.63  Aligned_cols=37  Identities=19%  Similarity=0.254  Sum_probs=29.1

Q ss_pred             EEEeeCCCChhHHHHHHHHHHHc---CCCCChHHHHHHHh
Q psy17913         10 AYAFFTPGNARHAKQLVDVLIEA---NQSVTPALSEMSQM   46 (121)
Q Consensus        10 AiTFft~~n~~~a~dLv~lL~ea---~QeVP~~L~~~a~~   46 (121)
                      .+-|+..+|.++|.-|+.+|...   .+++..||+++...
T Consensus       107 ~~~~~~~EdeRLa~~~~~~l~~~~l~~~~~~~wl~~~~~~  146 (175)
T PF10978_consen  107 STPFIDGEDERLATALIELLNRNKLYQEELLSWLKSWRQD  146 (175)
T ss_pred             CcceeCCChhHHHHHHHHHHHcCCCCHHHHHHHHHHHHHH
Confidence            45678889999999999999876   34667788888543


No 65 
>cd04926 ACT_ACR_4 C-terminal  ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the C-terminal  ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=39.87  E-value=40  Score=21.36  Aligned_cols=29  Identities=17%  Similarity=0.182  Sum_probs=24.5

Q ss_pred             eeEEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913          8 GTAYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus         8 G~AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      |+-+++..++.+.++.+|..+|.+.+-.|
T Consensus         1 gtri~V~~~D~~Gll~~i~~~l~~~~lnI   29 (72)
T cd04926           1 GVRLELRTEDRVGLLSDVTRVFRENGLTV   29 (72)
T ss_pred             CeEEEEEECCccCHHHHHHHHHHHCCcEE
Confidence            45678888999999999999999887766


No 66 
>PF06012 DUF908:  Domain of Unknown Function (DUF908);  InterPro: IPR010309 This is a domain of unknown function found at the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing. This domain is found in association with and immediately N-terminal to another domain of unknown function: IPR010314 from INTERPRO. 
Probab=39.09  E-value=30  Score=28.60  Aligned_cols=28  Identities=11%  Similarity=0.222  Sum_probs=23.2

Q ss_pred             CChhHHHHHHHHHHHcCCCCChHHHHHHH
Q psy17913         17 GNARHAKQLVDVLIEANQSVTPALSEMSQ   45 (121)
Q Consensus        17 ~n~~~a~dLv~lL~ea~QeVP~~L~~~a~   45 (121)
                      .|+.++.+|+++|.-.. +||.|++..|-
T Consensus       262 ~dp~l~~eL~eLi~~~~-~v~~~i~~~Al  289 (329)
T PF06012_consen  262 QDPELVNELVELISPEE-KVPMDIQTAAL  289 (329)
T ss_pred             cChHHHHHHHHHhCCCC-CCCHHHHHHHH
Confidence            46779999999988776 99999887764


No 67 
>TIGR03714 secA2 accessory Sec system translocase SecA2. Members of this protein family are homologous to SecA and part of the accessory Sec system. This system, including both five core proteins for export and a variable number of proteins for glycosylation, operates in certain Gram-positive pathogens for the maturation and delivery of serine-rich glycoproteins such as the cell surface glycoprotein GspB in Streptococcus gordonii.
Probab=38.79  E-value=75  Score=29.95  Aligned_cols=19  Identities=16%  Similarity=0.090  Sum_probs=16.4

Q ss_pred             CCCCCCceeEEEeeCCCCh
Q psy17913          1 MSSQCFIGTAYAFFTPGNA   19 (121)
Q Consensus         1 ~~RaG~~G~AiTFft~~n~   19 (121)
                      .+|+|++|++++|++.+|.
T Consensus       521 tGRqG~~G~s~~~is~eD~  539 (762)
T TIGR03714       521 SGRQGDPGSSQFFVSLEDD  539 (762)
T ss_pred             ccCCCCceeEEEEEccchh
Confidence            3789999999999998764


No 68 
>COG2169 Ada Adenosine deaminase [Nucleotide transport and metabolism]
Probab=36.89  E-value=37  Score=26.75  Aligned_cols=29  Identities=7%  Similarity=0.038  Sum_probs=22.9

Q ss_pred             ChhHHHHHHHHHHHcCCCCChHHHHHHHhcc
Q psy17913         18 NARHAKQLVDVLIEANQSVTPALSEMSQMSA   48 (121)
Q Consensus        18 n~~~a~dLv~lL~ea~QeVP~~L~~~a~~~~   48 (121)
                      +..++..|+.+|+++  +-|+||++++.+..
T Consensus        80 ~~~~V~~a~~~ie~~--~~~~~le~la~~lg  108 (187)
T COG2169          80 RSGLVATACRLIEQN--PEKRWLEELADELG  108 (187)
T ss_pred             ccHHHHHHHHHHHcC--CCcccHHHHHHHhC
Confidence            456778888888777  88899999998654


No 69 
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH). ACT_3PGDH-like: The ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH), with or without an extended C-terminal (xct) region found in various bacteria, archaea, fungi, and plants. 3PGDH is an enzyme that belongs to the D-isomer specific, 2-hydroxyacid dehydrogenase family and catalyzes the oxidation of D-3-phosphoglycerate to 3- phosphohydroxypyruvate, which is the first step in the biosynthesis of L-serine, using NAD+ as the oxidizing agent. In bacteria, 3PGDH is feedback controlled by the end product L-serine in an allosteric manner. In the Escherichia coli homotetrameric enzyme, the interface at adjacent ACT (regulatory) domains couples to create an extended beta-sheet. Each regulatory interface forms two serine-binding sites. The mechanism by which serine transmits inhibition to the active
Probab=36.61  E-value=53  Score=19.12  Aligned_cols=25  Identities=8%  Similarity=0.005  Sum_probs=19.2

Q ss_pred             EeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         12 AFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        12 TFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      .+..++.+.++.+|.++|.+.+-.|
T Consensus         3 ~v~~~d~~g~l~~i~~~l~~~~~nI   27 (71)
T cd04879           3 LIVHKDVPGVIGKVGTILGEHGINI   27 (71)
T ss_pred             EEEecCCCCHHHHHHHHHHhcCCCe
Confidence            4556677788999999998886655


No 70 
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria. The C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria. 3PGDH is an enzyme that belongs to the D-isomer specific, 2-hydroxyacid dehydrogenase family and catalyzes the oxidation of D-3-phosphoglycerate to 3- phosphohydroxypyruvate, which is the first step in the biosynthesis of L-serine, using NAD+ as the oxidizing agent. In Escherichia coli, the SerA 3PGDH is feedback-controlled by the end product L-serine in an allosteric manner. In the homotetrameric enzyme, the interface at adjacent ACT (regulatory) domains couples to create an extended beta-sheet. Each regulatory interface forms two serine-binding sites. The mechanism by which serine transmits inhibition to the active site is postulated to involve the tethering of the regulatory domains together to create a rigid quaternary structure with a solvent-
Probab=36.59  E-value=48  Score=19.94  Aligned_cols=26  Identities=15%  Similarity=0.125  Sum_probs=22.0

Q ss_pred             EEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         11 YAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        11 iTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      +.++.++.+.+..++.++|.+.+..|
T Consensus         2 ~~~~~~d~~g~l~~i~~~l~~~~~nI   27 (69)
T cd04901           2 ILHIHKNVPGVLGQINTILAEHNINI   27 (69)
T ss_pred             EEEEecCCCcHHHHHHHHHHHcCCCH
Confidence            56777888889999999999887776


No 71 
>PF07905 PucR:  Purine catabolism regulatory protein-like family;  InterPro: IPR012914 This domain is found in the purine catabolism regulatory protein expressed by Bacillus subtilis (PucR, O32138 from SWISSPROT). PucR is thought to be a transcriptional regulator of genes involved in the purine degradation pathway, and may contain a LysR-like DNA-binding domain. It is similar to LysR-type regulators in that it represses its own expression []. The other members of this family are also putative regulatory proteins. 
Probab=36.31  E-value=83  Score=22.05  Aligned_cols=31  Identities=10%  Similarity=0.239  Sum_probs=23.9

Q ss_pred             ChhHHHHHHHHHHHc------------CCCCChHHHHHHHhcc
Q psy17913         18 NARHAKQLVDVLIEA------------NQSVTPALSEMSQMSA   48 (121)
Q Consensus        18 n~~~a~dLv~lL~ea------------~QeVP~~L~~~a~~~~   48 (121)
                      +.....++++-|.++            -.+||+++.++|++..
T Consensus        57 ~~~~~~~~i~~L~~~~~agL~i~~~~~~~~iP~~~i~~A~~~~   99 (123)
T PF07905_consen   57 DEEELREFIRELAEKGAAGLGIKTGRYLDEIPEEIIELADELG   99 (123)
T ss_pred             CHHHHHHHHHHHHHCCCeEEEEeccCccccCCHHHHHHHHHcC
Confidence            566678888888765            3379999999998764


No 72 
>PRK08561 rps15p 30S ribosomal protein S15P; Reviewed
Probab=36.12  E-value=39  Score=25.84  Aligned_cols=25  Identities=16%  Similarity=0.361  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHcC--CCCChHHHHHHHh
Q psy17913         22 AKQLVDVLIEAN--QSVTPALSEMSQM   46 (121)
Q Consensus        22 a~dLv~lL~ea~--QeVP~~L~~~a~~   46 (121)
                      -+.|.++|++.+  .|||++|..|.+.
T Consensus        68 G~ki~~iLk~~gl~p~iPEDL~~L~~r   94 (151)
T PRK08561         68 GKKITEILEENGLAPEIPEDLRNLIKK   94 (151)
T ss_pred             cchHHHHHHHcCCCCCCcHHHHHHHHH
Confidence            356888999886  5899999988764


No 73 
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB. This CD includes the C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB. AcuB is putatively involved in the anaerobic catabolism of acetoin, and related proteins. Studies report the induction of AcuB by nitrate respiration and also by fermentation. Since acetoin can be secreted and later serve as a source of carbon, it has been proposed that, during anaerobic growth when other carbon sources are exhausted, the induction of the AcuB protein  results in acetoin catabolism. AcuB-like proteins have two N-terminal tandem CBS domains and a single C-terminal ACT domain. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=35.93  E-value=56  Score=19.86  Aligned_cols=29  Identities=3%  Similarity=0.189  Sum_probs=22.3

Q ss_pred             eeEEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913          8 GTAYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus         8 G~AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      |+-+++.-++.+..+.+|+++|.+++..|
T Consensus         1 g~~~~v~~~d~pG~l~~i~~~l~~~~inI   29 (72)
T cd04883           1 SSQIEVRVPDRPGQLADIAAIFKDRGVNI   29 (72)
T ss_pred             CcEEEEEECCCCCHHHHHHHHHHHcCCCE
Confidence            35577777777778888999998886655


No 74 
>TIGR00643 recG ATP-dependent DNA helicase RecG.
Probab=35.92  E-value=71  Score=28.66  Aligned_cols=35  Identities=9%  Similarity=0.099  Sum_probs=23.4

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      +|.+++|.||.|+.+.....+.+.+++|.++..-+
T Consensus       551 GR~g~~g~~il~~~~~~~~~~~~rl~~~~~~~dgf  585 (630)
T TIGR00643       551 GRGDHQSYCLLVYKNPKSESAKKRLRVMADTLDGF  585 (630)
T ss_pred             ccCCCCcEEEEEECCCCCHHHHHHHHHHHhhcccH
Confidence            45666899999994434445566667787765544


No 75 
>PF09345 DUF1987:  Domain of unknown function (DUF1987);  InterPro: IPR018530  This family of proteins are functionally uncharacterised. 
Probab=35.45  E-value=42  Score=23.54  Aligned_cols=24  Identities=17%  Similarity=0.412  Sum_probs=20.8

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHc
Q psy17913          9 TAYAFFTPGNARHAKQLVDVLIEA   32 (121)
Q Consensus         9 ~AiTFft~~n~~~a~dLv~lL~ea   32 (121)
                      ..+++||....+.+-+|+++|+++
T Consensus        49 ~~L~YfNTSSsk~l~~i~~~Le~~   72 (99)
T PF09345_consen   49 FKLSYFNTSSSKALMDIFDLLEDA   72 (99)
T ss_pred             EEEEEEecHhHHHHHHHHHHHHHH
Confidence            357889999999999999999887


No 76 
>KOG0345|consensus
Probab=35.41  E-value=29  Score=31.52  Aligned_cols=18  Identities=22%  Similarity=0.348  Sum_probs=15.4

Q ss_pred             CCCCCceeEEEeeCCCCh
Q psy17913          2 SSQCFIGTAYAFFTPGNA   19 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~   19 (121)
                      .|+|+.|.||.|++|++.
T Consensus       349 aR~gr~G~Aivfl~p~E~  366 (567)
T KOG0345|consen  349 ARAGREGNAIVFLNPREE  366 (567)
T ss_pred             hhccCccceEEEecccHH
Confidence            588999999999999543


No 77 
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain. This domain binds to B12 (adenosylcobamide), which initiates the conversion of succinyl CoA and methylmalonyl CoA by forming an adenosyl radical, which then undergoes a rearrangement exchanging a hydrogen atom with a group attached to a neighboring carbon atom. This family is present in both mammals and bacteria. Bacterial members are heterodimers and involved in the fermentation of pyruvate to propionate. Mammalian members are homodimers and responsible for the conversion of odd-chain fatty acids and branched-chain amino acids via propionyl CoA to succinyl CoA for further degradation.
Probab=35.23  E-value=41  Score=23.49  Aligned_cols=27  Identities=11%  Similarity=0.177  Sum_probs=21.6

Q ss_pred             eeEEEeeCCCChhHHHHHHHHHHHcCC
Q psy17913          8 GTAYAFFTPGNARHAKQLVDVLIEANQ   34 (121)
Q Consensus         8 G~AiTFft~~n~~~a~dLv~lL~ea~Q   34 (121)
                      =++||+..+.....+++|++.|++...
T Consensus        53 ~V~iS~~~~~~~~~~~~~~~~L~~~~~   79 (122)
T cd02071          53 VIGLSSLSGGHMTLFPEVIELLRELGA   79 (122)
T ss_pred             EEEEcccchhhHHHHHHHHHHHHhcCC
Confidence            356777777788889999999998844


No 78 
>PF05105 Phage_holin_4:  Holin family ;  InterPro: IPR006480 This group of sequences describe one of the many mutually dissimilar families of holins, phage proteins that act together with lytic enzymes in bacterial lysis. This family includes, besides phage holins, the protein TcdE/UtxA involved in toxin secretion in Clostridium difficile and related species []. This entry is represented by the Bacteriophage phi-29, Gp14 (holin). The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=34.82  E-value=57  Score=22.82  Aligned_cols=25  Identities=12%  Similarity=0.158  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHcCCCCChHHHHHHHh
Q psy17913         22 AKQLVDVLIEANQSVTPALSEMSQM   46 (121)
Q Consensus        22 a~dLv~lL~ea~QeVP~~L~~~a~~   46 (121)
                      +-.|++.|.+.+-++|++|.++-+.
T Consensus        89 ~~SI~EN~~~~G~~iP~~l~~~l~~  113 (118)
T PF05105_consen   89 LISILENLAEMGVPIPKWLKKFLKQ  113 (118)
T ss_pred             HHHHHHHHHHhCCCchHHHHHHHHH
Confidence            3456677778888999999988664


No 79 
>PF06479 Ribonuc_2-5A:  Ribonuclease 2-5A;  InterPro: IPR010513 The proteins listed below share a common architecture with a protein kinase homology domain (see PDOC00100 from PROSITEDOC) followed by an ~135-residue globular kinase-extension nuclease (KEN) domain made of eight helices []:    - Mammalian 2-5A-dependent RNase or RNase L (EC 3.1.26.-), an interferon- induced enzyme implicated in both the molecular mechanisms of interferon action and the fundamental control of RNA stability. 2-5A-dependent RNase is a unique enzyme in that it requires 2-5A, unusual oligoadenylates with 2',5'-phosphodiester linkages. RNase L is catalytically active only after binding to an unusual activator molecule containing a 5'-phosphorylated 2', 5'-linked oligoadenylate (2-5A), in the N-terminal half. RNase L consists of three domains, namely the N-terminal ankyrin repeat domain (see PDOC50088 from PROSITEDOC), the protein kinase homology domain, and the C-terminal KEN domain [, , ].   - Eukaryotic Ire1/Ern1, an ancient transmembrane sensor of endoplasmic reticulum (ER) stress with dual protein kinase and ribonuclease activities. In response to ER stress Ire1/Ern1 catalyzes the splicing of target mRNAs in a spliceosome-independent manner. Ire1/Ern1 is a type 1 transmembrane receptor consisting of an N-terminal ER luminal domain, a transmembrane segment and a cytoplasmic region. The cytoplasmic region encompasses a protein kinase domain followed by a C-terminal KEN domain [, ].   The dimerisation of the kinase domain activates the ribonuclease function of the KEN domain [].; GO: 0016891 endoribonuclease activity, producing 5'-phosphomonoesters, 0006397 mRNA processing; PDB: 3SDJ_D 3FBV_L 3LJ2_A 3SDM_A 3LJ0_A 2RIO_A 3LJ1_A 3P23_A.
Probab=34.76  E-value=54  Score=23.98  Aligned_cols=28  Identities=11%  Similarity=0.232  Sum_probs=19.0

Q ss_pred             ChhHHHHHHHHHH---HcCCCCChHHHHHHH
Q psy17913         18 NARHAKQLVDVLI---EANQSVTPALSEMSQ   45 (121)
Q Consensus        18 n~~~a~dLv~lL~---ea~QeVP~~L~~~a~   45 (121)
                      +..-++||+++|+   .+-+|+|++++++..
T Consensus        59 ~~~sv~DLLR~IRNk~~Hy~el~~~~k~~lg   89 (129)
T PF06479_consen   59 DGDSVRDLLRAIRNKKHHYQELPEEVKEILG   89 (129)
T ss_dssp             -TT-HHHHHHHHHHHHHTCCCS-HHHHHHC-
T ss_pred             CccCHHHHHHHHHcchHhHHHCCHHHHHHhC
Confidence            4455789888776   667899999988753


No 80 
>KOG4700|consensus
Probab=34.75  E-value=66  Score=25.72  Aligned_cols=22  Identities=18%  Similarity=0.152  Sum_probs=17.5

Q ss_pred             EEeeCCCChhHHHHHHHHHHHc
Q psy17913         11 YAFFTPGNARHAKQLVDVLIEA   32 (121)
Q Consensus        11 iTFft~~n~~~a~dLv~lL~ea   32 (121)
                      |-|+-++-.-.+.+|-+||.++
T Consensus       117 IkFV~DK~~~~l~e~d~ll~~a  138 (207)
T KOG4700|consen  117 IKFVGDKALLMLQEMDKLLREA  138 (207)
T ss_pred             eEEecchHHHHHHHHHHHHHHh
Confidence            6788877777788888888865


No 81 
>COG3092 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.32  E-value=21  Score=27.08  Aligned_cols=30  Identities=27%  Similarity=0.266  Sum_probs=24.9

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHcCCCCCh
Q psy17913          9 TAYAFFTPGNARHAKQLVDVLIEANQSVTP   38 (121)
Q Consensus         9 ~AiTFft~~n~~~a~dLv~lL~ea~QeVP~   38 (121)
                      .|||=+.|.-..+..||.+-|+|++|.+|+
T Consensus        91 raiTpl~p~la~Wfyev~~kl~e~g~al~p  120 (149)
T COG3092          91 RAITPLPPQLAVWFYEVREKLKEAGQALAP  120 (149)
T ss_pred             ccCCCCChHHHHHHHHHHHHHHHhCCCCCc
Confidence            466667777778899999999999998875


No 82 
>KOG4284|consensus
Probab=33.99  E-value=29  Score=32.95  Aligned_cols=39  Identities=13%  Similarity=0.162  Sum_probs=23.7

Q ss_pred             CCCCCceeEEEeeCCCCh-hHHHHH-------HHHHHHcCCCCChHH
Q psy17913          2 SSQCFIGTAYAFFTPGNA-RHAKQL-------VDVLIEANQSVTPAL   40 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~-~~a~dL-------v~lL~ea~QeVP~~L   40 (121)
                      +|.|.+|.||||+..+.. .-.+.|       ++++.+-..++|-.|
T Consensus       364 gRFG~~G~aVT~~~~~~e~~~f~~m~~ria~~~~~~~~p~~p~P~~~  410 (980)
T KOG4284|consen  364 GRFGAHGAAVTLLEDERELKGFTAMAYRIAVTVKRVVEPVHPLPGDL  410 (980)
T ss_pred             ccccccceeEEEeccchhhhhhHHHHHHHhhhheeeeccCCCCCccc
Confidence            567789999999987543 222333       234444455566554


No 83 
>PRK10917 ATP-dependent DNA helicase RecG; Provisional
Probab=33.90  E-value=77  Score=28.82  Aligned_cols=33  Identities=9%  Similarity=0.149  Sum_probs=24.3

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHHHHHcCC
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDVLIEANQ   34 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~lL~ea~Q   34 (121)
                      +|.+++|.||.|+++.....+.+.+++|+++..
T Consensus       574 GR~g~~g~~ill~~~~~~~~~~~rl~~~~~~~d  606 (681)
T PRK10917        574 GRGAAQSYCVLLYKDPLSETARERLKIMRETND  606 (681)
T ss_pred             cCCCCceEEEEEECCCCChhHHHHHHHHHHhcc
Confidence            566678999999975545567777888887654


No 84 
>PRK02261 methylaspartate mutase subunit S; Provisional
Probab=33.87  E-value=54  Score=23.83  Aligned_cols=27  Identities=15%  Similarity=0.051  Sum_probs=23.0

Q ss_pred             eeEEEeeCCCChhHHHHHHHHHHHcCC
Q psy17913          8 GTAYAFFTPGNARHAKQLVDVLIEANQ   34 (121)
Q Consensus         8 G~AiTFft~~n~~~a~dLv~lL~ea~Q   34 (121)
                      =+++|+........+++|++.|++.+.
T Consensus        57 ~V~lS~~~~~~~~~~~~~~~~L~~~~~   83 (137)
T PRK02261         57 AILVSSLYGHGEIDCRGLREKCIEAGL   83 (137)
T ss_pred             EEEEcCccccCHHHHHHHHHHHHhcCC
Confidence            467899888889999999999998844


No 85 
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains. Included in this CD is the C-terminal ACT domain of a novel protein composed of just two ACT domains, as seen in the yet uncharacterized structure (pdb 2F06) of the Bt0572 protein from Bacteroides thetaiotaomicron and related proteins. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=33.80  E-value=63  Score=19.00  Aligned_cols=26  Identities=15%  Similarity=0.296  Sum_probs=21.0

Q ss_pred             EEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         11 YAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        11 iTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      +++..++.+..+.+|+++|.+++-.|
T Consensus         2 i~v~~~d~pG~L~~i~~~l~~~~~nI   27 (65)
T cd04882           2 LAVEVPDKPGGLHEILQILSEEGINI   27 (65)
T ss_pred             EEEEeCCCCcHHHHHHHHHHHCCCCh
Confidence            45667778888999999999987766


No 86 
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a.a.), putative amino acid binding protein, Af1403, and related domains. This CD includes the N-terminal ACT domain of the yet uncharacterized, small (~133 a.a.), putative amino acid binding protein, Af1403, from Archaeoglobus fulgidus and other related archeal ACT domains. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=33.46  E-value=62  Score=19.07  Aligned_cols=27  Identities=15%  Similarity=0.272  Sum_probs=21.2

Q ss_pred             EEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         10 AYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        10 AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      ++++.-++.+.++.+|+++|.+.+..|
T Consensus         2 ~l~i~~~d~~g~l~~i~~~l~~~~~~i   28 (72)
T cd04874           2 ALSIIAEDKPGVLRDLTGVIAEHGGNI   28 (72)
T ss_pred             eEEEEeCCCCChHHHHHHHHHhCCCCE
Confidence            466777777888999999998886655


No 87 
>PF01913 FTR:  Formylmethanofuran-tetrahydromethanopterin formyltransferase;  InterPro: IPR022667 Formylmethanofuran:tetrahyromethanopterin formyltransferase (Ftr) is involved in C1 metabolism in methanogenic archaea, sulphate-reducing archaea and methylotrophic bacteria. It catalyses the following reversible reaction:  N-formylmethanofuran + 5,6,7,8-tetrahydromethanopterin = methanofuran + 5-formyl-5,6,7,8-tetrahydromethanopterin Ftr from the thermophilic methanogen Methanopyrus kandleri (optimum growth temperature 98 degrees C) is a hyperthermophilic enzyme that is absolutely dependent on the presence of lyotropic salts for activity and thermostability. The crystal structure of Ftr, determined to a reveals a homotetramer composed essentially of two dimers. Each subunit is subdivided into two tightly associated lobes both consisting of a predominantly antiparallel beta sheet flanked by alpha helices forming an alpha/beta sandwich structure. The approximate location of the active site was detected in a region close to the dimer interface []. Ftr from the mesophilic methanogen Methanosarcina barkeri and the sulphate-reducing archaeon Archaeoglobus fulgidus have a similar structure []. In the methylotrophic bacterium Methylobacterium extorquens, Ftr interacts with three other polypeptides to form an Ftr/cyclohydrolase complex which catalyses the hydrolysis of formyl-tetrahydromethanopterin to formate during growth on C1 substrates [].; GO: 0016740 transferase activity, 0006730 one-carbon metabolic process; PDB: 1M5H_E 1M5S_C 1FTR_C 2FHJ_B 2FHK_D.
Probab=33.36  E-value=66  Score=24.47  Aligned_cols=33  Identities=15%  Similarity=0.169  Sum_probs=26.2

Q ss_pred             CCceeEEEeeCCCChhHHHHHHHHHHHcCCCCC
Q psy17913          5 CFIGTAYAFFTPGNARHAKQLVDVLIEANQSVT   37 (121)
Q Consensus         5 G~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP   37 (121)
                      |+.|++|-||+.+-+.+.++|++-+.++--..|
T Consensus        68 GRPGv~il~f~~~~~~L~~~l~~RigQcVLT~P  100 (144)
T PF01913_consen   68 GRPGVSILIFAMSKKKLEKQLLERIGQCVLTCP  100 (144)
T ss_dssp             SS-EEEEEEEESSHHHHHHHHHHHHHHHTTTST
T ss_pred             CCCcEEEEEEeCCHHHHHHHHHHHccCcccCCh
Confidence            788999999988888888888887777655555


No 88 
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase). This CD includes the N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) which catalyzes the hydrolysis of 10-formyltetrahydrofolate (formyl-FH4) to FH4 and formate. Formyl-FH4 hydrolase  generates the formate that is used by purT-encoded 5'-phosphoribosylglycinamide transformylase for step three of de novo purine nucleotide synthesis. Formyl-FH4 hydrolase, a hexamer which is activated by methionine and inhibited by glycine, is proposed to regulate the balance FH4 and C1-FH4 in response to changing growth conditions. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=33.01  E-value=67  Score=20.10  Aligned_cols=26  Identities=12%  Similarity=0.185  Sum_probs=22.7

Q ss_pred             EEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         11 YAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        11 iTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      +|+..++.+.++.+|.++|.+.+..|
T Consensus         2 i~v~g~D~~Giv~~it~~l~~~g~nI   27 (74)
T cd04875           2 LTLSCPDRPGIVAAVSGFLAEHGGNI   27 (74)
T ss_pred             EEEEcCCCCCHHHHHHHHHHHcCCCE
Confidence            67888999999999999999887765


No 89 
>PF06348 DUF1059:  Protein of unknown function (DUF1059);  InterPro: IPR009409 This entry consists of short hypothetical archaeal and bacterial proteins of unknown function.
Probab=32.98  E-value=1.3e+02  Score=18.88  Aligned_cols=38  Identities=11%  Similarity=0.128  Sum_probs=26.7

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHcCC--CCChHHHHHHHh
Q psy17913          9 TAYAFFTPGNARHAKQLVDVLIEANQ--SVTPALSEMSQM   46 (121)
Q Consensus         9 ~AiTFft~~n~~~a~dLv~lL~ea~Q--eVP~~L~~~a~~   46 (121)
                      ..+++--+.+..+++.+++-+++...  +||++|.+....
T Consensus        13 C~~~~~a~tedEll~~~~~Ha~~~Hg~~~~~~el~~~ir~   52 (57)
T PF06348_consen   13 CGFVIRAETEDELLEAVVEHAREVHGMTEIPEELREKIRS   52 (57)
T ss_pred             CCeEEeeCCHHHHHHHHHHHHHHhcCCccCCHHHHHHHHH
Confidence            34455555677888999888888744  579887776553


No 90 
>PF11784 DUF3320:  Protein of unknown function (DUF3320);  InterPro: IPR021754  This family is conserved in Proteobacteria and Chlorobi families. Many members are annotated as being putative DNA helicase-related proteins. 
Probab=32.37  E-value=57  Score=20.07  Aligned_cols=28  Identities=11%  Similarity=0.388  Sum_probs=22.8

Q ss_pred             EeeCCCChhHHHHHHHHHHHcCCCCChH
Q psy17913         12 AFFTPGNARHAKQLVDVLIEANQSVTPA   39 (121)
Q Consensus        12 TFft~~n~~~a~dLv~lL~ea~QeVP~~   39 (121)
                      .||.+.....+.++|.-+.++.-+|...
T Consensus         3 ~f~~~~~~~~L~~~i~~Iv~~EgPI~~~   30 (52)
T PF11784_consen    3 DFYHPEYRPQLARMIRQIVEVEGPIHED   30 (52)
T ss_pred             chhhhhHHHHHHHHHHHHHHHcCCccHH
Confidence            4788888888888888888888888864


No 91 
>PRK00194 hypothetical protein; Validated
Probab=32.34  E-value=80  Score=20.47  Aligned_cols=29  Identities=14%  Similarity=0.111  Sum_probs=24.6

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHcCCCCC
Q psy17913          9 TAYAFFTPGNARHAKQLVDVLIEANQSVT   37 (121)
Q Consensus         9 ~AiTFft~~n~~~a~dLv~lL~ea~QeVP   37 (121)
                      .-+|++-++.+.++.+|.++|.+.+..|-
T Consensus         4 ~~ltv~g~DrpGiva~vt~~la~~g~nI~   32 (90)
T PRK00194          4 AIITVIGKDKVGIIAGVSTVLAELNVNIL   32 (90)
T ss_pred             EEEEEEcCCCCCHHHHHHHHHHHcCCCEE
Confidence            35888999999999999999998877653


No 92 
>PF05673 DUF815:  Protein of unknown function (DUF815);  InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function.
Probab=32.28  E-value=96  Score=25.43  Aligned_cols=41  Identities=10%  Similarity=0.096  Sum_probs=32.9

Q ss_pred             CceeEEEeeCCCChhHHHHHHHHHHHcCCCCC-hHHHHHHHh
Q psy17913          6 FIGTAYAFFTPGNARHAKQLVDVLIEANQSVT-PALSEMSQM   46 (121)
Q Consensus         6 ~~G~AiTFft~~n~~~a~dLv~lL~ea~QeVP-~~L~~~a~~   46 (121)
                      +-|+.|+|..++....+.-+..+++..+-+++ ++|...|-.
T Consensus       184 RFGL~l~F~~~~q~~YL~IV~~~~~~~g~~~~~e~l~~~Al~  225 (249)
T PF05673_consen  184 RFGLWLSFYPPDQEEYLAIVRHYAERYGLELDEEELRQEALQ  225 (249)
T ss_pred             hCCcEEEecCCCHHHHHHHHHHHHHHcCCCCCHHHHHHHHHH
Confidence            46899999999988888777778888899998 467666654


No 93 
>PRK08156 type III secretion system protein SpaS; Validated
Probab=32.25  E-value=45  Score=28.56  Aligned_cols=26  Identities=12%  Similarity=0.032  Sum_probs=20.0

Q ss_pred             CChhHHHHHHHHHHHcCCCCChHHHHH
Q psy17913         17 GNARHAKQLVDVLIEANQSVTPALSEM   43 (121)
Q Consensus        17 ~n~~~a~dLv~lL~ea~QeVP~~L~~~   43 (121)
                      +|+.+|+.|.+.. +.+|+||++|-+-
T Consensus       302 en~pLARaLY~~v-evg~~IP~ely~A  327 (361)
T PRK08156        302 RDIKLARRLYKTH-RRYSFVSLEDLDE  327 (361)
T ss_pred             eCHHHHHHHHHhC-CCCCcCCHHHHHH
Confidence            5788888888754 7899999876543


No 94 
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase. A conserved gene neighborhood widely spread in the Actinobacteria contains this uncharacterized DEAH-box family helicase encoded convergently towards an operon of genes for protein homologous to type II secretion and pilus formation proteins. The context suggests that this helicase may play a role in conjugal transfer of DNA.
Probab=32.22  E-value=47  Score=30.63  Aligned_cols=30  Identities=0%  Similarity=-0.230  Sum_probs=21.2

Q ss_pred             CCCCCceeEEEeeCC--CChhHHHHHHHHHHH
Q psy17913          2 SSQCFIGTAYAFFTP--GNARHAKQLVDVLIE   31 (121)
Q Consensus         2 ~RaG~~G~AiTFft~--~n~~~a~dLv~lL~e   31 (121)
                      +|+|+.|+||+|+++  .|..++.++.++|+.
T Consensus       371 GR~G~~g~ai~v~~~~~~d~~~~~~~~~~~~~  402 (742)
T TIGR03817       371 GRRGQGALVVLVARDDPLDTYLVHHPEALFDR  402 (742)
T ss_pred             CCCCCCcEEEEEeCCChHHHHHHhCHHHHhcC
Confidence            577778999999974  456666666666653


No 95 
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase. This domain binds methylcobalamin, which it uses as an intermediate methyl carrier from methyltetrahydrofolate (CH3H4folate) to homocysteine (Hcy).
Probab=31.75  E-value=56  Score=25.51  Aligned_cols=30  Identities=0%  Similarity=-0.086  Sum_probs=24.9

Q ss_pred             eeEEEeeCCCChhHHHHHHHHHHHcCCCCC
Q psy17913          8 GTAYAFFTPGNARHAKQLVDVLIEANQSVT   37 (121)
Q Consensus         8 G~AiTFft~~n~~~a~dLv~lL~ea~QeVP   37 (121)
                      =+++|+....+...++++++.|++....||
T Consensus       142 ~V~lS~~~~~~~~~~~~~i~~L~~~~~~~~  171 (213)
T cd02069         142 IIGLSGLLVPSLDEMVEVAEEMNRRGIKIP  171 (213)
T ss_pred             EEEEccchhccHHHHHHHHHHHHhcCCCCe
Confidence            467888888888899999999998866665


No 96 
>PRK09108 type III secretion system protein HrcU; Validated
Probab=31.67  E-value=37  Score=28.83  Aligned_cols=26  Identities=27%  Similarity=0.399  Sum_probs=20.6

Q ss_pred             CChhHHHHHHHHHHHcCCCCChHHHHHH
Q psy17913         17 GNARHAKQLVDVLIEANQSVTPALSEMS   44 (121)
Q Consensus        17 ~n~~~a~dLv~lL~ea~QeVP~~L~~~a   44 (121)
                      +|+.+|+.|.+  .+.+|+||++|-+-.
T Consensus       309 en~pLARaLy~--~~vg~~IP~ely~aV  334 (353)
T PRK09108        309 GNPPVARALYR--VELDEPIPEELFETV  334 (353)
T ss_pred             eCHHHHHHHhc--CCCCCcCCHHHHHHH
Confidence            58899999983  688999998765443


No 97 
>TIGR01404 FlhB_rel_III type III secretion protein, YscU/HrpY family. This model represents one of several families of proteins related to bacterial flagellar biosynthesis proteins and involved in bacterial type III protein secretion systems. This family is homologous to, but distinguished from, flagellar biosynthetic protein FlhB (TIGRFAMs model TIGR00328). This model may not identify all type III secretion system FlhB homologs.
Probab=31.53  E-value=44  Score=28.21  Aligned_cols=27  Identities=22%  Similarity=0.183  Sum_probs=19.9

Q ss_pred             CChhHHHHHHHHHHHcCCCCChHHHHHH
Q psy17913         17 GNARHAKQLVDVLIEANQSVTPALSEMS   44 (121)
Q Consensus        17 ~n~~~a~dLv~lL~ea~QeVP~~L~~~a   44 (121)
                      +|+.+|+.|.+. .|.+|+||++|-+-.
T Consensus       306 en~pLAR~Ly~~-~evg~~IP~ely~aV  332 (342)
T TIGR01404       306 RDIPLARQLYRT-ARVGQYIPEELFEAV  332 (342)
T ss_pred             eCHHHHHHHHHc-CCCCCcCCHHHHHHH
Confidence            578888888873 457899998765543


No 98 
>COG1938 Archaeal enzymes of ATP-grasp superfamily [General function prediction only]
Probab=31.49  E-value=80  Score=25.85  Aligned_cols=35  Identities=20%  Similarity=0.240  Sum_probs=25.1

Q ss_pred             EEeeCCCChhHHHHHHHHHHHc-CCCCC-hHHHHHHH
Q psy17913         11 YAFFTPGNARHAKQLVDVLIEA-NQSVT-PALSEMSQ   45 (121)
Q Consensus        11 iTFft~~n~~~a~dLv~lL~ea-~QeVP-~~L~~~a~   45 (121)
                      .||.+.-|++-|..+|++|.+. +-.|+ +.|+++|+
T Consensus       178 et~~~~PDP~AAa~vve~lnk~~~l~V~td~L~keAe  214 (244)
T COG1938         178 ETFGDRPDPRAAARVVEALNKMLGLNVDTDKLEKEAE  214 (244)
T ss_pred             cccCCCCChHHHHHHHHHHHHHhcCccCHHHHHHHHH
Confidence            4555555899999999988765 56676 46776665


No 99 
>PRK13109 flhB flagellar biosynthesis protein FlhB; Reviewed
Probab=31.45  E-value=45  Score=28.41  Aligned_cols=26  Identities=15%  Similarity=0.262  Sum_probs=19.7

Q ss_pred             CChhHHHHHHHHHHHcCCCCChHHHHH
Q psy17913         17 GNARHAKQLVDVLIEANQSVTPALSEM   43 (121)
Q Consensus        17 ~n~~~a~dLv~lL~ea~QeVP~~L~~~   43 (121)
                      +|+.+|+.|.+.. +.+|+||++|-+-
T Consensus       316 en~pLARaLy~~~-evg~~IP~ely~A  341 (358)
T PRK13109        316 EDKPLARSLYDAV-QVDQVIPAEFYRP  341 (358)
T ss_pred             eCHHHHHHHHHhC-CCCCcCCHHHHHH
Confidence            4788888888755 6899999876543


No 100
>COG2166 sufE Cysteine desulfurase SufE subunit [Posttranslational modification, protein turnover, chaperones]
Probab=31.13  E-value=59  Score=24.63  Aligned_cols=24  Identities=29%  Similarity=0.529  Sum_probs=21.0

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHc
Q psy17913          9 TAYAFFTPGNARHAKQLVDVLIEA   32 (121)
Q Consensus         9 ~AiTFft~~n~~~a~dLv~lL~ea   32 (121)
                      ..+.|+.+.|..|++-|+-||-+.
T Consensus        70 ~~~~F~gdSdA~ivrGL~aill~~   93 (144)
T COG2166          70 GTLHFFGDSDARIVRGLLAILLAA   93 (144)
T ss_pred             ceEEEeccchhHHHHHHHHHHHHH
Confidence            458899999999999999988765


No 101
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat. Spore coat polysaccharide biosynthesis protein F (spsF) is a glycosyltransferase implicated in the synthesis of the spore coat in a variety of bacteria challenged by stress as starvation. The spsF gene is expressed in the late stage of coat development responsible for a terminal step in coat formation that involves the glycosylation of the coat.  SpsF gene mutation resulted in spores that appeared normal. But, the spores tended to aggregate and had abnormal adsorption properties, indicating a surface alteration.
Probab=30.97  E-value=41  Score=25.42  Aligned_cols=37  Identities=16%  Similarity=0.231  Sum_probs=25.8

Q ss_pred             EEeeCCCChhHHHHHHHHHHHcCCCCC-hHHHHHHHhc
Q psy17913         11 YAFFTPGNARHAKQLVDVLIEANQSVT-PALSEMSQMS   47 (121)
Q Consensus        11 iTFft~~n~~~a~dLv~lL~ea~QeVP-~~L~~~a~~~   47 (121)
                      ++.=|++|...++.|.+.|.+.+.+++ .|+.++.+++
T Consensus       187 ~DiDt~eD~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~  224 (233)
T cd02518         187 LTVDTPEDFELIKEIYEALYPKNPDFSLEDIIELLDKN  224 (233)
T ss_pred             EecCCHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHHhC
Confidence            333366788889999888877666666 4677766554


No 102
>PF12853 NADH_u_ox_C:  C-terminal of NADH-ubiquinone oxidoreductase 21 kDa subunit;  InterPro: IPR024549 This domain is found in the C-terminal region of fungal NADH-ubiquinone oxidoreductase 21 kDa subunits [].
Probab=30.95  E-value=59  Score=22.91  Aligned_cols=26  Identities=12%  Similarity=0.304  Sum_probs=19.3

Q ss_pred             HHHHHHHHHc-----CCCCChHHHHHHHhcc
Q psy17913         23 KQLVDVLIEA-----NQSVTPALSEMSQMSA   48 (121)
Q Consensus        23 ~dLv~lL~ea-----~QeVP~~L~~~a~~~~   48 (121)
                      ++|++.|++-     ...+|+||+.+|...+
T Consensus         2 ~Em~~k~k~GkplYgeS~l~~~~Q~vA~RNS   32 (90)
T PF12853_consen    2 REMKKKVKEGKPLYGESSLDPYMQGVAARNS   32 (90)
T ss_pred             hHHHHHHHCCCCCCCCccCCHHHHHHHHhhh
Confidence            5677777765     4468999999998643


No 103
>PRK13741 conjugal transfer entry exclusion protein TraS; Provisional
Probab=30.51  E-value=36  Score=26.55  Aligned_cols=29  Identities=17%  Similarity=0.239  Sum_probs=21.5

Q ss_pred             eCCCChh-HHHHHHHHHHHcCCCCChHHHH
Q psy17913         14 FTPGNAR-HAKQLVDVLIEANQSVTPALSE   42 (121)
Q Consensus        14 ft~~n~~-~a~dLv~lL~ea~QeVP~~L~~   42 (121)
                      +|.++-. =+.+|.++|+...-+||+.++-
T Consensus         2 IT~k~I~~E~e~Lk~~Lk~gev~IPS~~~c   31 (171)
T PRK13741          2 ITHKDIKTETEKLKDVLSVGEVNIPSLWQV   31 (171)
T ss_pred             cchHHHHHHHHHHHHHhhcCCccCCCHHHh
Confidence            4554432 3788999999999999997764


No 104
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme. The C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme, found in plants, fungi, bacteria, and archaea. The P-protein of E. coli (CM-PDT, PheA) catalyzes the conversion of chorismate to prephenate and then the decarboxylation and dehydration to form phenylpyruvate. These are the first two steps in the biosynthesis of L-Phe and L-Tyr via the shikimate pathway in microorganisms and plants. The E. coli P-protein (CM-PDT) has three domains with an N-terminal domain with chorismate mutase activity, a middle domain with prephenate dehydratase activity, and an ACT regulatory C-terminal domain. The prephenate dehydratase enzyme has a PDT and ACT domain. The ACT domain is essential to bring about the negative allosteric regulation by L-Phe bindi
Probab=30.47  E-value=84  Score=19.99  Aligned_cols=28  Identities=18%  Similarity=0.286  Sum_probs=22.3

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913          9 TAYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus         9 ~AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      ++++|..++.+..+.+++++|.+.+-.|
T Consensus         2 ~sl~~~~~d~~G~L~~il~~f~~~~ini   29 (80)
T cd04905           2 TSIVFTLPNKPGALYDVLGVFAERGINL   29 (80)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHCCcCE
Confidence            4677877778888999999999886654


No 105
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains. This ACT domain family, ACT_ACR-UUR-like_2, includes the second of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; including those enzymes similar to the GlnD found in enteric Escherichia coli and those found in photosynthetic, nitrogen-fixing bacterium Rhodospirillum rubrum. Also included in this CD are the second and fourth ACT domains of a novel protein composed almost entirely of ACT domain repeats, the ACR protein. These ACR proteins, found in Arabidopsis and Oryza, are proposed to function as novel regulatory or sensor proteins in plants. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=30.39  E-value=72  Score=19.25  Aligned_cols=27  Identities=11%  Similarity=0.108  Sum_probs=21.9

Q ss_pred             EEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         10 AYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        10 AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      -+..+.++.+.++.+|+.+|.+.+..|
T Consensus         2 ~l~v~~~d~~gll~~i~~~l~~~~~~I   28 (70)
T cd04899           2 VLELTALDRPGLLADVTRVLAELGLNI   28 (70)
T ss_pred             EEEEEEcCCccHHHHHHHHHHHCCCeE
Confidence            356677788889999999999887766


No 106
>cd04411 Ribosomal_P1_P2_L12p Ribosomal protein P1, P2, and L12p. Ribosomal proteins P1 and P2 are the eukaryotic proteins that are functionally equivalent to bacterial L7/L12. L12p is the archaeal homolog. Unlike other ribosomal proteins, the archaeal L12p and eukaryotic P1 and P2 do not share sequence similarity with their bacterial counterparts. They are part of the ribosomal stalk (called the L7/L12 stalk in bacteria), along with 28S rRNA and the proteins L11 and P0 in eukaryotes (23S rRNA, L11, and L10e in archaea). In bacterial ribosomes, L7/L12 homodimers bind the extended C-terminal helix of L10 to anchor the L7/L12 molecules to the ribosome. Eukaryotic P1/P2 heterodimers and archaeal L12p homodimers are believed to bind the L10 equivalent proteins, eukaryotic P0 and archaeal L10e, in a similar fashion. P1 and P2 (L12p, L7/L12) are the only proteins in the ribosome to occur as multimers, always appearing as sets of dimers. Recent data indicate that most archaeal species contain 
Probab=30.38  E-value=78  Score=22.45  Aligned_cols=28  Identities=11%  Similarity=0.218  Sum_probs=22.7

Q ss_pred             hhHHHHHHHHHHHcCCCCCh-HHHHHHHh
Q psy17913         19 ARHAKQLVDVLIEANQSVTP-ALSEMSQM   46 (121)
Q Consensus        19 ~~~a~dLv~lL~ea~QeVP~-~L~~~a~~   46 (121)
                      ..-+.+|.+||+.++.+|.+ |+..++..
T Consensus        16 ~~ta~~I~~IL~aaGveVe~~~~~~~~~a   44 (105)
T cd04411          16 ELTEDKIKELLSAAGAEIEPERVKLFLSA   44 (105)
T ss_pred             CCCHHHHHHHHHHcCCCcCHHHHHHHHHH
Confidence            35678999999999999976 77777654


No 107
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=30.26  E-value=73  Score=20.30  Aligned_cols=27  Identities=15%  Similarity=0.147  Sum_probs=23.3

Q ss_pred             EEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         10 AYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        10 AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      -++.++++.+.++.+|..+|.+.+..|
T Consensus         2 ~~~v~~~Dr~gLl~~i~~~l~~~~lnI   28 (74)
T cd04925           2 AIELTGTDRPGLLSEVFAVLADLHCNV   28 (74)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHCCCcE
Confidence            467888888999999999999887766


No 108
>COG3084 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.71  E-value=67  Score=22.27  Aligned_cols=28  Identities=18%  Similarity=0.272  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHcCCCCC-----hHHHHHHHhccC
Q psy17913         22 AKQLVDVLIEANQSVT-----PALSEMSQMSAM   49 (121)
Q Consensus        22 a~dLv~lL~ea~QeVP-----~~L~~~a~~~~~   49 (121)
                      +.+++++|+.+=|.-|     ++|+.+|.++.+
T Consensus         6 lnevlellqp~w~k~~dlnl~q~lqkla~eagf   38 (88)
T COG3084           6 LNEVIELLQPAWQKEPDLNLLQFLQKLAKESGF   38 (88)
T ss_pred             HHHHHHHhhHHhccCCCccHHHHHHHHHHHhcc
Confidence            5788999998866555     478888888764


No 109
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains. This CD includes the first of the two ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains. The glycine cleavage enzyme system in Escherichia coli provides one-carbon units for cellular methylation reactions. This enzyme system, encoded by the gcvTHP operon and lpd gene, catalyzes the cleavage of glycine into CO2 + NH3 and transfers a one-carbon unit to tetrahydrofolate, producing 5,10-methylenetetrahydrofolate. The gcvTHP operon is activated by the GcvA protein in response to glycine and repressed by a GcvA/GcvR interaction in the absence of glycine. It has been proposed that the co-activator glycine acts through a mechanism of de-repression by binding to GcvR and preventing GcvR from interacting with GcvA to block GcvA's activator function. Evidence also suggests that GcvR int
Probab=29.37  E-value=83  Score=20.20  Aligned_cols=27  Identities=7%  Similarity=0.107  Sum_probs=23.7

Q ss_pred             EEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         10 AYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        10 AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      -+|+.-|+.+.++..|.++|.+.+..|
T Consensus         3 iltv~g~Dr~GiVa~vs~~la~~g~nI   29 (77)
T cd04893           3 VISALGTDRPGILNELTRAVSESGCNI   29 (77)
T ss_pred             EEEEEeCCCChHHHHHHHHHHHcCCCE
Confidence            478889999999999999999887765


No 110
>KOG0342|consensus
Probab=29.18  E-value=43  Score=30.40  Aligned_cols=27  Identities=15%  Similarity=0.171  Sum_probs=24.0

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHHHH
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLVDV   28 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv~l   28 (121)
                      +|.|++|.|+-|+.|.+..+++.|.+|
T Consensus       422 aR~gk~G~alL~l~p~El~Flr~LK~l  448 (543)
T KOG0342|consen  422 AREGKEGKALLLLAPWELGFLRYLKKL  448 (543)
T ss_pred             cccCCCceEEEEeChhHHHHHHHHhhC
Confidence            588999999999999999999988854


No 111
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria. This CD includes the C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria. This protein has two N-terminal tandem CBS domains and a single C-terminal ACT domain. The CBS domain is found in a wide range of proteins, often in tandem arrangements and together with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=29.07  E-value=66  Score=19.95  Aligned_cols=26  Identities=27%  Similarity=0.436  Sum_probs=21.2

Q ss_pred             EEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         11 YAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        11 iTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      ++++-++.+..+.+|+++|.+++-.|
T Consensus         2 l~v~~~d~pG~L~~l~~~i~~~g~nI   27 (72)
T cd04884           2 FTFLLEDKPGTLKPVVDTLREFNARI   27 (72)
T ss_pred             EEEEecCCCccHHHHHHHHHHCCCeE
Confidence            45677788888999999999987766


No 112
>PF07894 DUF1669:  Protein of unknown function (DUF1669);  InterPro: IPR012461 This family is composed of sequences derived from hypothetical eukaryotic proteins of unknown function. Some members of this family are annotated as being potential phospholipases but no literature was found to support this. 
Probab=28.97  E-value=56  Score=27.29  Aligned_cols=28  Identities=25%  Similarity=0.541  Sum_probs=18.3

Q ss_pred             eEEEeeCC--CChhHHHHHHH-HHHHcCCCC
Q psy17913          9 TAYAFFTP--GNARHAKQLVD-VLIEANQSV   36 (121)
Q Consensus         9 ~AiTFft~--~n~~~a~dLv~-lL~ea~QeV   36 (121)
                      .|+.+|.|  ++.+.+||||. ++++|.|.|
T Consensus       120 r~~vy~qPp~~~~p~IKE~vR~~I~~A~kVI  150 (284)
T PF07894_consen  120 RATVYFQPPKDGQPHIKEVVRRMIQQAQKVI  150 (284)
T ss_pred             eEEEEeCCCCCCCCCHHHHHHHHHHHhccee
Confidence            46677776  56666788775 556666655


No 113
>PTZ00095 40S ribosomal protein S19; Provisional
Probab=28.75  E-value=54  Score=25.51  Aligned_cols=24  Identities=13%  Similarity=0.027  Sum_probs=17.7

Q ss_pred             ChhHHHHHHHHHHHcCC-CCChHHH
Q psy17913         18 NARHAKQLVDVLIEANQ-SVTPALS   41 (121)
Q Consensus        18 n~~~a~dLv~lL~ea~Q-eVP~~L~   41 (121)
                      -..+...|.+.|++..+ +||+|..
T Consensus        33 a~~fI~~~A~~LK~~gki~~P~W~d   57 (169)
T PTZ00095         33 PWRFIKAFAQHFKLEGKIFVPKCTE   57 (169)
T ss_pred             HHHHHHHHHHHHHHcCCCCCCcchh
Confidence            35678888999997754 6777765


No 114
>PF11848 DUF3368:  Domain of unknown function (DUF3368);  InterPro: IPR021799  This domain is functionally uncharacterised. This domain is found in bacteria and archaea. This presumed domain is about 50 amino acids in length. 
Probab=28.68  E-value=93  Score=18.67  Aligned_cols=24  Identities=33%  Similarity=0.412  Sum_probs=19.0

Q ss_pred             HHHHHHHHHHHcCCCCChHHHHHH
Q psy17913         21 HAKQLVDVLIEANQSVTPALSEMS   44 (121)
Q Consensus        21 ~a~dLv~lL~ea~QeVP~~L~~~a   44 (121)
                      -++++++.|++++--||+.|.+.+
T Consensus        20 ~~~~~l~~l~~~g~~is~~l~~~~   43 (48)
T PF11848_consen   20 EVKPLLDRLQQAGFRISPKLIEEI   43 (48)
T ss_pred             hHHHHHHHHHHcCcccCHHHHHHH
Confidence            467888888889988988776654


No 115
>KOG0348|consensus
Probab=28.51  E-value=50  Score=30.67  Aligned_cols=25  Identities=24%  Similarity=0.256  Sum_probs=20.8

Q ss_pred             CCCCCceeEEEeeCCCChhHHHHHH
Q psy17913          2 SSQCFIGTAYAFFTPGNARHAKQLV   26 (121)
Q Consensus         2 ~RaG~~G~AiTFft~~n~~~a~dLv   26 (121)
                      -|+|.+|.|+-|+.|.+...+..|.
T Consensus       539 ARaG~kG~alLfL~P~Eaey~~~l~  563 (708)
T KOG0348|consen  539 ARAGEKGEALLFLLPSEAEYVNYLK  563 (708)
T ss_pred             hhccCCCceEEEecccHHHHHHHHH
Confidence            4899999999999999887665554


No 116
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH). The C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate, found in Bacillus subtilis (BS) and other Firmicutes, Deinococci, and Bacteroidetes. PDH is the first enzyme in the aromatic amino acid pathway specific for the biosynthesis of tyrosine. This enzyme is feedback-inhibited by tyrosine in B. subtilis and other microorganisms. Both phenylalanine and tryptophan have been shown to be inhibitors of this activity in B. subtilis. Bifunctional  chorismate mutase-PDH (TyrA) enzymes such as those seen in Escherichia coli  do not contain an ACT domain. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=28.23  E-value=1.2e+02  Score=18.29  Aligned_cols=27  Identities=15%  Similarity=0.171  Sum_probs=21.2

Q ss_pred             EEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         10 AYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        10 AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      .+++.-++.+..+.+|+++|.+.+..|
T Consensus         3 ~~~v~~~d~~G~L~~l~~~l~~~~i~i   29 (69)
T cd04909           3 DLYVDVPDEPGVIAEVTQILGDAGISI   29 (69)
T ss_pred             EEEEEcCCCCCHHHHHHHHHHHcCCCc
Confidence            456666777778899999999888776


No 117
>COG5182 CUS1 Splicing factor 3b, subunit 2 [RNA processing and modification]
Probab=28.13  E-value=42  Score=29.27  Aligned_cols=29  Identities=17%  Similarity=0.130  Sum_probs=23.8

Q ss_pred             hHHHHHHHHHHHcCCCCChHHHHHHHhcc
Q psy17913         20 RHAKQLVDVLIEANQSVTPALSEMSQMSA   48 (121)
Q Consensus        20 ~~a~dLv~lL~ea~QeVP~~L~~~a~~~~   48 (121)
                      .|..+|.++|--.--.+||||-.|-.-..
T Consensus       282 ~IS~eLrealgi~~g~pPPWlf~Mq~~G~  310 (429)
T COG5182         282 AISAELREALGIDSGTPPPWLFNMQKHGM  310 (429)
T ss_pred             chHHHHHHHhCCCCCCCChHHHhhhhcCC
Confidence            56778888888888899999999976443


No 118
>PRK05298 excinuclease ABC subunit B; Provisional
Probab=28.03  E-value=76  Score=28.80  Aligned_cols=38  Identities=5%  Similarity=0.034  Sum_probs=24.9

Q ss_pred             CCCC--CceeEEEeeCCC---------ChhHHHHHHHHHHHcCCCCChH
Q psy17913          2 SSQC--FIGTAYAFFTPG---------NARHAKQLVDVLIEANQSVTPA   39 (121)
Q Consensus         2 ~RaG--~~G~AiTFft~~---------n~~~a~dLv~lL~ea~QeVP~~   39 (121)
                      ||++  +.|+||+|++..         +....+++.+.+...+..||..
T Consensus       540 GR~gR~~~G~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~  588 (652)
T PRK05298        540 GRAARNVNGKVILYADKITDSMQKAIDETERRREIQIAYNEEHGITPKT  588 (652)
T ss_pred             ccccCCCCCEEEEEecCCCHHHHHHHHHHHHHHHHHHHhhhccCCCChh
Confidence            4444  469999999953         4445555656666667777754


No 119
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins. A family of small methanogenic corrinoid proteins that bind methyl-Co(III) 5-hydroxybenzimidazolylcobamide as a cofactor. They play a role on the methanogenesis from trimethylamine, dimethylamine or monomethylamine, which is initiated by a series of corrinoid-dependent methyltransferases.
Probab=27.80  E-value=80  Score=23.97  Aligned_cols=29  Identities=17%  Similarity=0.209  Sum_probs=22.3

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHcCC--CCC
Q psy17913          9 TAYAFFTPGNARHAKQLVDVLIEANQ--SVT   37 (121)
Q Consensus         9 ~AiTFft~~n~~~a~dLv~lL~ea~Q--eVP   37 (121)
                      +++|+........++++++.|++...  .||
T Consensus       137 v~lS~~~~~~~~~~~~~i~~lr~~~~~~~~~  167 (201)
T cd02070         137 LGLSALMTTTMGGMKEVIEALKEAGLRDKVK  167 (201)
T ss_pred             EEEeccccccHHHHHHHHHHHHHCCCCcCCe
Confidence            56787777777888999999998865  553


No 120
>PRK06298 type III secretion system protein; Validated
Probab=27.78  E-value=53  Score=27.99  Aligned_cols=26  Identities=23%  Similarity=0.134  Sum_probs=19.0

Q ss_pred             CChhHHHHHHHHHHHcCCCCChHHHHH
Q psy17913         17 GNARHAKQLVDVLIEANQSVTPALSEM   43 (121)
Q Consensus        17 ~n~~~a~dLv~lL~ea~QeVP~~L~~~   43 (121)
                      .|+.+|+.|.+. .|.+|+||++|-+-
T Consensus       308 en~pLARaLy~~-~evg~~IP~ely~A  333 (356)
T PRK06298        308 RNVPLAHQLLDE-GKELKFIPESTYEA  333 (356)
T ss_pred             eCHHHHHHHHHc-CCCCCcCCHHHHHH
Confidence            477888888763 35789999876544


No 121
>PRK13689 hypothetical protein; Provisional
Probab=27.38  E-value=1e+02  Score=21.09  Aligned_cols=24  Identities=17%  Similarity=0.152  Sum_probs=17.8

Q ss_pred             hhHHHHHHHHHHHcCCCCChHHHH
Q psy17913         19 ARHAKQLVDVLIEANQSVTPALSE   42 (121)
Q Consensus        19 ~~~a~dLv~lL~ea~QeVP~~L~~   42 (121)
                      ..++.||+.+|++.+.++---|..
T Consensus        13 E~il~el~~VLeKH~Ap~DLSLMv   36 (75)
T PRK13689         13 EQLLAELLAVLEKHKAPTDLSLMV   36 (75)
T ss_pred             HHHHHHHHHHHHhcCCCccHHHHH
Confidence            468899999999887666554443


No 122
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains. This CD includes the C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains. The Escherichia coli tdcB gene product, ThrD-II, anaerobically catalyzes the pyridoxal phosphate-dependent dehydration of L-threonine and L-serine to ammonia and to alpha-ketobutyrate and pyruvate, respectively. Tetrameric ThrD-II is subject to allosteric activation by AMP, inhibition by alpha-keto acids, and catabolite inactivation by several metabolites of glycolysis and the citric acid cycle. Also included in  this CD are  N-terminal ACT domains present in smaller (~170 a.a.) archaeal proteins of unknown function. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=27.15  E-value=69  Score=18.80  Aligned_cols=24  Identities=21%  Similarity=0.340  Sum_probs=18.9

Q ss_pred             eeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         13 FFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        13 Fft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      +..++.+..+.+|+++|.+++-.|
T Consensus         3 v~~~d~~G~L~~i~~~i~~~~~nI   26 (73)
T cd04886           3 VELPDRPGQLAKLLAVIAEAGANI   26 (73)
T ss_pred             EEeCCCCChHHHHHHHHHHcCCCE
Confidence            445677888999999999887665


No 123
>cd00271 Chemokine_C Chemokine_C, C or lymphotactin subgroup, 1 of 4 subgroup designations of chemokines based on the arrangement of two N-terminal, conserved cysteine residues. Most of the known chemokines (cd00169) belong to either the CC (cd00272) or CXC (cd00273) subclass. The two other subclasses each have a single known member: fractalkine for the CX3C (cd00274) class and lymphotactin for the C (cd00271) class. Chemokine_Cs differ structurally since they contain only one of the two disulfide bridges that are conserved in all other chemokines and they possess a unique C-terminal extension, which is required for biological activity and thought to play a role in receptor binding. Lymphotactin, a mediator of mucosal immunity, has been found to chemoattract neutrophils and B cells through the XCR1 receptor and thought to be a factor in acute allograft rejection and inflammatory bowel disease.
Probab=26.66  E-value=1e+02  Score=20.37  Aligned_cols=26  Identities=23%  Similarity=0.247  Sum_probs=17.7

Q ss_pred             eEEEeeCCC--------ChhHHHHHHHHHHHcCC
Q psy17913          9 TAYAFFTPG--------NARHAKQLVDVLIEANQ   34 (121)
Q Consensus         9 ~AiTFft~~--------n~~~a~dLv~lL~ea~Q   34 (121)
                      .||-|+|.+        +..+++++++.|.+..+
T Consensus        35 ~AVIF~Tkkgr~iCadP~~~WVq~~i~~ld~~~~   68 (72)
T cd00271          35 RAVIFITKRGLKICADPQAKWVKSAVKTIDRRAS   68 (72)
T ss_pred             CeEEEEecCCCEEeCCCChHHHHHHHHHHHhhcc
Confidence            477787754        45688888887775543


No 124
>PRK12721 secretion system apparatus protein SsaU; Reviewed
Probab=26.61  E-value=59  Score=27.59  Aligned_cols=26  Identities=19%  Similarity=0.152  Sum_probs=18.9

Q ss_pred             CChhHHHHHHHHHHHcCCCCChHHHHH
Q psy17913         17 GNARHAKQLVDVLIEANQSVTPALSEM   43 (121)
Q Consensus        17 ~n~~~a~dLv~lL~ea~QeVP~~L~~~   43 (121)
                      +|+.+|+.|.+..+ .+|+||++|-+-
T Consensus       307 en~pLARaLY~~~~-vg~~IP~ely~a  332 (349)
T PRK12721        307 ENIPLARALFKEVE-CGDYIPETLFEP  332 (349)
T ss_pred             eCHHHHHHHHHhCC-CCCcCCHHHHHH
Confidence            47888888887444 779999876543


No 125
>COG3082 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.48  E-value=1.1e+02  Score=20.83  Aligned_cols=25  Identities=16%  Similarity=0.213  Sum_probs=19.2

Q ss_pred             hhHHHHHHHHHHHcCCCCChHHHHH
Q psy17913         19 ARHAKQLVDVLIEANQSVTPALSEM   43 (121)
Q Consensus        19 ~~~a~dLv~lL~ea~QeVP~~L~~~   43 (121)
                      ..|+.||+.+|++.+.++.-.|..+
T Consensus        13 e~il~e~iaVLeKH~ap~dLsLmvl   37 (74)
T COG3082          13 EQILNELIAVLEKHKAPTDLSLMVL   37 (74)
T ss_pred             HHHHHHHHHHHHhcCCCcchhHHHH
Confidence            4578999999999988776655543


No 126
>PF05014 Nuc_deoxyrib_tr:  Nucleoside 2-deoxyribosyltransferase;  InterPro: IPR007710 Nucleoside 2-deoxyribosyltransferase (2.4.2.6 from EC) catalyses the cleavage of the glycosidic bonds of 2-deoxyribonucleosides. Nucleoside 2-deoxyribosyltransferases can be divided into two groups based on their substrate specificity: class I enzymes are specific for the transfer of deoxyribose between two purines, while class II enzymes will transfer the deoxyribose between either purines or pyrimidines. The structure of the class I [] and class II [] enzymes are very similar. In class I enzymes, the purine base shields the active site from solvent, which the smaller pyrimidine base cannot do, while in class II enzymes the active site is shielded by a loop (residues 48-62). Both classes of enzymes are found in various Lactobacillus species and participate in nucleoside recycling in these microorganisms. This entry represents both classes of enzymes.; GO: 0050144 nucleoside deoxyribosyltransferase activity, 0070694 deoxyribonucleoside 5'-monophosphate N-glycosidase activity, 0009159 deoxyribonucleoside monophosphate catabolic process; PDB: 1S2L_A 1S2D_C 1S2I_A 1S3F_B 1S2G_C 2A0K_A 2F67_A 2F64_B 2F62_A 2F2T_A ....
Probab=26.33  E-value=14  Score=25.40  Aligned_cols=27  Identities=22%  Similarity=0.303  Sum_probs=21.4

Q ss_pred             EEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         10 AYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        10 AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      |=.||++.+..+...|.++|++...+|
T Consensus         4 Agp~F~~~~~~~~~~~~~~L~~~g~~v   30 (113)
T PF05014_consen    4 AGPFFSEEQKARVERLREALEKNGFEV   30 (113)
T ss_dssp             ESGGSSHHHHHHHHHHHHHHHTTTTEE
T ss_pred             eCCcCCHHHHHHHHHHHHHHHhCCCEE
Confidence            345788888899999999999886543


No 127
>COG4840 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.16  E-value=1.3e+02  Score=20.34  Aligned_cols=30  Identities=7%  Similarity=0.140  Sum_probs=24.5

Q ss_pred             ChhHHHHHHHHHHHcCCCCChHHHHHHHhc
Q psy17913         18 NARHAKQLVDVLIEANQSVTPALSEMSQMS   47 (121)
Q Consensus        18 n~~~a~dLv~lL~ea~QeVP~~L~~~a~~~   47 (121)
                      +.+-+.||.++++....--|.+++.+|.+-
T Consensus        37 ~~edLtdiy~mvkkkenfSpsEmqaiA~eL   66 (71)
T COG4840          37 NYEDLTDIYDMVKKKENFSPSEMQAIADEL   66 (71)
T ss_pred             cHHHHHHHHHHHHHhccCCHHHHHHHHHHH
Confidence            445678888988888888899999998864


No 128
>KOG1283|consensus
Probab=26.09  E-value=57  Score=28.52  Aligned_cols=24  Identities=25%  Similarity=0.508  Sum_probs=18.9

Q ss_pred             eeEEEeeC------CCChhHHHHHHHHHHH
Q psy17913          8 GTAYAFFT------PGNARHAKQLVDVLIE   31 (121)
Q Consensus         8 G~AiTFft------~~n~~~a~dLv~lL~e   31 (121)
                      |..+||++      .+++.+|.||+++|+.
T Consensus        82 GaGfSyVdg~~~Y~~~~~qia~Dl~~llk~  111 (414)
T KOG1283|consen   82 GAGFSYVDGSSAYTTNNKQIALDLVELLKG  111 (414)
T ss_pred             cCceeeecCcccccccHHHHHHHHHHHHHH
Confidence            56677775      4578999999999984


No 129
>PF07197 DUF1409:  Protein of unknown function (DUF1409);  InterPro: IPR010811 This represents a short conserved region (approximately 50 residues long), sometimes repeated, within a number of hypothetical Oryza sativa proteins of unknown function.
Probab=25.60  E-value=37  Score=21.53  Aligned_cols=20  Identities=15%  Similarity=0.215  Sum_probs=16.4

Q ss_pred             HHHHHcCCCCChHHHHHHHh
Q psy17913         27 DVLIEANQSVTPALSEMSQM   46 (121)
Q Consensus        27 ~lL~ea~QeVP~~L~~~a~~   46 (121)
                      .-|+|.+.+||.++.+++..
T Consensus        19 arleE~qa~i~~e~~~l~~~   38 (51)
T PF07197_consen   19 ARLEEIQAQIPDELAKLATP   38 (51)
T ss_pred             HHHHHHHHHhhHHHHHhcCh
Confidence            55788999999999888754


No 130
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate. Included in this CD is the C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate, found in Bacillus subtilis (BS) and other Firmicutes, Deinococci, and Bacteroidetes. PDH is the first enzyme in the aromatic amino acid pathway specific for the biosynthesis of tyrosine. This enzyme is feedback inhibited by tyrosine in B. subtilis and other microorganisms. Both phenylalanine and tryptophan have been shown to be inhibitors of this activity in B. subtilis. Bifunctional  chorismate mutase-PDH (TyrA) enzymes such as those seen in Escherichia coli do not contain an ACT domain. Also included in this CD is the N-terminal ACT domain of a novel protein composed almost entirely of two tandem A
Probab=25.45  E-value=82  Score=18.43  Aligned_cols=26  Identities=15%  Similarity=0.364  Sum_probs=20.6

Q ss_pred             EeeCCCChhHHHHHHHHHHHcCCCCC
Q psy17913         12 AFFTPGNARHAKQLVDVLIEANQSVT   37 (121)
Q Consensus        12 TFft~~n~~~a~dLv~lL~ea~QeVP   37 (121)
                      ++..++.+..+.++.++|.+++..|.
T Consensus         2 ~v~~~d~~G~l~~i~~~l~~~~inI~   27 (56)
T cd04889           2 SVFVENKPGRLAEVTEILAEAGINIK   27 (56)
T ss_pred             EEEeCCCCChHHHHHHHHHHcCCCEe
Confidence            45667778888999999999987763


No 131
>PF04877 Hairpins:  HrpZ;  InterPro: IPR006961  HrpZ (harpin elicitor) from the plant pathogen Pseudomonas syringae binds to lipid bilayers and forms a cation-conducting pore in vivo. This pore-forming activity may allow nutrient release or delivery of virulence factors during bacterial colonisation of host plants [].  The entry also represents hairpinN which is a virulence determinant which elicits lesion formation in Arabidopsis and tobacco and triggers systemic resistance in Arabidopsis []. 
Probab=25.34  E-value=52  Score=27.90  Aligned_cols=36  Identities=11%  Similarity=0.195  Sum_probs=27.5

Q ss_pred             eeEEEeeCCCChhHHHHHHHHHHHcCCCCC-----hHHHHHH
Q psy17913          8 GTAYAFFTPGNARHAKQLVDVLIEANQSVT-----PALSEMS   44 (121)
Q Consensus         8 G~AiTFft~~n~~~a~dLv~lL~ea~QeVP-----~~L~~~a   44 (121)
                      +--.+| .++|..++++|.++|...-.+.|     .|-.+|.
T Consensus       154 g~g~~F-~~~D~~lL~eIaqFMD~nPe~FgkPd~~sW~~eLk  194 (308)
T PF04877_consen  154 GGGATF-SKEDMPLLKEIAQFMDQNPEQFGKPDRKSWADELK  194 (308)
T ss_pred             CCCccc-CcccHHHHHHHHHHHhcCHhhcCCCCCchHHHHhh
Confidence            334567 88999999999999997755443     3888774


No 132
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains. This ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD; including those enzymes similar to the GlnD found in enteric Escherichia coli and those found in photosynthetic, nitrogen-fixing bacterium Rhodospirillum rubrum. Also included in this CD is the N-terminal ACT domain of a yet characterized Arabidopsis/Oryza predicted tyrosine kinase. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=25.30  E-value=1e+02  Score=19.35  Aligned_cols=28  Identities=14%  Similarity=0.222  Sum_probs=23.5

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913          9 TAYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus         9 ~AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      +-+.+++++.+.++.+|..+|...+-.|
T Consensus         2 ~~i~v~~~Dr~gLl~~i~~~l~~~~l~I   29 (73)
T cd04900           2 TEVFIYTPDRPGLFARIAGALDQLGLNI   29 (73)
T ss_pred             EEEEEEecCCCCHHHHHHHHHHHCCCCe
Confidence            3477888999999999999999887665


No 133
>TIGR02764 spore_ybaN_pdaB polysaccharide deacetylase family sporulation protein PdaB. This model describes the YbaN protein family, also called PdaB and SpoVIE, of Gram-positive bacteria. Although ybaN null mutants have only a mild sporulation defect, ybaN/ytrI double mutants show drastically reducted sporulation efficiencies. This synthetic defect suggests the role of this sigmaE-controlled gene in sporulation had been masked by functional redundancy. Members of this family are homologous to a characterized polysaccharide deacetylase; the exact function this protein family is unknown.
Probab=25.23  E-value=1.4e+02  Score=21.96  Aligned_cols=27  Identities=19%  Similarity=0.151  Sum_probs=15.2

Q ss_pred             eeEEEeeCCCChhHHHHHHHHHHHcCC
Q psy17913          8 GTAYAFFTPGNARHAKQLVDVLIEANQ   34 (121)
Q Consensus         8 G~AiTFft~~n~~~a~dLv~lL~ea~Q   34 (121)
                      =+|+||=.--+......|+++|++.+-
T Consensus         7 ~V~LTFDDgp~~~~t~~~l~~L~~~~i   33 (191)
T TIGR02764         7 KIALTFDISWGNDYTEPILDTLKEYDV   33 (191)
T ss_pred             EEEEEEECCCCcccHHHHHHHHHHcCC
Confidence            366666443333455666777776644


No 134
>COG4824 Phage-related holin (Lysis protein) [General function prediction only]
Probab=24.77  E-value=53  Score=24.68  Aligned_cols=26  Identities=19%  Similarity=0.254  Sum_probs=20.7

Q ss_pred             HHHHHHHHHHHc---CCCCChHHHHHHHh
Q psy17913         21 HAKQLVDVLIEA---NQSVTPALSEMSQM   46 (121)
Q Consensus        21 ~a~dLv~lL~ea---~QeVP~~L~~~a~~   46 (121)
                      +|.|++++|+.+   .-+||+.|.+.-+.
T Consensus        95 iaNE~isI~EN~s~lGlpvPe~L~~~l~~  123 (133)
T COG4824          95 IANEGISILENASRLGLPVPEMLKDLLET  123 (133)
T ss_pred             HHhhhHHHHHHHHHhCCCchHHHHHHHHH
Confidence            688899998877   45899988877654


No 135
>TIGR01389 recQ ATP-dependent DNA helicase RecQ. The ATP-dependent DNA helicase RecQ of E. coli is about 600 residues long. This model represents bacterial proteins with a high degree of similarity in domain architecture and in primary sequence to E. coli RecQ. The model excludes eukaryotic and archaeal proteins with RecQ-like regions, as well as more distantly related bacterial helicases related to RecQ.
Probab=24.49  E-value=60  Score=28.61  Aligned_cols=25  Identities=12%  Similarity=0.291  Sum_probs=17.9

Q ss_pred             CCCCceeEEEeeCCCChhHHHHHHH
Q psy17913          3 SQCFIGTAYAFFTPGNARHAKQLVD   27 (121)
Q Consensus         3 RaG~~G~AiTFft~~n~~~a~dLv~   27 (121)
                      |.|+.+.|+.|+++.|..+.+.|++
T Consensus       317 R~G~~~~~il~~~~~d~~~~~~~i~  341 (591)
T TIGR01389       317 RDGLPAEAILLYSPADIALLKRRIE  341 (591)
T ss_pred             CCCCCceEEEecCHHHHHHHHHHHh
Confidence            3445678999999888766665553


No 136
>PF13625 Helicase_C_3:  Helicase conserved C-terminal domain
Probab=24.24  E-value=1.1e+02  Score=21.47  Aligned_cols=26  Identities=8%  Similarity=0.166  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHcC-CCCChHHHHHHHhc
Q psy17913         22 AKQLVDVLIEAN-QSVTPALSEMSQMS   47 (121)
Q Consensus        22 a~dLv~lL~ea~-QeVP~~L~~~a~~~   47 (121)
                      +.+|+++|++.. .+||+.|+.+..+.
T Consensus        57 ~e~i~~~L~~~S~~~lP~~v~~~i~~w   83 (129)
T PF13625_consen   57 AEEIIEFLERYSKNPLPQNVEQSIEDW   83 (129)
T ss_pred             HHHHHHHHHHHcCCCCCHHHHHHHHHH
Confidence            678889888765 68999888777653


No 137
>PTZ00373 60S Acidic ribosomal protein P2; Provisional
Probab=24.07  E-value=1.1e+02  Score=22.07  Aligned_cols=28  Identities=21%  Similarity=0.265  Sum_probs=22.2

Q ss_pred             hhHHHHHHHHHHHcCCCCCh-HHHHHHHh
Q psy17913         19 ARHAKQLVDVLIEANQSVTP-ALSEMSQM   46 (121)
Q Consensus        19 ~~~a~dLv~lL~ea~QeVP~-~L~~~a~~   46 (121)
                      ..-+.||.+||+.++-+|.+ |+..++..
T Consensus        19 ~pTaddI~kIL~AaGveVd~~~~~l~~~~   47 (112)
T PTZ00373         19 NPTKKEVKNVLSAVNADVEDDVLDNFFKS   47 (112)
T ss_pred             CCCHHHHHHHHHHcCCCccHHHHHHHHHH
Confidence            35588999999999999975 77766654


No 138
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS). ACT_AHAS: N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS). AHAS catalyses the first common step in the biosynthesis of the three branched-chain amino acids. The first step involves the condensation of either pyruvate or 2-ketobutyrate with the two-carbon hydroxyethyl fragment derived from another pyruvate molecule, covalently bound to the coenzyme thiamine diphosphate. Bacterial AHASs generally consist of regulatory and catalytic subunits. The effector (valine) binding sites are proposed to be located in two symmetrically related positions in the interface between a pair of N-terminal ACT domains with the C-terminal domain of IlvH contacting the catalytic dimer. Plants Arabidopsis and Oryza have tandem IlvH subunits; both the first and second ACT domain sequences are present in this CD. Members of
Probab=23.98  E-value=1.1e+02  Score=17.84  Aligned_cols=26  Identities=0%  Similarity=0.116  Sum_probs=18.4

Q ss_pred             EEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         11 YAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        11 iTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      +.+..++.+.++.+|.++|.+.+-.|
T Consensus         3 l~i~~~d~~g~l~~i~~~l~~~~~~i   28 (72)
T cd04878           3 LSVLVENEPGVLNRISGLFARRGFNI   28 (72)
T ss_pred             EEEEEcCCCcHHHHHHHHHHhCCCCE
Confidence            34455666778899999998775544


No 139
>TIGR02433 lysidine_TilS_C tRNA(Ile)-lysidine synthetase, C-terminal domain. TIGRFAMs model TIGR02432 describes the family of the N-terminal domain of tRNA(Ile)-lysidine synthetase. This family (TIGR02433) describes a small C-terminal domain of about 50 residues present in about half the members of family TIGR02432,and in no other protein. Characterized examples of tRNA(Ile)-lysidine synthetase from E. coli and Bacillus subtilis both contain this domain.
Probab=23.97  E-value=1.1e+02  Score=17.55  Aligned_cols=20  Identities=30%  Similarity=0.522  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHcCCCCChHHHHH
Q psy17913         22 AKQLVDVLIEANQSVTPALSEM   43 (121)
Q Consensus        22 a~dLv~lL~ea~QeVP~~L~~~   43 (121)
                      .+.|.++|+|  +.||+|+.+.
T Consensus        20 ~k~lkk~~~e--~kiP~~~R~~   39 (47)
T TIGR02433        20 SKKLKKLFID--AKVPPWLRDR   39 (47)
T ss_pred             CchHHHHHHH--cCCCHHHHcC
Confidence            4567777775  4799998654


No 140
>KOG1891|consensus
Probab=23.92  E-value=40  Score=27.84  Aligned_cols=14  Identities=21%  Similarity=0.304  Sum_probs=11.5

Q ss_pred             CCCCChHHHHHHHh
Q psy17913         33 NQSVTPALSEMSQM   46 (121)
Q Consensus        33 ~QeVP~~L~~~a~~   46 (121)
                      ..|||+||+..|..
T Consensus       195 ~~EiP~WL~vYa~a  208 (271)
T KOG1891|consen  195 EKEIPPWLLVYAQA  208 (271)
T ss_pred             hhhcCHHHHHHhcC
Confidence            45999999998864


No 141
>PRK12773 flhB flagellar biosynthesis protein FlhB; Reviewed
Probab=23.84  E-value=66  Score=29.89  Aligned_cols=28  Identities=14%  Similarity=0.173  Sum_probs=20.2

Q ss_pred             CChhHHHHHHHHHHHcCCCCChHHHHHHH
Q psy17913         17 GNARHAKQLVDVLIEANQSVTPALSEMSQ   45 (121)
Q Consensus        17 ~n~~~a~dLv~lL~ea~QeVP~~L~~~a~   45 (121)
                      +|+.+|+.|.+. .|.+|+||++|-+-.+
T Consensus       606 ENpPLARALY~~-veVGq~IP~eLYeAVA  633 (646)
T PRK12773        606 EDRLQARGLYEE-VELGAEVPQQFYRAIA  633 (646)
T ss_pred             ECHHHHHHHHHc-CCCCCcCCHHHHHHHH
Confidence            477888888873 4578999998765443


No 142
>cd00274 Chemokine_CX3C Chemokine_CX3C:  1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteines; differ structurally from the other subgroups in that they are attached to a membrane-spanning domain via a mucin-like stalk and can be proteolytically cleaved to a freely diffusible form; chemotatic for T cells, monocytes, and natural killer cells; function as monomers and are found only in vertebrates and a few viruses; currently only fractalkine (sometimes called neurotactin) has been identified as a member of this subfamily; the primary source of fractalkine is neurons, and they exhibit cell adhesion and chemoattractive properties in the central nervous system. See CDs:  Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_CC (cd00272), and Chemokine_C (cd00271) for the additional chemokine subgroups.
Probab=23.73  E-value=62  Score=21.93  Aligned_cols=25  Identities=16%  Similarity=0.062  Sum_probs=17.6

Q ss_pred             eEEEeeCCC--------ChhHHHHHHHHHHHcC
Q psy17913          9 TAYAFFTPG--------NARHAKQLVDVLIEAN   33 (121)
Q Consensus         9 ~AiTFft~~--------n~~~a~dLv~lL~ea~   33 (121)
                      -||-|+|.+        +..++.++++.|....
T Consensus        37 ~AVIF~Tkkgr~iCAdP~~~WVq~~mk~Ld~k~   69 (76)
T cd00274          37 RAIILETRQHRLFCADPKEQWVKDAMQHLDRQA   69 (76)
T ss_pred             CeEEEEECCCCEEeCCCChHHHHHHHHHHHHHH
Confidence            477888754        4578888888886543


No 143
>PLN00138 large subunit ribosomal protein LP2; Provisional
Probab=23.55  E-value=1.1e+02  Score=21.96  Aligned_cols=28  Identities=14%  Similarity=0.150  Sum_probs=22.6

Q ss_pred             hhHHHHHHHHHHHcCCCCCh-HHHHHHHh
Q psy17913         19 ARHAKQLVDVLIEANQSVTP-ALSEMSQM   46 (121)
Q Consensus        19 ~~~a~dLv~lL~ea~QeVP~-~L~~~a~~   46 (121)
                      ..-+.+|.+||+.++-+|.+ |+..++..
T Consensus        17 ~pta~dI~~IL~AaGvevd~~~~~~f~~~   45 (113)
T PLN00138         17 CPSAEDLKDILGSVGADADDDRIELLLSE   45 (113)
T ss_pred             CCCHHHHHHHHHHcCCcccHHHHHHHHHH
Confidence            45678999999999999975 77777654


No 144
>KOG0002|consensus
Probab=23.54  E-value=1e+02  Score=19.29  Aligned_cols=21  Identities=14%  Similarity=0.210  Sum_probs=12.8

Q ss_pred             HHHHHHHHHcCCCCChHHHHHH
Q psy17913         23 KQLVDVLIEANQSVTPALSEMS   44 (121)
Q Consensus        23 ~dLv~lL~ea~QeVP~~L~~~a   44 (121)
                      ..|.+.++ .|-+||+|+.-+.
T Consensus         8 ~kl~k~~k-qnr~iP~WiRm~~   28 (48)
T KOG0002|consen    8 QKLAKKLK-QNRPIPQWIRMRT   28 (48)
T ss_pred             HHHHHHHH-ccCCccHHHhhcc
Confidence            34444433 4668999987554


No 145
>KOG3200|consensus
Probab=23.49  E-value=50  Score=26.46  Aligned_cols=14  Identities=14%  Similarity=0.161  Sum_probs=11.7

Q ss_pred             CCCCChHHHHHHHh
Q psy17913         33 NQSVTPALSEMSQM   46 (121)
Q Consensus        33 ~QeVP~~L~~~a~~   46 (121)
                      -+|+|+||+.+.++
T Consensus        63 peelP~wLq~~v~k   76 (224)
T KOG3200|consen   63 PEELPPWLQYYVDK   76 (224)
T ss_pred             ccccCHHHHHHHHH
Confidence            37899999998765


No 146
>PRK00254 ski2-like helicase; Provisional
Probab=23.17  E-value=1.4e+02  Score=27.22  Aligned_cols=18  Identities=22%  Similarity=0.189  Sum_probs=14.3

Q ss_pred             CCCCCC-----ceeEEEeeCCCC
Q psy17913          1 MSSQCF-----IGTAYAFFTPGN   18 (121)
Q Consensus         1 ~~RaG~-----~G~AiTFft~~n   18 (121)
                      +||||+     .|.||.|+++++
T Consensus       367 ~GRAGR~~~d~~G~~ii~~~~~~  389 (720)
T PRK00254        367 MGRAGRPKYDEVGEAIIVATTEE  389 (720)
T ss_pred             hhccCCCCcCCCceEEEEecCcc
Confidence            478887     489999998755


No 147
>PF03444 HrcA_DNA-bdg:  Winged helix-turn-helix transcription repressor, HrcA DNA-binding;  InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress. Commonly, they induce a set of proteins that protect cellular proteins from being denatured by heat. Among such proteins are the GroE and DnaK chaperones whose transcription is regulated by a heat-shock repressor protein HrcA. HrcA is a winged helix-turn-helix repressor that negatively regulates the transcription of dnaK and groE operons by binding the upstream CIRCE (controlling inverted repeat of chaperone expression) element. In Bacillus subtilis this element is a perfect 9 base pair inverted repeat separated by a 9 base pair spacer.   The crystal structure of a heat-inducible transcriptional repressor, HrcA, from Thermotoga maritima has been reported at 2.2A resolution. HrcA is composed of three domains: an N-terminal winged helix-turn-helix domain (WHTH), a GAF-like domain, and an inserted dimerizing domain (IDD). The IDD shows a unique structural fold with an anti-parallel beta-sheet composed of three beta-strands sided by four alpha-helices. HrcA crystallises as a dimer, which is formed through hydrophobic contact between the IDDs and a limited contact that involves conserved residues between the GAF-like domains []. The structural studies suggest that the inactive form of HrcA is the dimer and this is converted to its DNA-binding form by interaction with GroEL, which binds to a conserved C-terminal sequence region [, ]. Comparison of the HrcA-CIRCE complexes from B. subtilis and Bacillus thermoglucosidasius (Geobacillus thermoglucosidasius), which grow at vastly different ranges of temperature shows that the thermostability profiles were consistent with the difference in the growth temperatures suggesting that HrcA can function as a thermosensor to detect temperature changes in cells []. Any increase in temperature causes the dissociation of the HrcA from the CIRCE complex with the concomitant activation of transcription of the groE and dnaK operons.  This domain represents the winged helix-turn-helix DNA-binding domain which is located close to the N terminus of HrcA. This domain is also found at the N terminus of a set of uncharacterised proteins that have two C-terminal CBS domains. ; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent
Probab=23.17  E-value=63  Score=22.08  Aligned_cols=25  Identities=28%  Similarity=0.380  Sum_probs=22.0

Q ss_pred             eCCCChhHHHHHHHHHHHcCCCCCh
Q psy17913         14 FTPGNARHAKQLVDVLIEANQSVTP   38 (121)
Q Consensus        14 ft~~n~~~a~dLv~lL~ea~QeVP~   38 (121)
                      +|+....+++.||++..+.+++|..
T Consensus         2 Lt~rq~~IL~alV~~Y~~~~~PVgS   26 (78)
T PF03444_consen    2 LTERQREILKALVELYIETGEPVGS   26 (78)
T ss_pred             CCHHHHHHHHHHHHHHHhcCCCcCH
Confidence            5677889999999999999999975


No 148
>PF13740 ACT_6:  ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A.
Probab=23.05  E-value=49  Score=21.19  Aligned_cols=27  Identities=15%  Similarity=0.212  Sum_probs=20.6

Q ss_pred             EEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         10 AYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        10 AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      -||++-++.+.++.+|.++|.+.+..|
T Consensus         4 vItv~G~DrpGiv~~v~~~l~~~g~ni   30 (76)
T PF13740_consen    4 VITVVGPDRPGIVAAVTGVLAEHGCNI   30 (76)
T ss_dssp             EEEEEEE--TTHHHHHHHHHHCTT-EE
T ss_pred             EEEEEecCCCcHHHHHHHHHHHCCCcE
Confidence            478888899999999999999887655


No 149
>PF01312 Bac_export_2:  FlhB HrpN YscU SpaS Family;  InterPro: IPR006135 Salmonella, and related proteobacteria, secrete large amounts of proteins into the culture media. The major secreted proteins are either flagellar proteins or virulence factors [], secreted through the flagellar or virulence export structures respectively. Both secretion systems penetrate the inner and outer membranes and their components bear substantial sequence similarity. Both the flagellar and needle like pilus look fairly similar to each other [].  The type III secretion system is of great interest, as it is used to transport virulence factors from the pathogen directly into the host cell [] and is only triggered when the bacterium comes into close contact with the host.  It is believed that the family of type III flagellar and pilus inner membrane proteins are used as structural moieties in a complex with several other subunits []. One such set of inner membrane proteins, labeled "S" here for nomenclature purposes, includes the Salmonella and Shigella SpaS, the Yersinia YscU, Rhizobium Y4YO, and the Erwinia HrcU genes, Salmonella FlhB and Escherichia coli EscU [, , , ]. Many of the proteins, in this entry, undergo autocatalytic cleavage promoted by cyclization of a conserved asparagine. These proteins belong to the MEROPS peptidase family N6. ; GO: 0009306 protein secretion, 0016020 membrane; PDB: 3C03_C 3BZT_A 3BZV_B 3BZP_A 3BZX_B 3BZL_B 3C00_A 3BZR_A 3BZY_A 3BZO_A ....
Probab=22.83  E-value=52  Score=27.64  Aligned_cols=26  Identities=23%  Similarity=0.235  Sum_probs=15.4

Q ss_pred             CChhHHHHHHHHHHHcCCCCChHHHHH
Q psy17913         17 GNARHAKQLVDVLIEANQSVTPALSEM   43 (121)
Q Consensus        17 ~n~~~a~dLv~lL~ea~QeVP~~L~~~   43 (121)
                      +|+.+|+.|.+..+ -+|+||++|-+-
T Consensus       309 en~pLARaLy~~~~-~g~~IP~ely~a  334 (343)
T PF01312_consen  309 ENPPLARALYRTVE-VGQEIPEELYEA  334 (343)
T ss_dssp             E-HHHHHHHHHHS--TTSB--GGGHHH
T ss_pred             eCHHHHHHHHhcCC-CCCcCCHHHHHH
Confidence            46778888876544 688999875543


No 150
>PF09350 DUF1992:  Domain of unknown function (DUF1992);  InterPro: IPR018961  This entry represents a family of proteins that may have a role in protein folding or as a chaperone. DnaJ is a member of the J-protein family, which are defined by the presence of a J domain that can regulate the activity of 70kDa heat-shock proteins []. Some of the proteins in this entry contain a J domain.
Probab=22.42  E-value=1.3e+02  Score=19.73  Aligned_cols=20  Identities=15%  Similarity=0.159  Sum_probs=13.2

Q ss_pred             HHHHHHHHHcCCCCChHHHHH
Q psy17913         23 KQLVDVLIEANQSVTPALSEM   43 (121)
Q Consensus        23 ~dLv~lL~ea~QeVP~~L~~~   43 (121)
                      +-+-++|+.++. +|+||+..
T Consensus        39 ~~~~~iLk~~g~-lPp~i~l~   58 (71)
T PF09350_consen   39 RMANRILKNAGY-LPPWIELR   58 (71)
T ss_pred             HHHHHhhcccCC-CCHHHHHH
Confidence            445566666665 89987754


No 151
>KOG0983|consensus
Probab=22.37  E-value=1.1e+02  Score=26.43  Aligned_cols=30  Identities=13%  Similarity=0.184  Sum_probs=23.9

Q ss_pred             EeeCCCChhHHHHHH-----HHHHHcCCCCChHHH
Q psy17913         12 AFFTPGNARHAKQLV-----DVLIEANQSVTPALS   41 (121)
Q Consensus        12 TFft~~n~~~a~dLv-----~lL~ea~QeVP~~L~   41 (121)
                      .|+++.|..++-+|.     +||+...++||+.+.
T Consensus       159 yFi~n~dV~IcMelMs~C~ekLlkrik~piPE~il  193 (391)
T KOG0983|consen  159 YFITNTDVFICMELMSTCAEKLLKRIKGPIPERIL  193 (391)
T ss_pred             EEeeCchHHHHHHHHHHHHHHHHHHhcCCchHHhh
Confidence            477888888777765     799999999998754


No 152
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains. Included in this CD is the N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains as seen in the uncharacterized structure (pdb 2F06) of the Bt0572 protein from Bacteroides thetaiotaomicron and related ACT domains. These tandem ACT domain proteins belong to the superfamily of ACT regulatory domains.
Probab=22.06  E-value=1.2e+02  Score=18.46  Aligned_cols=26  Identities=15%  Similarity=0.309  Sum_probs=20.2

Q ss_pred             EEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         11 YAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        11 iTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      |+...++.+..+.+|.++|.+++-.|
T Consensus         4 i~v~v~d~pG~La~v~~~l~~~~inI   29 (66)
T cd04908           4 LSVFLENKPGRLAAVTEILSEAGINI   29 (66)
T ss_pred             EEEEEcCCCChHHHHHHHHHHCCCCE
Confidence            45566777888899999999887765


No 153
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein. This CD, ACT_1ZPV, includes those single ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein (pdb structure 1ZPV). Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=22.02  E-value=1.3e+02  Score=19.48  Aligned_cols=27  Identities=11%  Similarity=0.070  Sum_probs=23.6

Q ss_pred             EEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         10 AYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        10 AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      .+++.-++.+.++.+|.++|-+.+..|
T Consensus         3 vl~i~g~D~pGiva~vt~~la~~g~nI   29 (88)
T cd04872           3 VITVVGKDRVGIVAGVSTKLAELNVNI   29 (88)
T ss_pred             EEEEEcCCCCCHHHHHHHHHHHcCCCE
Confidence            478888999999999999999887766


No 154
>COG5094 TAF9 Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription]
Probab=21.99  E-value=96  Score=23.40  Aligned_cols=32  Identities=22%  Similarity=0.255  Sum_probs=24.0

Q ss_pred             CCCChhHHHHHHHHH--HHcCCCCChHHHHHHHh
Q psy17913         15 TPGNARHAKQLVDVL--IEANQSVTPALSEMSQM   46 (121)
Q Consensus        15 t~~n~~~a~dLv~lL--~ea~QeVP~~L~~~a~~   46 (121)
                      -|+|.+++.-|+.-|  .+..+.||-.|.++|..
T Consensus        13 gPrDvrlihliL~Slgi~~ye~~VplQLl~FAhR   46 (145)
T COG5094          13 GPRDVRLIHLILRSLGIEEYEPKVPLQLLEFAHR   46 (145)
T ss_pred             CCcchhHHHHHHHhcCchhhCccchHHHHHHHHH
Confidence            477887777666543  46788999999999854


No 155
>PTZ00072 40S ribosomal protein S13; Provisional
Probab=21.81  E-value=1.1e+02  Score=23.33  Aligned_cols=25  Identities=8%  Similarity=0.194  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHcC--CCCChHHHHHHHh
Q psy17913         22 AKQLVDVLIEAN--QSVTPALSEMSQM   46 (121)
Q Consensus        22 a~dLv~lL~ea~--QeVP~~L~~~a~~   46 (121)
                      -+.|.++|++.+  -|||++|..|...
T Consensus        65 G~kI~rILk~~Glap~iPeDly~LikK   91 (148)
T PTZ00072         65 GSKILRILKKNGLAPEIPEDLYFLIKK   91 (148)
T ss_pred             chHHHHHHHhcCCCCCCchHHHHHHHH
Confidence            355888999988  4899999888654


No 156
>PF01842 ACT:  ACT domain;  InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold. ACT domains are linked to a wide range of metabolic enzymes that are regulated by amino acid concentration. The archetypical ACT domain is the C-terminal regulatory domain of 3-phosphoglycerate dehydrogenase (3PGDH), which folds with a ferredoxin-like topology. A pair of ACT domains form an eight-stranded antiparallel sheet with two molecules of allosteric inhibitor serine bound in the interface. Biochemical exploration of a few other proteins containing ACT domains supports the suggestions that these domains contain the archetypical ACT structure [].; GO: 0016597 amino acid binding, 0008152 metabolic process; PDB: 3L76_B 2F06_B 3NRB_C 1Y7P_C 2QMX_A 2DT9_A 2ZHO_D 3K5P_A 3TVI_K 3C1M_C ....
Probab=21.67  E-value=87  Score=18.31  Aligned_cols=27  Identities=7%  Similarity=0.229  Sum_probs=20.7

Q ss_pred             EEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913         10 AYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        10 AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      -+++..++.+.++.+|.++|.+.+-.|
T Consensus         2 ~v~v~~~drpG~l~~v~~~la~~~inI   28 (66)
T PF01842_consen    2 RVRVIVPDRPGILADVTEILADHGINI   28 (66)
T ss_dssp             EEEEEEETSTTHHHHHHHHHHHTTEEE
T ss_pred             EEEEEcCCCCCHHHHHHHHHHHcCCCH
Confidence            356667788889999999998876443


No 157
>KOG0542|consensus
Probab=21.60  E-value=1.7e+02  Score=24.58  Aligned_cols=35  Identities=17%  Similarity=0.081  Sum_probs=30.4

Q ss_pred             EEeeCCCChhHHHHHHHHHHHcCCCCChHHHHHHH
Q psy17913         11 YAFFTPGNARHAKQLVDVLIEANQSVTPALSEMSQ   45 (121)
Q Consensus        11 iTFft~~n~~~a~dLv~lL~ea~QeVP~~L~~~a~   45 (121)
                      .+|+|..+..+.+-|..-.+-.+-++|+|+.+...
T Consensus       155 ~Afvtdg~wDl~~~l~~qck~~~i~~P~~f~qwIn  189 (280)
T KOG0542|consen  155 FAFVTDGDWDLWVFLQYQCKLKNIRIPAFFNQWIN  189 (280)
T ss_pred             eEEEeCchhhHHHHHHHHHHHhcCCCcHHHHHHhH
Confidence            68999999988888888888889999999887764


No 158
>PF09814 HECT_2:  HECT-like Ubiquitin-conjugating enzyme (E2)-binding;  InterPro: IPR019193 This entry consists of E3 ubiquitin-protein ligases which accept ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfer it to substrates, generally promoting their degradation by the proteasome [].
Probab=21.46  E-value=75  Score=25.88  Aligned_cols=26  Identities=15%  Similarity=0.396  Sum_probs=22.8

Q ss_pred             hhHHHHHHHHHHHcCCCCChHHHHHH
Q psy17913         19 ARHAKQLVDVLIEANQSVTPALSEMS   44 (121)
Q Consensus        19 ~~~a~dLv~lL~ea~QeVP~~L~~~a   44 (121)
                      ..+..+|+++|++.+..+|+.+..|.
T Consensus       324 ~~~~~~l~~~L~~s~~~lP~s~R~~~  349 (354)
T PF09814_consen  324 PEMCDELIELLESSNSLLPPSCRKFN  349 (354)
T ss_pred             HHHHHHHHHHHHHHhhhCCHhHhhhC
Confidence            56789999999999999999888764


No 159
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family. This model describes a subfamily of the B12 binding domain (pfam02607, pfam02310) proteins. Members of the seed alignment include corrinoid proteins specific to four different, mutally non-homologous enzymes of the genus Methanosarcina. Three of the four cognate enzymes (trimethylamine, dimethylamine, and monomethylamine methyltransferases) all have the unusual, ribosomally incorporated amino acid pyrrolysine at the active site. All act in systems in which a methyl group is transferred to the corrinoid protein to create methylcobalamin, from which the methyl group is later transferred elsewhere.
Probab=21.38  E-value=1.2e+02  Score=23.16  Aligned_cols=25  Identities=16%  Similarity=0.062  Sum_probs=20.0

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHcC
Q psy17913          9 TAYAFFTPGNARHAKQLVDVLIEAN   33 (121)
Q Consensus         9 ~AiTFft~~n~~~a~dLv~lL~ea~   33 (121)
                      +++|+....+...++++++.|++..
T Consensus       139 v~lS~~~~~~~~~~~~~i~~l~~~~  163 (197)
T TIGR02370       139 LTGSALMTTTMYGQKDINDKLKEEG  163 (197)
T ss_pred             EEEccccccCHHHHHHHHHHHHHcC
Confidence            5677777777778899999999883


No 160
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=21.35  E-value=44  Score=25.37  Aligned_cols=22  Identities=14%  Similarity=0.111  Sum_probs=10.1

Q ss_pred             hhHHHHHHHHHHHcCCCCChHH
Q psy17913         19 ARHAKQLVDVLIEANQSVTPAL   40 (121)
Q Consensus        19 ~~~a~dLv~lL~ea~QeVP~~L   40 (121)
                      .+-+.+|++.|+...++.|+||
T Consensus       255 Rps~~el~~~l~~~~~~~~~~~  276 (279)
T cd05111         255 RPTFKELANEFTRMARDPPRYL  276 (279)
T ss_pred             CcCHHHHHHHHHHHHhCCccee
Confidence            3344444444444444444444


No 161
>PF10281 Ish1:  Putative stress-responsive nuclear envelope protein;  InterPro: IPR018803  This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues []. 
Probab=21.30  E-value=1.7e+02  Score=16.51  Aligned_cols=16  Identities=19%  Similarity=0.092  Sum_probs=13.5

Q ss_pred             HHHHHHHHHcCCCCCh
Q psy17913         23 KQLVDVLIEANQSVTP   38 (121)
Q Consensus        23 ~dLv~lL~ea~QeVP~   38 (121)
                      .+|.+-|++.+.++|+
T Consensus         7 ~~L~~wL~~~gi~~~~   22 (38)
T PF10281_consen    7 SDLKSWLKSHGIPVPK   22 (38)
T ss_pred             HHHHHHHHHcCCCCCC
Confidence            5788999999888875


No 162
>PF01894 UPF0047:  Uncharacterised protein family UPF0047;  InterPro: IPR001602 This family contains small uncharacterised proteins of 14 to 16 kDa mainly from bacteria although the signatures also occur in a hypothetical protein from archaea and from yeast.; PDB: 1VPH_E 2P6C_A 2CU5_A 1VMJ_A 1XBF_B 1VMH_A 1VE0_A 2P6H_B 1VMF_C.
Probab=21.22  E-value=1.4e+02  Score=21.45  Aligned_cols=18  Identities=11%  Similarity=0.237  Sum_probs=14.9

Q ss_pred             CCC-ChhHHHHHHHHHHHc
Q psy17913         15 TPG-NARHAKQLVDVLIEA   32 (121)
Q Consensus        15 t~~-n~~~a~dLv~lL~ea   32 (121)
                      ++. |+.+.+||.+.|++-
T Consensus        35 nE~~dp~v~~Dl~~~l~~l   53 (118)
T PF01894_consen   35 NENADPDVRRDLLEALERL   53 (118)
T ss_dssp             EESSSHHHHHHHHHHHHHH
T ss_pred             eecCChhHHHhHHHHHHHh
Confidence            344 899999999999865


No 163
>PF00725 3HCDH:  3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;  InterPro: IPR006108 3-hydroxyacyl-CoA dehydrogenase (1.1.1.35 from EC) (HCDH) [] is an enzyme involved in fatty acid metabolism, it catalyzes the reduction of 3-hydroxyacyl-CoA to 3-oxoacyl-CoA. Most eukaryotic cells have 2 fatty-acid beta-oxidation systems, one located in mitochondria and the other in peroxisomes. In peroxisomes 3-hydroxyacyl-CoA dehydrogenase forms, with enoyl-CoA hydratase (ECH) and 3,2-trans-enoyl-CoA isomerase (ECI) a multifunctional enzyme where the N-terminal domain bears the hydratase/isomerase activities and the C-terminal domain the dehydrogenase activity. There are two mitochondrial enzymes: one which is monofunctional and the other which is, like its peroxisomal counterpart, multifunctional. In Escherichia coli (gene fadB) and Pseudomonas fragi (gene faoA) HCDH is part of a multifunctional enzyme which also contains an ECH/ECI domain as well as a 3-hydroxybutyryl-CoA epimerase domain []. There are two major region of similarities in the sequences of proteins of the HCDH family, the first one located in the N-terminal, corresponds to the NAD-binding site, the second one is located in the centre of the sequence. This represents the C-terminal domain which is also found in lambda crystallin. Some proteins include two copies of this domain.; GO: 0003857 3-hydroxyacyl-CoA dehydrogenase activity, 0016491 oxidoreductase activity, 0006631 fatty acid metabolic process, 0055114 oxidation-reduction process; PDB: 3MOG_A 2WTB_A 3ADP_A 3ADO_A 1WDL_B 2D3T_B 1WDK_A 1WDM_B 3K6J_A 1ZCJ_A ....
Probab=21.16  E-value=74  Score=20.88  Aligned_cols=16  Identities=25%  Similarity=0.347  Sum_probs=10.1

Q ss_pred             CCCChHHHHHHHhccC
Q psy17913         34 QSVTPALSEMSQMSAM   49 (121)
Q Consensus        34 QeVP~~L~~~a~~~~~   49 (121)
                      .++|++|++|.++..-
T Consensus        71 ~~~~~~l~~mv~~g~~   86 (97)
T PF00725_consen   71 FRPSPLLKEMVEEGRL   86 (97)
T ss_dssp             GSS-HHHHHHHHTT--
T ss_pred             CCchHHHHHHHHCCCC
Confidence            3567899999986544


No 164
>PF01090 Ribosomal_S19e:  Ribosomal protein S19e;  InterPro: IPR001266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family includes a number of eukaryotic and archaebacterial ribosomal proteins; mammalian S19, Drosophila S19, Ascaris lumbricoides S19g (ALEP-1) and S19s, yeast YS16 (RP55A and RP55B), Aspergillus S16 and Haloarcula marismortui HS12.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3IZ6_S 3U5G_T 3U5C_T 3O30_M 3O2Z_M 3IZB_S 2XZN_T 2XZM_T 2V7F_A.
Probab=21.12  E-value=36  Score=25.59  Aligned_cols=23  Identities=13%  Similarity=0.131  Sum_probs=14.9

Q ss_pred             hhHHHHHHHHHHHcCC-CCChHHH
Q psy17913         19 ARHAKQLVDVLIEANQ-SVTPALS   41 (121)
Q Consensus        19 ~~~a~dLv~lL~ea~Q-eVP~~L~   41 (121)
                      ..+.+.|.+.|++.++ ++|+|..
T Consensus         9 ~~fI~~~A~~LK~~gki~~P~w~d   32 (139)
T PF01090_consen    9 DEFIKALAEFLKKSGKIEPPEWAD   32 (139)
T ss_dssp             HHHHHHHHHHHTCSSTS--TSCGG
T ss_pred             HHHHHHHHHHHHHcCCcCCcchHH
Confidence            3567888889988755 5666654


No 165
>smart00229 RasGEFN Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal motif. A subset of guanine nucleotide exchange factor for Ras-like small GTPases appear to possess this domain N-terminal to the RasGef (Cdc25-like) domain. The recent crystal structureof Sos shows that this domain is alpha-helical and plays a "purely structural role" (Nature 394, 337-343).
Probab=21.08  E-value=1.4e+02  Score=20.40  Aligned_cols=28  Identities=11%  Similarity=0.184  Sum_probs=18.3

Q ss_pred             ChhHHHHHHHHHHHcCCC-CChHHHHHHH
Q psy17913         18 NARHAKQLVDVLIEANQS-VTPALSEMSQ   45 (121)
Q Consensus        18 n~~~a~dLv~lL~ea~Qe-VP~~L~~~a~   45 (121)
                      ++.+...|.+++.+..++ +|.|...++.
T Consensus        93 ~~~l~~~l~~f~~~~~~~~~~~~~~~l~~  121 (127)
T smart00229       93 DPKLILRLLEFLDLVDQEKGPGLVTSLQE  121 (127)
T ss_pred             CHHHHHHHHHHHHHHhhCcCCCHHHHHHH
Confidence            444667777777766555 7777666654


No 166
>cd04868 ACT_AK-like ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase). This CD includes each of two ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase). Typically, AK consists of two ACT domains in a tandem repeat, but the second ACT domain is inserted within the first, resulting in, what is normally the terminal beta strand of ACT2, formed from a region N-terminal of ACT1. AK catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. Aspartokinase is the first enzyme in the pathway of the biosynthesis of the aspartate family of amino acids (lysine, threonine, methionine, and isoleucine) and the bacterial cell wall component, meso-diaminopimelate. One mechanism for the regulation of this pathway is by the production of several isoenzymes of aspartokinase with different repressors and allosteric inhibitors. Pairs of ACT domains are proposed to specifically bind am
Probab=20.62  E-value=1.7e+02  Score=16.08  Aligned_cols=26  Identities=23%  Similarity=0.279  Sum_probs=17.5

Q ss_pred             EEeeCCC---ChhHHHHHHHHHHHcCCCC
Q psy17913         11 YAFFTPG---NARHAKQLVDVLIEANQSV   36 (121)
Q Consensus        11 iTFft~~---n~~~a~dLv~lL~ea~QeV   36 (121)
                      ++++...   +..++.++.++|.+.+-+|
T Consensus         3 i~v~g~~~~~~~~~~~~i~~~l~~~~i~i   31 (60)
T cd04868           3 VSIVGVGMRGTPGVAAKIFSALAEAGINV   31 (60)
T ss_pred             EEEECCCCCCCCCHHHHHHHHHHHCCCcE
Confidence            5666443   5667888999998775443


No 167
>PF02310 B12-binding:  B12 binding domain;  InterPro: IPR006158  The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin). Cobalamin-binding domains are mainly found in two families of enzymes present in animals and prokaryotes, which perform distinct kinds of reactions at the cobalt-carbon bond. Enzymes that require methylcobalamin carry out methyl transfer reactions. Enzymes that require adenosylcobalamin catalyse reactions in which the first step is the cleavage of adenosylcobalamin to form cob(II)alamin and the 5'-deoxyadenosyl radical, and thus act as radical generators. In both types of enzymes the B12-binding domain uses a histidine to bind the cobalt atom of cobalamin cofactors. This histidine is embedded in a DXHXXG sequence, the most conserved primary sequence motif of the domain [, , ]. Proteins containing the cobalamin-binding domain include:    Animal and prokaryotic methionine synthase (2.1.1.13 from EC), which catalyse the transfer of a methyl group from methyl-cobalamin to homocysteine, yielding enzyme-bound cob(I)alamin and methionine. Animal and prokaryotic methylmalonyl-CoA mutase (5.4.99.2 from EC), which are involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle.  Prokaryotic lysine 5,6-aminomutase (5.4.3.4 from EC).  Prokaryotic glutamate mutase (5.4.99.1 from EC) [].  Prokaryotic methyleneglutarate mutase (5.4.99.4 from EC).  Prokaryotic isobutyryl-CoA mutase (5.4.99.13 from EC).    The core structure of the cobalamin-binding domain is characterised by a five-stranded alpha/beta (Rossmann) fold, which consists of 5 parallel beta-sheets surrounded by 4-5 alpha helices in three layers (alpha/beta/alpha) []. Upon binding cobalamin, important elements of the binding site appear to become structured, including an alpha-helix that forms on one side of the cleft accommodating the nucleotide 'tail' of the cofactor. In cobalamin, the cobalt atom can be either free (dmb-off) or bound to dimethylbenzimidazole (dmb-on) according to the pH. When bound to the cobalamin-binding domain, the dimethylbenzimidazole ligand is replaced by the active histidine (His-on) of the DXHXXG motif. The replacement of dimethylbenzimidazole by histidine allows switching between the catalytic and activation cycles []. In methionine synthase the cobalamin cofactor is sandwiched between the cobalamin-binding domain and an approximately 90 residues N-terminal domain forming a helical bundle comprising two pairs of antiparallel helices []. In methionine synthase, there is a second, adjacent domain involved in cobalamin binding that forms a 4-helical bundle cap (IPR003759 from INTERPRO); in the conversion to the active conformation of this enzyme, the 4-helical cap rotates to allow the cobalamin cofactor to bind the activation domain (IPR004223 from INTERPRO) [].; GO: 0031419 cobalamin binding, 0046872 metal ion binding; PDB: 1Y80_A 3BUL_A 1K7Y_A 1BMT_A 3IV9_A 1K98_A 3IVA_A 3KP1_A 3KOW_A 3KOZ_A ....
Probab=20.61  E-value=1.2e+02  Score=20.19  Aligned_cols=28  Identities=21%  Similarity=0.246  Sum_probs=17.1

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHcCCCC
Q psy17913          9 TAYAFFTPGNARHAKQLVDVLIEANQSV   36 (121)
Q Consensus         9 ~AiTFft~~n~~~a~dLv~lL~ea~QeV   36 (121)
                      +++|.....+...+.+|++.+++.+..+
T Consensus        55 V~iS~~~~~~~~~~~~l~~~~k~~~p~~   82 (121)
T PF02310_consen   55 VGISVSMTPNLPEAKRLARAIKERNPNI   82 (121)
T ss_dssp             EEEEESSSTHHHHHHHHHHHHHTTCTTS
T ss_pred             EEEEccCcCcHHHHHHHHHHHHhcCCCC
Confidence            4566644455556677777777665543


No 168
>PF15606 Toxin_55:  Putative toxin 55
Probab=20.52  E-value=1.4e+02  Score=20.40  Aligned_cols=30  Identities=13%  Similarity=0.254  Sum_probs=21.9

Q ss_pred             CChhHHHHHHHHHHHc------CCCCChHHHHHHHh
Q psy17913         17 GNARHAKQLVDVLIEA------NQSVTPALSEMSQM   46 (121)
Q Consensus        17 ~n~~~a~dLv~lL~ea------~QeVP~~L~~~a~~   46 (121)
                      -|..|+.++-+++.++      ++...+||++|.+.
T Consensus        16 aDTgI~~~v~~~~~~~~~~~GK~~drCd~Lqelid~   51 (77)
T PF15606_consen   16 ADTGIVQQVYEIISDAFQSGGKAPDRCDVLQELIDC   51 (77)
T ss_pred             hhHHHHHHHHHHHHHHHhhcCCCCcHHHHHHHHHHc
Confidence            3667888888877755      44677899998763


No 169
>cd05833 Ribosomal_P2 Ribosomal protein P2. This subfamily represents the eukaryotic large ribosomal protein P2. Eukaryotic P1 and P2 are functionally equivalent to the bacterial protein L7/L12, but are not homologous to L7/L12. P2 is located in the L12 stalk, with proteins P1, P0, L11, and 28S rRNA. P1 and P2 are the only proteins in the ribosome to occur as multimers, always appearing as sets of heterodimers. Recent data indicate that eukaryotes have four copies (two heterodimers), while most archaeal species contain six copies of L12p (three homodimers). Bacteria may have four or six copies of L7/L12 (two or three homodimers) depending on the species. Experiments using S. cerevisiae P1 and P2 indicate that P1 proteins are positioned more internally with limited reactivity in the C-terminal domains, while P2 proteins seem to be more externally located and are more likely to interact with other cellular components. In lower eukaryotes, P1 and P2 are further subdivided into P1A, P1B, P2
Probab=20.51  E-value=1.5e+02  Score=21.17  Aligned_cols=28  Identities=14%  Similarity=0.144  Sum_probs=22.1

Q ss_pred             hhHHHHHHHHHHHcCCCCCh-HHHHHHHh
Q psy17913         19 ARHAKQLVDVLIEANQSVTP-ALSEMSQM   46 (121)
Q Consensus        19 ~~~a~dLv~lL~ea~QeVP~-~L~~~a~~   46 (121)
                      ..-+.+|.+||+.++-+|.+ |+..++..
T Consensus        17 ~pTa~dI~~IL~AaGveVe~~~~~lf~~~   45 (109)
T cd05833          17 SPSAADVKKILGSVGVEVDDEKLNKVISE   45 (109)
T ss_pred             CCCHHHHHHHHHHcCCCccHHHHHHHHHH
Confidence            45678999999999999965 77766653


No 170
>PF02603 Hpr_kinase_N:  HPr Serine kinase N terminus;  InterPro: IPR011126 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This entry represents the N-terminal region of Hpr Serine/threonine kinase PtsK. This kinase is the sensor in a multicomponent phosphorelay system in control of carbon catabolic repression in bacteria []. This kinase in unusual in that it recognises the tertiary structure of its target and is a member of a novel family unrelated to any previously described protein phosphorylating enzymes []. X-ray analysis of the full-length crystalline enzyme from Staphylococcus xylosus at a resolution of 1.95 A shows the enzyme to consist of two clearly separated domains that are assembled in a hexameric structure resembling a three-bladed propeller. The blades are formed by two N-terminal domains each, and the compact central hub assembles the C-terminal kinase domains []. ; GO: 0000155 two-component sensor activity, 0004672 protein kinase activity, 0005524 ATP binding, 0000160 two-component signal transduction system (phosphorelay), 0006109 regulation of carbohydrate metabolic process; PDB: 1KNX_B 1KO7_A.
Probab=20.31  E-value=72  Score=22.75  Aligned_cols=18  Identities=17%  Similarity=0.224  Sum_probs=12.0

Q ss_pred             HcCCCCChHHHHHHHhcc
Q psy17913         31 EANQSVTPALSEMSQMSA   48 (121)
Q Consensus        31 ea~QeVP~~L~~~a~~~~   48 (121)
                      ..++++|++|.++|++..
T Consensus        88 t~~~~~p~~l~e~a~~~~  105 (127)
T PF02603_consen   88 TRGLEPPPELIELAEKYN  105 (127)
T ss_dssp             ETTT---HHHHHHHHHCT
T ss_pred             ECcCCCCHHHHHHHHHhC
Confidence            448899999999998753


No 171
>PF11698 V-ATPase_H_C:  V-ATPase subunit H;  InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) (3.6.3.14 from EC) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release []. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins []. This entry represents the C-terminal domain of subunit H (also known as Vma13p) found in the V1 complex of V-ATPases. This subunit has a regulatory function, being responsible for activating ATPase activity and coupling ATPase activity to proton flow []. The yeast enzyme contains five motifs similar to the HEAT or Armadillo repeats seen in the importins, and can be divided into two distinct domains: a large N-terminal domain consisting of stacked alpha helices, and a smaller C-terminal alpha-helical domain with a similar superhelical topology to an armadillo repeat []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0015991 ATP hydrolysis coupled proton transport, 0000221 vacuolar proton-transporting V-type ATPase, V1 domain; PDB: 1HO8_A.
Probab=20.22  E-value=56  Score=23.86  Aligned_cols=20  Identities=25%  Similarity=0.408  Sum_probs=15.8

Q ss_pred             eCCCChhHHHHHHHHHHHcC
Q psy17913         14 FTPGNARHAKQLVDVLIEAN   33 (121)
Q Consensus        14 ft~~n~~~a~dLv~lL~ea~   33 (121)
                      |+++|..+++.|+++|..+.
T Consensus        37 f~~~~~~llk~L~~lL~~s~   56 (119)
T PF11698_consen   37 FEENNFELLKKLIKLLDKSD   56 (119)
T ss_dssp             GSSGGGHHHHHHHHHH-SHH
T ss_pred             HHHcccHHHHHHHHHHccCC
Confidence            47788999999999996554


No 172
>PRK09333 30S ribosomal protein S19e; Provisional
Probab=20.16  E-value=84  Score=23.94  Aligned_cols=23  Identities=9%  Similarity=0.063  Sum_probs=16.3

Q ss_pred             hhHHHHHHHHHHHcCC-CCChHHH
Q psy17913         19 ARHAKQLVDVLIEANQ-SVTPALS   41 (121)
Q Consensus        19 ~~~a~dLv~lL~ea~Q-eVP~~L~   41 (121)
                      ..+...|.+.|++..+ ++|+|..
T Consensus        10 ~~~I~~~A~~LK~~~ki~~P~W~~   33 (150)
T PRK09333         10 DLLIERLAEYLKNVDEIKPPEWAA   33 (150)
T ss_pred             HHHHHHHHHHHHhcCCcCCCcchh
Confidence            3567888888987755 6666755


No 173
>PRK06719 precorrin-2 dehydrogenase; Validated
Probab=20.08  E-value=1.5e+02  Score=21.79  Aligned_cols=37  Identities=16%  Similarity=0.229  Sum_probs=27.1

Q ss_pred             eEEEeeCCC-ChhHHHHHHHHHHHcCCCCChHHHHHHHhcc
Q psy17913          9 TAYAFFTPG-NARHAKQLVDVLIEANQSVTPALSEMSQMSA   48 (121)
Q Consensus         9 ~AiTFft~~-n~~~a~dLv~lL~ea~QeVP~~L~~~a~~~~   48 (121)
                      +-|+.-|.. ++.+++.|.+.|++   .+|+.+.++|.++.
T Consensus       119 l~iaisT~G~sP~la~~lr~~ie~---~l~~~~~~~a~~~~  156 (157)
T PRK06719        119 YVVTISTSGKDPSFTKRLKQELTS---ILPKLIKKISRTHK  156 (157)
T ss_pred             eEEEEECCCcChHHHHHHHHHHHH---HhhHHHHHHHhhcc
Confidence            455555654 77888888887774   57889999998763


No 174
>PF10551 MULE:  MULE transposase domain;  InterPro: IPR018289 This entry represents a domain found in Mutator-like elements (MULE)-encoded tranposases, some of which also contain a zinc-finger motif [, ]. This domain is also found in a transposase for the insertion sequence element IS256 in transposon Tn4001 []. 
Probab=20.05  E-value=1.9e+02  Score=18.38  Aligned_cols=27  Identities=19%  Similarity=0.261  Sum_probs=19.3

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHcCCC
Q psy17913          9 TAYAFFTPGNARHAKQLVDVLIEANQS   35 (121)
Q Consensus         9 ~AiTFft~~n~~~a~dLv~lL~ea~Qe   35 (121)
                      +|+.++..++......+++.|+++.++
T Consensus        29 v~~~l~~~e~~~~~~~~l~~~~~~~~~   55 (93)
T PF10551_consen   29 VAFALVSSESEESYEWFLEKLKEAMPQ   55 (93)
T ss_pred             EEEEEEcCCChhhhHHHHHHhhhcccc
Confidence            466777777777777777777777653


Done!