Diaphorina citri psyllid: psy17914

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
ISGKSQFLFAIVYTARYLDLFTSYVSVYNSFMKIVFIAASYGTVYLMYIKFKATYDHNHDTFRYLDLFTSYVSVYNSFMKIVFIAASYGTVYLMYIKFKATYDHNHDTFRGLLSESDPTVLWTFSIYLESVAILPQLFLVSKTGEAESITSHYLFALGAYRALYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLYITRGKPVDSCGLCHNIVPGPLYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLLQTRVVCVITLYRVLYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLLQTRVVCVITLYRALYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLYITRVKTTWTLLPLWLELFRPPSTVTSSICTSLEVSLQTRVVCVVTLYRALYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLYITRVSLRDYKQIADQLSLAGGR
ccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHEEEEEEEcccccccccccccccccHHHHHHHHccHHHHHHEEccccEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEECccccccHHHHHHHHHHHHHHHHHHHHEEEcccccccccHHHHHHHHHHHHHccEEEEEEEEcccccccccCCccccccEEEEEEEEEEEEHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHEEEEccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccCEEEEEEccccEEEEEEEEEEEHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHEEEEEEEcccccccccccHHcccc
ISGKSQFLFAIVYTARYLDLFTSYVSVYNSFMKIVFIAASYGTVYLMYIKFKATYDHNHDTFRYLDLFTSYVSVYNSFMKIVFIAASYGTVYLMYIKFKATYDHNHDTFRGLLSESDPTVLWTFSIYLESVAILPQLFLVSKTGEAESITSHYLFALGAYRALYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLYITRGKPVDSCGLCHNIVPGPLYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLLQTRVVCVITLYRVLYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLLQTRVVCVITLYRALYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLYITRVKTTWTLLPLWLELFRPPSTVTSSICTSLEVSLQTRVVCVVTLYRALYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLYITRVSLRDYKQIAD********
xxxxxxxxxxxxxxxxxxxxHHHHHxxxxxHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ISGKSQFLFAIVYTARYLDLFTSYVSVYNSFMKIVFIAASYGTVYLMYIKFKATYDHNHDTFRYLDLFTSYVSVYNSFMKIVFIAASYGTVYLMYIKFKATYDHNHDTFRGLLSESDPTVLWTFSIYLESVAILPQLFLVSKTGEAESITSHYLFALGAYRALYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLYITRGKPVDSCGLCHNIVPGPLYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLLQTRVVCVITLYRVLYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLLQTRVVCVITLYRALYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLYITRVKTTWTLLPLWLELFRPPSTVTSSICTSLEVSLQTRVVCVVTLYRALYLLNWVYRYYSEDYLDLIAIVAGVVQTALYCDFFYLYITRVSLRDYKQIADQLSLAGGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ER lumen protein retaining receptor 2 Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L.confidentP33947
ER lumen protein retaining receptor 2 Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L.confidentQ5ZKX9
ER lumen protein retaining receptor 2 Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L.confidentQ6PEH1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005801 [CC]cis-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005793 [CC]endoplasmic reticulum-Golgi intermediate compartmentprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046907 [BP]intracellular transportprobableGO:0009987, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005046 [MF]KDEL sequence bindingprobableGO:0042277, GO:0005048, GO:0033218, GO:0003674, GO:0005488, GO:0046923

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted