Query         psy17926
Match_columns 95
No_of_seqs    129 out of 1007
Neff          5.2 
Searched_HMMs 46136
Date          Fri Aug 16 17:40:04 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17926.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17926hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4126|consensus              100.0 1.3E-31 2.8E-36  220.3   6.8   86    5-91    165-256 (529)
  2 smart00098 alkPPc Alkaline pho  99.9 7.2E-28 1.6E-32  194.7   5.8   83    5-92     84-172 (419)
  3 PRK10518 alkaline phosphatase;  99.9 1.9E-25 4.1E-30  183.1   6.6   83    2-89    150-243 (476)
  4 cd00016 alkPPc Alkaline phosph  99.9 3.3E-25 7.2E-30  176.8   6.7   69    6-88     96-169 (384)
  5 PF00245 Alk_phosphatase:  Alka  99.9 8.5E-26 1.8E-30  182.2   2.1   87    2-91     80-172 (421)
  6 COG1785 PhoA Alkaline phosphat  99.9 2.6E-22 5.7E-27  164.8   5.1   71    4-88    139-217 (482)
  7 PRK11587 putative phosphatase;  46.9      16 0.00035   26.1   2.1   23    8-31     88-110 (218)
  8 TIGR01509 HAD-SF-IA-v3 haloaci  46.6      19  0.0004   24.2   2.3   25    8-33     90-114 (183)
  9 TIGR01149 mtrG N5-methyltetrah  45.9       3 6.5E-05   26.8  -1.6   19    6-24     26-44  (70)
 10 PRK06769 hypothetical protein;  45.5      20 0.00042   25.2   2.3   22    8-30     33-54  (173)
 11 PRK08942 D,D-heptose 1,7-bisph  42.4      24 0.00052   24.6   2.4   21    9-30     35-55  (181)
 12 TIGR01428 HAD_type_II 2-haloal  42.2      24 0.00053   24.5   2.4   23    8-31     97-119 (198)
 13 TIGR01664 DNA-3'-Pase DNA 3'-p  42.2      24 0.00051   24.9   2.3   22    8-30     47-68  (166)
 14 PRK01026 tetrahydromethanopter  42.2     3.8 8.2E-05   26.8  -1.6   19    6-24     29-47  (77)
 15 TIGR00213 GmhB_yaeD D,D-heptos  42.2      24 0.00053   24.5   2.4   22    8-30     31-52  (176)
 16 TIGR02253 CTE7 HAD superfamily  40.7      26 0.00055   24.7   2.3   24    8-32     99-122 (221)
 17 TIGR01449 PGP_bact 2-phosphogl  39.3      29 0.00063   24.1   2.4   23    8-31     90-112 (213)
 18 PF04210 MtrG:  Tetrahydrometha  37.5      11 0.00023   24.3  -0.0   19    6-24     26-44  (70)
 19 TIGR01681 HAD-SF-IIIC HAD-supe  36.3      29 0.00063   23.2   1.9   20    9-29     35-54  (128)
 20 PRK09456 ?-D-glucose-1-phospha  35.9      27 0.00058   24.6   1.8   24    8-32     89-112 (199)
 21 TIGR01549 HAD-SF-IA-v1 haloaci  34.9      34 0.00073   22.6   2.1   23    8-31     69-91  (154)
 22 TIGR03351 PhnX-like phosphonat  34.3      36 0.00077   24.0   2.2   22    9-31     93-114 (220)
 23 PLN02770 haloacid dehalogenase  33.1      38 0.00082   24.9   2.3   22    8-30    113-134 (248)
 24 TIGR01656 Histidinol-ppas hist  32.9      42 0.00091   22.6   2.3   21    9-30     33-53  (147)
 25 TIGR02247 HAD-1A3-hyp Epoxide   32.4      39 0.00084   23.7   2.2   22    9-31    100-121 (211)
 26 TIGR01685 MDP-1 magnesium-depe  32.1      40 0.00086   24.4   2.2   21    8-29     50-70  (174)
 27 TIGR02244 HAD-IG-Ncltidse HAD   31.9      38 0.00082   27.3   2.2   25    7-32    188-212 (343)
 28 TIGR02252 DREG-2 REG-2-like, H  31.8      43 0.00092   23.3   2.3   21    9-30    111-131 (203)
 29 TIGR01662 HAD-SF-IIIA HAD-supe  31.4      49  0.0011   21.5   2.4   21    9-30     31-51  (132)
 30 PRK13288 pyrophosphatase PpaX;  30.4      48   0.001   23.4   2.3   23    8-31     87-109 (214)
 31 TIGR01454 AHBA_synth_RP 3-amin  29.9      49  0.0011   23.2   2.3   24    8-32     80-103 (205)
 32 TIGR01261 hisB_Nterm histidino  29.7      49  0.0011   23.3   2.3   21    8-29     34-54  (161)
 33 COG0546 Gph Predicted phosphat  29.6      49  0.0011   23.9   2.3   29    7-36     93-121 (220)
 34 PLN03243 haloacid dehalogenase  29.1      46   0.001   25.1   2.2   23    8-31    114-136 (260)
 35 PRK10826 2-deoxyglucose-6-phos  28.9      51  0.0011   23.4   2.3   24    8-32     97-120 (222)
 36 PRK14988 GMP/IMP nucleotidase;  28.9      51  0.0011   24.0   2.3   22    8-30     98-119 (224)
 37 TIGR01422 phosphonatase phosph  28.3      45 0.00097   24.3   2.0   21    9-30    105-125 (253)
 38 PLN02811 hydrolase              28.2      52  0.0011   23.5   2.2   23    8-31     83-105 (220)
 39 PRK13478 phosphonoacetaldehyde  28.1      47   0.001   24.6   2.0   22    8-30    106-127 (267)
 40 PRK06698 bifunctional 5'-methy  28.1      48   0.001   26.9   2.2   26    8-34    335-360 (459)
 41 TIGR01990 bPGM beta-phosphoglu  26.9      58  0.0013   22.0   2.2   20    9-29     93-112 (185)
 42 PLN02779 haloacid dehalogenase  26.3      56  0.0012   24.9   2.2   23    8-31    149-171 (286)
 43 TIGR00338 serB phosphoserine p  26.1      57  0.0012   22.9   2.1   22    8-30     90-111 (219)
 44 PRK13226 phosphoglycolate phos  25.8      58  0.0013   23.5   2.1   22    8-30    100-121 (229)
 45 TIGR01459 HAD-SF-IIA-hyp4 HAD-  24.7      67  0.0014   23.5   2.3   18   13-30     33-50  (242)
 46 cd07397 MPP_DevT Myxococcus xa  24.4 1.1E+02  0.0024   23.4   3.5   49   29-82    150-201 (238)
 47 TIGR01491 HAD-SF-IB-PSPlk HAD-  24.2      68  0.0015   21.9   2.2   22    8-30     85-106 (201)
 48 PF14502 HTH_41:  Helix-turn-he  24.1      30 0.00064   20.6   0.3   22    5-27      3-24  (48)
 49 TIGR01548 HAD-SF-IA-hyp1 haloa  23.9      75  0.0016   22.2   2.4   23    9-32    112-134 (197)
 50 TIGR02335 hydr_PhnA phosphonoa  23.6      73  0.0016   25.9   2.5   20    7-27    101-120 (408)
 51 TIGR01691 enolase-ppase 2,3-di  22.9      71  0.0015   23.8   2.2   22    9-31    101-122 (220)
 52 PF13419 HAD_2:  Haloacid dehal  22.9      79  0.0017   20.4   2.2   21    9-30     83-103 (176)
 53 TIGR03172 probable selenium-de  22.5      65  0.0014   24.5   1.9   23   13-35     18-40  (232)
 54 TIGR02009 PGMB-YQAB-SF beta-ph  22.3      80  0.0017   21.3   2.2   20    9-29     94-113 (185)
 55 TIGR01668 YqeG_hyp_ppase HAD s  22.2      75  0.0016   22.2   2.1   18   13-30     52-69  (170)
 56 PLN02954 phosphoserine phospha  22.2      73  0.0016   22.5   2.0   25    7-32     88-112 (224)
 57 PRK09552 mtnX 2-hydroxy-3-keto  22.1      73  0.0016   22.8   2.1   27    8-35     79-105 (219)
 58 PRK13225 phosphoglycolate phos  21.6      78  0.0017   24.1   2.2   22    8-30    147-168 (273)
 59 TIGR01670 YrbI-phosphatas 3-de  20.8   1E+02  0.0022   21.1   2.5   22   13-34     37-58  (154)
 60 cd07372 2A5CPDO_B The beta sub  20.6 1.4E+02   0.003   23.3   3.5   31   13-43    173-207 (294)

No 1  
>KOG4126|consensus
Probab=99.97  E-value=1.3e-31  Score=220.27  Aligned_cols=86  Identities=41%  Similarity=0.623  Sum_probs=81.6

Q ss_pred             ccccccHHHHHHHHcCCcEeEEeeccCCCCCcccceeccCCCCCccCCCCccccc-cChHHHHHHHhhcCCCCCccEEE-
Q psy17926          5 LEKVRRVQTYVAYGTGKATGIVTNTRVTHATPAAFYGHSPSRYWEDDGKVPVISR-KSCKDLARQLVEDYPGKDINSFD-   82 (95)
Q Consensus         5 ~~~~~ti~le~Ak~~Gk~tGiVTT~~vthATPAa~yAH~~~R~we~d~~~~~~~~-~~~~dIA~Qlv~~~~g~~~dVil-   82 (95)
                      ++.|.|| ++|||++||+||||||+||||||||++|||+++|+||||++||.+.+ .+|.|||+||+++++|+++|||| 
T Consensus       165 ~~~v~SI-l~wAq~AGk~tG~VTTTRvThAsPag~yAH~anR~wE~D~~v~~~~~~~~c~DiA~QLi~~~~G~~l~Vi~G  243 (529)
T KOG4126|consen  165 GNHVISI-LEWAQLAGKSTGLVTTTRVTHASPAGAYAHVANRNWECDAEVPASAGGEGCQDIARQLIEQPVGKNLDVILG  243 (529)
T ss_pred             cccchHH-HHHHHHhCcccceEEEeeeccCCchhhhhccccccccccccccccccccchHHHHHHHhccCCCCceEEEec
Confidence            5678899 99999999999999999999999999999999999999999999665 58999999999999999999999 


Q ss_pred             ----ecccCCCCC
Q psy17926         83 ----EFYPGKDIN   91 (95)
Q Consensus        83 ----~F~p~~~~d   91 (95)
                          +|+|+...|
T Consensus       244 GGr~~f~~~~~~d  256 (529)
T KOG4126|consen  244 GGRKYFLPKGTND  256 (529)
T ss_pred             CCcccccCCCCCC
Confidence                999998888


No 2  
>smart00098 alkPPc Alkaline phosphatase homologues.
Probab=99.94  E-value=7.2e-28  Score=194.66  Aligned_cols=83  Identities=41%  Similarity=0.627  Sum_probs=76.6

Q ss_pred             ccccccHHHHHHHHcCCcEeEEeeccCCCCCcccceeccCCCCCccCCCCccccc-cChHHHHHHHhhcCCCCCccEEE-
Q psy17926          5 LEKVRRVQTYVAYGTGKATGIVTNTRVTHATPAAFYGHSPSRYWEDDGKVPVISR-KSCKDLARQLVEDYPGKDINSFD-   82 (95)
Q Consensus         5 ~~~~~ti~le~Ak~~Gk~tGiVTT~~vthATPAa~yAH~~~R~we~d~~~~~~~~-~~~~dIA~Qlv~~~~g~~~dVil-   82 (95)
                      +++++|| +||||++||+||||||++||||||||||||+.+|+||++.+++.... .+|.+||+||++.    ++|||| 
T Consensus        84 ~~~~~tI-le~Ak~~G~~tGiVTT~~ithATPAafyAH~~~R~~e~~~~i~~~~~~~~~~dIa~Ql~~~----~~dVilG  158 (419)
T smart00098       84 GKEVPSV-LEWAKKAGKSTGLVTTTRITHATPAATYAHVASRKWYNDADIPAEALENGCGDIARQLINN----RIDVLLG  158 (419)
T ss_pred             CCcchhH-HHHHHHcCCcEEEEeCcccCCCcchhheeecccccccchhhhHHHHhhcCCccHHHHHhhc----CCcEEEe
Confidence            7899999 99999999999999999999999999999999999999999888553 5899999999997    799999 


Q ss_pred             ----ecccCCCCCc
Q psy17926         83 ----EFYPGKDINA   92 (95)
Q Consensus        83 ----~F~p~~~~d~   92 (95)
                          +|+|+.+.|+
T Consensus       159 GG~~~F~p~~~~~~  172 (419)
T smart00098      159 GGRSYFAPTGTADP  172 (419)
T ss_pred             CCcccccccCCCcc
Confidence                8999887654


No 3  
>PRK10518 alkaline phosphatase; Provisional
Probab=99.92  E-value=1.9e-25  Score=183.09  Aligned_cols=83  Identities=22%  Similarity=0.218  Sum_probs=70.7

Q ss_pred             CCCccccccHHHHHHHHcCCcEeEEeeccCCCCCcccceeccCCCCCccCCCCcccc------ccChHHHHHHHhhcCCC
Q psy17926          2 KLDLEKVRRVQTYVAYGTGKATGIVTNTRVTHATPAAFYGHSPSRYWEDDGKVPVIS------RKSCKDLARQLVEDYPG   75 (95)
Q Consensus         2 ~~d~~~~~ti~le~Ak~~Gk~tGiVTT~~vthATPAa~yAH~~~R~we~d~~~~~~~------~~~~~dIA~Qlv~~~~g   75 (95)
                      +.+++++.|| +||||++||+||||||++||||||||||||+.+|+||+|.......      .+++.+||+||++.   
T Consensus       150 d~~g~~v~TI-lE~Ak~~G~aTGiVTT~~ithATPAafyAH~~~R~~~~~~~~~~~c~~~~~~~gg~~~IA~Ql~~~---  225 (476)
T PRK10518        150 DIHGKDHPTL-LELAKAAGKATGNVSTAELQDATPAALVAHVTSRKCYGPEETSEKCPGNALENGGRGSITEQLLNT---  225 (476)
T ss_pred             CCCCCcchhH-HHHHHHcCCcEEEEeccccCCCcchhhhhccchhhccCccccccccccccccccchhHHHHHHhcc---
Confidence            4468899999 9999999999999999999999999999999999999876632211      13456999999986   


Q ss_pred             CCccEEE-----ecccCCC
Q psy17926         76 KDINSFD-----EFYPGKD   89 (95)
Q Consensus        76 ~~~dVil-----~F~p~~~   89 (95)
                       ++||||     +|+|+..
T Consensus       226 -~~DVilGGG~~~F~~~~~  243 (476)
T PRK10518        226 -RADVTLGGGAKTFAETAT  243 (476)
T ss_pred             -CCeEEEeCChhhccccCC
Confidence             799999     8999654


No 4  
>cd00016 alkPPc Alkaline phosphatase homologues; alkaline phosphatases are non-specific phosphomonoesterases that catalyze the hydrolysis reaction via a phosphoseryl intermediate to produce inorganic phosphate and the corresponding alcohol, optimally at high pH. Alkaline phosphatase exists as a dimer, each monomer binding 2 zinc atoms and one magnesium atom, which are essential for enzymatic activity.
Probab=99.91  E-value=3.3e-25  Score=176.83  Aligned_cols=69  Identities=55%  Similarity=0.857  Sum_probs=66.1

Q ss_pred             cccccHHHHHHHHcCCcEeEEeeccCCCCCcccceeccCCCCCccCCCCccccccChHHHHHHHhhcCCCCCccEEE---
Q psy17926          6 EKVRRVQTYVAYGTGKATGIVTNTRVTHATPAAFYGHSPSRYWEDDGKVPVISRKSCKDLARQLVEDYPGKDINSFD---   82 (95)
Q Consensus         6 ~~~~ti~le~Ak~~Gk~tGiVTT~~vthATPAa~yAH~~~R~we~d~~~~~~~~~~~~dIA~Qlv~~~~g~~~dVil---   82 (95)
                      +++.|| +|+||++||+||||||++||||||||||||+++|+||             .+||+||+++.+|+++||||   
T Consensus        96 ~~~~ti-~e~ak~~G~~tGiVtT~~ithATPAa~~AH~~~R~~~-------------~~Ia~q~~~~~~g~~~dv~~GGG  161 (384)
T cd00016          96 KPVTSV-LEWAKAAGKATGIVTTTRVTHATPAAFYAHVPDRNWE-------------EDIAEQLIEEAPGRGIDVLLGGG  161 (384)
T ss_pred             cchhhH-HHHHHHcCCCEEEEeeeecCCCcchhhhccccccCCH-------------HHHHHHHhhccCCCCCeEEEeCC
Confidence            789999 9999999999999999999999999999999999998             89999999998899999999   


Q ss_pred             --ecccCC
Q psy17926         83 --EFYPGK   88 (95)
Q Consensus        83 --~F~p~~   88 (95)
                        +|+|+.
T Consensus       162 ~~~f~~~~  169 (384)
T cd00016         162 RRYFLPST  169 (384)
T ss_pred             hhhccccC
Confidence              899964


No 5  
>PF00245 Alk_phosphatase:  Alkaline phosphatase;  InterPro: IPR001952 This entry represents alkaline phosphatases (3.1.3.1 from EC) (ALP), which act as non-specific phosphomonoesterases to hydrolyse phosphate esters, optimally at high pH. The reaction mechanism involves the attack of a serine alkoxide on a phosphorus of the substrate to form a transient covalent enzyme-phosphate complex, followed by the hydrolysis of the serine phosphate. Alkaline phosphatases are found in all kingdoms of life, with the exception of some plants. Alkaline phosphatases are metalloenzymes that exist as a dimer, each monomer binding metal ions. The metal ions they carry can differ, although zinc and magnesium are the most common. For example, Escherichia coli alkaline phosphatase (encoded by phoA) requires the presence of two zinc ions bound at the M1 and M2 metal sites, and one magnesium ion bound at the M3 site []. However, alkaline phosphatases from Thermotoga maritima and Bacillus subtilis require cobalt for maximal activity [].  In mammals, there are four alkaline phosphatase isozymes: placental, placental-like (germ cell), intestinal and tissue-nonspecific (liver/bone/kidney). All four isozymes are anchored to the outer surface of the plasma membrane by a covalently attached glycosylphosphatidylinositol (GPI) anchor []. Human alkaline phosphatases have four metal binding sites: two for zinc, one for magnesium, and one for calcium ion. Placental alkaline phosphatase (ALPP or PLAP) is highly polymorphic, with at least three common alleles []. Its activity is down-regulated by a number of effectors such as l-phenylalanine, 5'-AMP, and by p-nitrophenyl-phosphonate (PNPPate) []. The placental-like isozyme (ALPPL or PLAP-like) is elevated in germ cell tumours. The intestinal isozyme (ALPI or IAP) has the ability to detoxify lipopolysaccharide and prevent bacterial invasion across the gut mucosal barrier []. The tissue-nonspecific isozyme (ALPL) is, and may play a role in skeletal mineralisation. Defects in ALPL are a cause of hypophosphatasia, including infantile-type (OMIM:241500), childhood-type (OMIM:241510) and adult-type (OMIM:146300). Hhypophosphatasia is an inherited metabolic bone disease characterised by defective skeletal mineralisation []. This entry also contains the related enzyme streptomycin-6-phosphate phosphatase (3.1.3.39 from EC) (encoded by strK) from Streptomyces species. This enzyme is involved in the synthesis of the antibiotic streptomycin, specifically cleaving both streptomycin-6-phosphate and, more slowly, streptomycin-3-phosphate [].; GO: 0016791 phosphatase activity, 0008152 metabolic process; PDB: 1AJD_B 1ALH_B 2ANH_B 3BDF_A 1ELZ_B 1ELX_B 1B8J_B 2GA3_A 1ANJ_B 1Y6V_B ....
Probab=99.91  E-value=8.5e-26  Score=182.21  Aligned_cols=87  Identities=40%  Similarity=0.621  Sum_probs=66.3

Q ss_pred             CCCccccccHHHHHHHHcCCcEeEEeeccCCCCCcccceeccCCCCCccCCCCcccc-ccChHHHHHHHhhcCCCCCccE
Q psy17926          2 KLDLEKVRRVQTYVAYGTGKATGIVTNTRVTHATPAAFYGHSPSRYWEDDGKVPVIS-RKSCKDLARQLVEDYPGKDINS   80 (95)
Q Consensus         2 ~~d~~~~~ti~le~Ak~~Gk~tGiVTT~~vthATPAa~yAH~~~R~we~d~~~~~~~-~~~~~dIA~Qlv~~~~g~~~dV   80 (95)
                      +.|+++++|| +|+||++||+||||||++||||||||||||+.+|+||++-..+... ..+|.||++||++.+  +++||
T Consensus        80 ~~~~~~~~ti-~e~Ak~~G~~tGvVtT~~ithATPAaf~Ah~~~R~~~~~ia~~~~~~~~g~~di~~q~~~~~--~~~Dv  156 (421)
T PF00245_consen   80 DPDGKPLETI-LELAKEAGKATGVVTTTRITHATPAAFYAHVPDRNWYNDIAEPDEQQLAGCPDIAQQLLESG--KNVDV  156 (421)
T ss_dssp             ETTSCB---H-HHHHHHTT-EEEEEEEEETTSHHHHTTT--BSSTT-HHHHHHCTCHHCTTS--HHHHHHHCT--GG-SE
T ss_pred             CCCCCcchhH-HHHHHHhCCeeeeeecccccCCccceEEEecccccccchhhcchhhhhcCCcchHHHhhcCC--cccce
Confidence            3568999999 9999999999999999999999999999999999999865544433 468999999999984  46999


Q ss_pred             EE-----ecccCCCCC
Q psy17926         81 FD-----EFYPGKDIN   91 (95)
Q Consensus        81 il-----~F~p~~~~d   91 (95)
                      ||     +|+|+.+.|
T Consensus       157 ~lGGG~~~f~p~~~~~  172 (421)
T PF00245_consen  157 ILGGGRRYFLPKGEPD  172 (421)
T ss_dssp             EEEE-GGGGSBTTCSC
T ss_pred             EecCchhhccccCCCC
Confidence            99     899998765


No 6  
>COG1785 PhoA Alkaline phosphatase [Inorganic ion transport and metabolism]
Probab=99.86  E-value=2.6e-22  Score=164.77  Aligned_cols=71  Identities=38%  Similarity=0.521  Sum_probs=64.7

Q ss_pred             CccccccHHHHHHHHcCCcEeEEeeccCCCCCcccceeccCCCCCccCCCCccccccChHHHHHHHhhcC-CCC--CccE
Q psy17926          4 DLEKVRRVQTYVAYGTGKATGIVTNTRVTHATPAAFYGHSPSRYWEDDGKVPVISRKSCKDLARQLVEDY-PGK--DINS   80 (95)
Q Consensus         4 d~~~~~ti~le~Ak~~Gk~tGiVTT~~vthATPAa~yAH~~~R~we~d~~~~~~~~~~~~dIA~Qlv~~~-~g~--~~dV   80 (95)
                      ++++++|| ||.||++||+||||||+|||||||||||||+.+|+||             .+||+|++... .|+  ++||
T Consensus       139 ~~~~~~Ti-LE~Ak~~GkaTGlVtTtriThATPAAf~AHv~~R~~~-------------~~ia~~~~~~~~~~~~~~~DV  204 (482)
T COG1785         139 NGKPLKTI-LELAKEAGKATGLVTTTRITHATPAAFAAHVTSRDDE-------------DEIATQQICPGNAGRNDKVDV  204 (482)
T ss_pred             CCcccchH-HHHHHHhCcccceEEeeeccccChHHHHHhcccccch-------------hHHHHHhhccccccccCCCCE
Confidence            47899999 9999999999999999999999999999999999976             78999999874 345  5999


Q ss_pred             EE-----ecccCC
Q psy17926         81 FD-----EFYPGK   88 (95)
Q Consensus        81 il-----~F~p~~   88 (95)
                      +|     +|+|+.
T Consensus       205 llGGG~~~F~p~~  217 (482)
T COG1785         205 LLGGGRKYFLPKA  217 (482)
T ss_pred             EecCchhhccccc
Confidence            99     999995


No 7  
>PRK11587 putative phosphatase; Provisional
Probab=46.90  E-value=16  Score=26.06  Aligned_cols=23  Identities=22%  Similarity=0.059  Sum_probs=18.6

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRV   31 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~v   31 (95)
                      +..+ ++..+++|+.+||||+...
T Consensus        88 ~~e~-L~~L~~~g~~~~ivTn~~~  110 (218)
T PRK11587         88 AIAL-LNHLNKLGIPWAIVTSGSV  110 (218)
T ss_pred             HHHH-HHHHHHcCCcEEEEcCCCc
Confidence            4455 7889999999999998753


No 8  
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED. HAD subfamilies caused by an overly broad single model.
Probab=46.64  E-value=19  Score=24.24  Aligned_cols=25  Identities=24%  Similarity=0.298  Sum_probs=19.7

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccCCC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRVTH   33 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~vth   33 (95)
                      +..+ ++..+++|+.++|||++....
T Consensus        90 ~~~~-l~~l~~~g~~~~i~Tn~~~~~  114 (183)
T TIGR01509        90 VEPL-LEALRARGKKLALLTNSPRDH  114 (183)
T ss_pred             HHHH-HHHHHHCCCeEEEEeCCchHH
Confidence            4445 788889999999999987544


No 9  
>TIGR01149 mtrG N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit G. coenzyme M methyltransferase subunit G in methanogenic archaea. This methyltranfersae is membrane-associated enzyme complex that uses methyl-transfer reaction to drive sodium-ion pump. Archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase is involved in the transfer of 'methyl' group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of the methyl moiety in methyl-coenzyme M by another enzyme methyl-coenzyme M reductase.
Probab=45.87  E-value=3  Score=26.81  Aligned_cols=19  Identities=47%  Similarity=0.461  Sum_probs=14.8

Q ss_pred             cccccHHHHHHHHcCCcEe
Q psy17926          6 EKVRRVQTYVAYGTGKATG   24 (95)
Q Consensus         6 ~~~~ti~le~Ak~~Gk~tG   24 (95)
                      ++|+.+-.|.+|+.||++|
T Consensus        26 eKVEf~~~E~~Qr~Gkk~G   44 (70)
T TIGR01149        26 EKVEFVNGEVAQRIGKKVG   44 (70)
T ss_pred             HHHHHHHHHHHHHHhHHhh
Confidence            4566555899999999887


No 10 
>PRK06769 hypothetical protein; Validated
Probab=45.52  E-value=20  Score=25.23  Aligned_cols=22  Identities=9%  Similarity=-0.177  Sum_probs=18.2

Q ss_pred             cccHHHHHHHHcCCcEeEEeecc
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      +..+ ++..++.|...||||+..
T Consensus        33 v~e~-L~~Lk~~G~~l~I~Tn~~   54 (173)
T PRK06769         33 TKAS-LQKLKANHIKIFSFTNQP   54 (173)
T ss_pred             HHHH-HHHHHHCCCEEEEEECCc
Confidence            4445 788999999999999875


No 11 
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated
Probab=42.44  E-value=24  Score=24.56  Aligned_cols=21  Identities=14%  Similarity=-0.005  Sum_probs=17.6

Q ss_pred             ccHHHHHHHHcCCcEeEEeecc
Q psy17926          9 RRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         9 ~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      ..+ +++.+++|..+||+|+.+
T Consensus        35 ~e~-L~~Lk~~g~~l~I~Tn~~   55 (181)
T PRK08942         35 IEA-IARLKQAGYRVVVATNQS   55 (181)
T ss_pred             HHH-HHHHHHCCCEEEEEeCCc
Confidence            345 788999999999999875


No 12 
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II. Note that the Type I HAD enzymes have not yet been fully characterized, but clearly utilize a substantially different catalytic mechanism and are thus unlikely to be related.
Probab=42.23  E-value=24  Score=24.51  Aligned_cols=23  Identities=17%  Similarity=0.037  Sum_probs=18.5

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRV   31 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~v   31 (95)
                      +..+ ++.++++|+.+||+|++..
T Consensus        97 ~~~~-L~~L~~~g~~~~i~Sn~~~  119 (198)
T TIGR01428        97 VPAG-LRALKERGYRLAILSNGSP  119 (198)
T ss_pred             HHHH-HHHHHHCCCeEEEEeCCCH
Confidence            3445 7889999999999998764


No 13 
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase. The central phosphatase domain is a member of the IIIA subfamily (TIGR01662) of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. As is common in this superfamily, the enzyme is magnesium dependent. A difference between this enzyme and other HAD-superfamily phosphatases is in the third conserved catalytic motif which usually contains two conserved aspartate residues believed to be involved in binding the magnesium ion. Here, the second aspartate is usually replaced by an arginine residue which may indicate an interaction with the phosphate backbone of the substrate. Alternatively, there is an additional conserved aspartate downstream of the ususal site which may indicate slightly different fold in this region.
Probab=42.22  E-value=24  Score=24.89  Aligned_cols=22  Identities=18%  Similarity=0.024  Sum_probs=18.0

Q ss_pred             cccHHHHHHHHcCCcEeEEeecc
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      +..+ ++..+++|+..||||+.+
T Consensus        47 v~e~-L~~Lk~~G~~l~I~TN~~   68 (166)
T TIGR01664        47 IPAK-LQELDDEGYKIVIFTNQS   68 (166)
T ss_pred             HHHH-HHHHHHCCCEEEEEeCCc
Confidence            3455 888999999999999854


No 14 
>PRK01026 tetrahydromethanopterin S-methyltransferase subunit G; Provisional
Probab=42.19  E-value=3.8  Score=26.80  Aligned_cols=19  Identities=32%  Similarity=0.343  Sum_probs=14.6

Q ss_pred             cccccHHHHHHHHcCCcEe
Q psy17926          6 EKVRRVQTYVAYGTGKATG   24 (95)
Q Consensus         6 ~~~~ti~le~Ak~~Gk~tG   24 (95)
                      ++|+-.-.|.+|+.||++|
T Consensus        29 eKVEftn~Ei~Qr~GkkvG   47 (77)
T PRK01026         29 EKVEFTNAEIFQRIGKKVG   47 (77)
T ss_pred             HHHHHHHHHHHHHHhHHhh
Confidence            4555555899999999887


No 15 
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase. This family of proteins formerly designated yaeD resembles the histidinol phosphatase domain of the bifunctional protein HisB. The member from E. coli has been characterized as D,D-heptose 1,7-bisphosphate phosphatase, GmhB, involved in inner core LPS assembly (PubMed:11751812).
Probab=42.16  E-value=24  Score=24.51  Aligned_cols=22  Identities=27%  Similarity=0.084  Sum_probs=18.5

Q ss_pred             cccHHHHHHHHcCCcEeEEeecc
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      +..+ +++.+++|+..+|||+..
T Consensus        31 v~e~-L~~Lk~~G~~l~i~TN~~   52 (176)
T TIGR00213        31 VIDA-LRELKKMGYALVLVTNQS   52 (176)
T ss_pred             HHHH-HHHHHHCCCEEEEEeCCc
Confidence            4455 788999999999999886


No 16 
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253. This family is a member of the haloacid dehalogenase (HAD) superfamily of hydrolases which are characterized by three conserved sequence motifs. By virtue of an alpha helical domain in-between the first and second conserved motif, this family is a member of subfamily IA (TIGR01549).
Probab=40.71  E-value=26  Score=24.65  Aligned_cols=24  Identities=25%  Similarity=0.252  Sum_probs=19.3

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccCC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRVT   32 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~vt   32 (95)
                      +..+ ++..++.|+.+||||++.-.
T Consensus        99 ~~~~-L~~L~~~g~~~~i~Tn~~~~  122 (221)
T TIGR02253        99 VRDT-LMELRESGYRLGIITDGLPV  122 (221)
T ss_pred             HHHH-HHHHHHCCCEEEEEeCCchH
Confidence            4455 78889999999999998644


No 17 
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic. This enzyme is a member of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolase enzymes (pfam00702).
Probab=39.28  E-value=29  Score=24.15  Aligned_cols=23  Identities=26%  Similarity=0.241  Sum_probs=18.4

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRV   31 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~v   31 (95)
                      +..+ +++.+++|..++|||+..-
T Consensus        90 ~~~~-L~~l~~~g~~~~i~S~~~~  112 (213)
T TIGR01449        90 VEAT-LGALRAKGLRLGLVTNKPT  112 (213)
T ss_pred             HHHH-HHHHHHCCCeEEEEeCCCH
Confidence            3445 7889999999999998753


No 18 
>PF04210 MtrG:  Tetrahydromethanopterin S-methyltransferase, subunit G ;  InterPro: IPR005866  This model describes the N5-methyltetrahydromethanopterin: coenzyme M methyltransferase subunit G in methanogenic archaea. This methyltranferase is a membrane-associated enzyme complex that uses methyl-transfer reaction to drive a sodium-ion pump. Archaea have evolved energy-yielding pathways marked by one-carbon biochemistry featuring novel cofactors and enzymes. This transferase is involved in the transfer of a methyl group from N5-methyltetrahydromethanopterin to coenzyme M. In an accompanying reaction, methane is produced by two-electron reduction of the methyl moiety in methyl-coenzyme M by another enzyme methyl-coenzyme M reductase.; GO: 0030269 tetrahydromethanopterin S-methyltransferase activity, 0015948 methanogenesis, 0016021 integral to membrane
Probab=37.54  E-value=11  Score=24.28  Aligned_cols=19  Identities=37%  Similarity=0.436  Sum_probs=14.8

Q ss_pred             cccccHHHHHHHHcCCcEe
Q psy17926          6 EKVRRVQTYVAYGTGKATG   24 (95)
Q Consensus         6 ~~~~ti~le~Ak~~Gk~tG   24 (95)
                      ++++-+-.|.+|+.||++|
T Consensus        26 eKvEf~~~Ei~Qr~GkkiG   44 (70)
T PF04210_consen   26 EKVEFTNAEIAQRAGKKIG   44 (70)
T ss_pred             HHHHhHHHHHHHHHhHHhh
Confidence            4556555899999999887


No 19 
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC. No member of this subfamily is characterized with respect to function, however the MDP-1 protein is a characterized phosphatase. All of the characterized enzymes within subfamily III are phosphatases, and all of the active site residues characteristic of HAD-superfamily phosphatases are present in subfamily IIIC.
Probab=36.28  E-value=29  Score=23.16  Aligned_cols=20  Identities=10%  Similarity=0.013  Sum_probs=17.2

Q ss_pred             ccHHHHHHHHcCCcEeEEeec
Q psy17926          9 RRVQTYVAYGTGKATGIVTNT   29 (95)
Q Consensus         9 ~ti~le~Ak~~Gk~tGiVTT~   29 (95)
                      ..+ +++.+++|...+|+|+.
T Consensus        35 ~e~-L~~Lk~~g~~l~i~Sn~   54 (128)
T TIGR01681        35 RDK-LQTLKKNGFLLALASYN   54 (128)
T ss_pred             HHH-HHHHHHCCeEEEEEeCC
Confidence            344 78899999999999998


No 20 
>PRK09456 ?-D-glucose-1-phosphatase; Provisional
Probab=35.90  E-value=27  Score=24.58  Aligned_cols=24  Identities=17%  Similarity=0.116  Sum_probs=19.1

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccCC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRVT   32 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~vt   32 (95)
                      +..+ ++..+++|+.++|+|++.-.
T Consensus        89 ~~e~-L~~l~~~g~~~~i~Sn~~~~  112 (199)
T PRK09456         89 VIAI-MHKLREQGHRVVVLSNTNRL  112 (199)
T ss_pred             HHHH-HHHHHhCCCcEEEEcCCchh
Confidence            3445 78899999999999998643


No 21 
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E. HAD subfamilies caused by an overly broad single model.
Probab=34.94  E-value=34  Score=22.64  Aligned_cols=23  Identities=17%  Similarity=0.211  Sum_probs=18.6

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRV   31 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~v   31 (95)
                      +..+ ++..+++|..++|||+..-
T Consensus        69 ~~e~-l~~L~~~g~~~~i~T~~~~   91 (154)
T TIGR01549        69 AADL-LKRLKEAGIKLGIISNGSL   91 (154)
T ss_pred             HHHH-HHHHHHCcCeEEEEeCCch
Confidence            4555 7888889999999998873


No 22 
>TIGR03351 PhnX-like phosphonatase-like hydrolase. This clade of sequences are the closest homologs to the PhnX enzyme, phosphonoacetaldehyde (Pald) hydrolase (phosphonatase, TIGR01422). This phosphonatase-like enzyme and PhnX itself are members of the haloacid dehalogenase (HAD) superfamily (pfam00702) having a a number of distinctive features that set them apart from typical HAD enzymes. The typical HAD N-terminal motif DxDx(T/V) here is DxAGT and the usual conserved lysine prior to the C-terminal motif is instead an arginine. Also distinctive of phosphonatase, and particular to its bi-catalytic mechanism is a conserved lysine in the variable "cap" domain. This lysine forms a Schiff base with the aldehyde of phosphonoacetaldehyde, providing, through the resulting positive charge, a polarization of the C-P bond necesary for cleavage as well as a route to the initial product of cleavage, an ene-amine. The conservation of these elements in this phosphonatase-like enzyme suggests that the
Probab=34.32  E-value=36  Score=24.02  Aligned_cols=22  Identities=9%  Similarity=0.012  Sum_probs=17.8

Q ss_pred             ccHHHHHHHHcCCcEeEEeeccC
Q psy17926          9 RRVQTYVAYGTGKATGIVTNTRV   31 (95)
Q Consensus         9 ~ti~le~Ak~~Gk~tGiVTT~~v   31 (95)
                      ..+ +++.+++|...||||+..-
T Consensus        93 ~~~-L~~L~~~g~~~~ivT~~~~  114 (220)
T TIGR03351        93 EEA-FRSLRSSGIKVALTTGFDR  114 (220)
T ss_pred             HHH-HHHHHHCCCEEEEEeCCch
Confidence            344 7889999999999997764


No 23 
>PLN02770 haloacid dehalogenase-like hydrolase family protein
Probab=33.05  E-value=38  Score=24.93  Aligned_cols=22  Identities=18%  Similarity=0.143  Sum_probs=18.5

Q ss_pred             cccHHHHHHHHcCCcEeEEeecc
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      +..+ +++.+++|...||||+..
T Consensus       113 v~e~-L~~L~~~g~~l~I~Tn~~  134 (248)
T PLN02770        113 LYKL-KKWIEDRGLKRAAVTNAP  134 (248)
T ss_pred             HHHH-HHHHHHcCCeEEEEeCCC
Confidence            4455 788999999999999986


No 24 
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain. This domain is a member of the haloacid-dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. This superfamily is distinguished by the presence of three motifs: an N-terminal motif containing the nucleophilic aspartate, a central motif containing an conserved serine or threonine, and a C-terminal motif containing a conserved lysine (or arginine) and conserved aspartates. More specifically, the domian modelled here is a member of subfamily III of the HAD-superfamily by virtue of lacking a "capping" domain in either of the two common positions, between motifs 1 and 2, or between motifs 2 and 3.
Probab=32.88  E-value=42  Score=22.64  Aligned_cols=21  Identities=19%  Similarity=0.135  Sum_probs=17.8

Q ss_pred             ccHHHHHHHHcCCcEeEEeecc
Q psy17926          9 RRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         9 ~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      ..+ ++..+++|+.++|+|+..
T Consensus        33 ~~~-l~~Lk~~g~~~~I~Sn~~   53 (147)
T TIGR01656        33 VPA-LLTLRAAGYTVVVVTNQS   53 (147)
T ss_pred             HHH-HHHHHHCCCEEEEEeCCC
Confidence            345 789999999999999875


No 25 
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase. These appear to be members of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases by general homology and the conservation of all of the recognized catalytic motifs (although the first motif is unusual in the replacement of the more common aspartate with glycine...). The variable domain is found in between motifs 1 and 2, indicating membership in subfamily I and phylogeny and prediction of the alpha helical nature of the variable domain (by PSI-PRED) indicate membership in subfamily IA.
Probab=32.43  E-value=39  Score=23.73  Aligned_cols=22  Identities=18%  Similarity=0.039  Sum_probs=17.3

Q ss_pred             ccHHHHHHHHcCCcEeEEeeccC
Q psy17926          9 RRVQTYVAYGTGKATGIVTNTRV   31 (95)
Q Consensus         9 ~ti~le~Ak~~Gk~tGiVTT~~v   31 (95)
                      ..+ ++..+++|..+||+|+...
T Consensus       100 ~~~-L~~L~~~g~~l~i~Sn~~~  121 (211)
T TIGR02247       100 MAA-IKTLRAKGFKTACITNNFP  121 (211)
T ss_pred             HHH-HHHHHHCCCeEEEEeCCCC
Confidence            344 7788889999999998743


No 26 
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1. This model represents two closely related clades of sequences from eukaryotes and archaea. The mouse enzyme has been characterized as a phosphatase and has been positively identified as a member of the haloacid dehalogenase (HAD) superfamily by site-directed mutagenesis of the active site residues.
Probab=32.13  E-value=40  Score=24.36  Aligned_cols=21  Identities=19%  Similarity=0.117  Sum_probs=17.9

Q ss_pred             cccHHHHHHHHcCCcEeEEeec
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNT   29 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~   29 (95)
                      +..+ ++..+++|+.+||+|+.
T Consensus        50 v~el-L~~Lk~~G~~l~I~Sn~   70 (174)
T TIGR01685        50 VRDV-LQTLKDAGTYLATASWN   70 (174)
T ss_pred             HHHH-HHHHHHCCCEEEEEeCC
Confidence            4456 89999999999999977


No 27 
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase. A TIGRFAMs model (TIGR01993) represents a (putative) family of _pyrimidine_ 5'-nucleotidases which are also subfamily I HAD's, which should not be confused with the current model.
Probab=31.92  E-value=38  Score=27.31  Aligned_cols=25  Identities=20%  Similarity=0.090  Sum_probs=19.8

Q ss_pred             ccccHHHHHHHHcCCcEeEEeeccCC
Q psy17926          7 KVRRVQTYVAYGTGKATGIVTNTRVT   32 (95)
Q Consensus         7 ~~~ti~le~Ak~~Gk~tGiVTT~~vt   32 (95)
                      .+..+ |+..+++|+..+|||++.-.
T Consensus       188 gl~el-L~~Lr~~G~klfLvTNS~~~  212 (343)
T TIGR02244       188 KLPLF-LSKLKEHGKKLFLLTNSDYD  212 (343)
T ss_pred             hHHHH-HHHHHHCCCeEEEEeCCCHH
Confidence            44555 78899999999999987643


No 28 
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase. Most likely, these sequences, like the vast majority of HAD sequences, represent phosphatase enzymes.
Probab=31.77  E-value=43  Score=23.30  Aligned_cols=21  Identities=14%  Similarity=0.158  Sum_probs=16.9

Q ss_pred             ccHHHHHHHHcCCcEeEEeecc
Q psy17926          9 RRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         9 ~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      ..+ ++..+++|+.++|||+..
T Consensus       111 ~~~-l~~L~~~g~~~~i~Sn~~  131 (203)
T TIGR02252       111 IKL-LKDLRERGLILGVISNFD  131 (203)
T ss_pred             HHH-HHHHHHCCCEEEEEeCCc
Confidence            344 677888999999999864


No 29 
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA. In the case of histidinol phosphatase and PNK-3'-phosphatase, this model represents a domain of a bifunctional system. In the histidinol phosphatase HisB, a C-terminal domain is an imidazoleglycerol-phosphate dehydratase which catalyzes a related step in histidine biosynthesis. In PNK-3'-phosphatase, N- and C-terminal domains constitute the polynucleotide kinase and DNA-binding components of the enzyme.
Probab=31.37  E-value=49  Score=21.51  Aligned_cols=21  Identities=24%  Similarity=0.071  Sum_probs=17.8

Q ss_pred             ccHHHHHHHHcCCcEeEEeecc
Q psy17926          9 RRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         9 ~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      ..+ ++..+++|..++|+|+..
T Consensus        31 ~~~-l~~L~~~g~~l~i~Sn~~   51 (132)
T TIGR01662        31 PDA-LAELKEAGYKVVIVTNQS   51 (132)
T ss_pred             HHH-HHHHHHCCCEEEEEECCc
Confidence            345 788899999999999987


No 30 
>PRK13288 pyrophosphatase PpaX; Provisional
Probab=30.44  E-value=48  Score=23.38  Aligned_cols=23  Identities=26%  Similarity=0.153  Sum_probs=18.8

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRV   31 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~v   31 (95)
                      +..+ +++.+++|...||||+..-
T Consensus        87 ~~~~-l~~L~~~g~~~~i~S~~~~  109 (214)
T PRK13288         87 VYET-LKTLKKQGYKLGIVTTKMR  109 (214)
T ss_pred             HHHH-HHHHHHCCCeEEEEeCCCH
Confidence            3455 7889999999999999863


No 31 
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein. The most closely related enzyme below the noise cutoff is IndB which is involved in the biosynthesis of Indigoidine in Pectobacterium (Erwinia) chrysanthemi, a gamma proteobacter. This enzyme is similarly related to PGP. In this case, too it is unclear what role would be be played by a PGPase activity.
Probab=29.88  E-value=49  Score=23.16  Aligned_cols=24  Identities=21%  Similarity=0.126  Sum_probs=18.8

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccCC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRVT   32 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~vt   32 (95)
                      +..+ +++.+++|..++|+|+..-.
T Consensus        80 ~~~~-L~~L~~~g~~~~i~Sn~~~~  103 (205)
T TIGR01454        80 VPEL-LAELRADGVGTAIATGKSGP  103 (205)
T ss_pred             HHHH-HHHHHHCCCeEEEEeCCchH
Confidence            3445 78899999999999986533


No 32 
>TIGR01261 hisB_Nterm histidinol-phosphatase. This model describes histidinol phosphatase. All known examples in the scope of this model are bifunctional proteins with a histidinol phosphatase domain followed by an imidazoleglycerol-phosphate dehydratase domain. These enzymatic domains catalyze the ninth and seventh steps, respectively, of histidine biosynthesis.
Probab=29.72  E-value=49  Score=23.25  Aligned_cols=21  Identities=24%  Similarity=0.069  Sum_probs=17.6

Q ss_pred             cccHHHHHHHHcCCcEeEEeec
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNT   29 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~   29 (95)
                      +..+ ++..+++|+.++|||+.
T Consensus        34 v~e~-L~~L~~~g~~l~IvSN~   54 (161)
T TIGR01261        34 VIPA-LLKLKKAGYKFVMVTNQ   54 (161)
T ss_pred             HHHH-HHHHHHCCCeEEEEeCC
Confidence            4455 78899999999999996


No 33 
>COG0546 Gph Predicted phosphatases [General function prediction only]
Probab=29.65  E-value=49  Score=23.90  Aligned_cols=29  Identities=24%  Similarity=0.212  Sum_probs=21.3

Q ss_pred             ccccHHHHHHHHcCCcEeEEeeccCCCCCc
Q psy17926          7 KVRRVQTYVAYGTGKATGIVTNTRVTHATP   36 (95)
Q Consensus         7 ~~~ti~le~Ak~~Gk~tGiVTT~~vthATP   36 (95)
                      -+..+ |++.+++|...||||+.+-..+.+
T Consensus        93 gv~e~-L~~L~~~g~~l~i~T~k~~~~~~~  121 (220)
T COG0546          93 GVKEL-LAALKSAGYKLGIVTNKPERELDI  121 (220)
T ss_pred             CHHHH-HHHHHhCCCeEEEEeCCcHHHHHH
Confidence            34455 899999999999999865444433


No 34 
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional
Probab=29.14  E-value=46  Score=25.11  Aligned_cols=23  Identities=4%  Similarity=-0.036  Sum_probs=18.5

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRV   31 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~v   31 (95)
                      +..+ ++..+++|+.++|||+.+-
T Consensus       114 ~~e~-L~~L~~~g~~l~I~Tn~~~  136 (260)
T PLN03243        114 SREF-VQALKKHEIPIAVASTRPR  136 (260)
T ss_pred             HHHH-HHHHHHCCCEEEEEeCcCH
Confidence            3344 7888999999999999864


No 35 
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional
Probab=28.93  E-value=51  Score=23.40  Aligned_cols=24  Identities=17%  Similarity=0.308  Sum_probs=18.9

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccCC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRVT   32 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~vt   32 (95)
                      +..+ ++..+++|..++|||+..-.
T Consensus        97 ~~~~-l~~l~~~g~~~~i~S~~~~~  120 (222)
T PRK10826         97 VREA-LALCKAQGLKIGLASASPLH  120 (222)
T ss_pred             HHHH-HHHHHHCCCeEEEEeCCcHH
Confidence            4455 78889999999999996543


No 36 
>PRK14988 GMP/IMP nucleotidase; Provisional
Probab=28.88  E-value=51  Score=23.98  Aligned_cols=22  Identities=18%  Similarity=0.132  Sum_probs=18.1

Q ss_pred             cccHHHHHHHHcCCcEeEEeecc
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      +..+ ++..+++|+..||+|+..
T Consensus        98 ~~e~-L~~Lk~~g~~~~i~Tn~~  119 (224)
T PRK14988         98 TVPF-LEALKASGKRRILLTNAH  119 (224)
T ss_pred             HHHH-HHHHHhCCCeEEEEeCcC
Confidence            4455 788999999999999964


No 37 
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase. This enzyme is a member of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases (pfam00702), and contains a modified version of the conserved catalytic motifs of that superfamily: the first motif is usually DxDx(T/V), here it is DxAxT, and in the third motif the normal conserved lysine is instead an arginine. Additionally, the enzyme contains a unique conserved catalytic lysine (B. cereus pos. 53) which is involved in the binding and activation of the substrate through the formation of a Schiff base. The substrate of this enzyme is the product of 2-aminoethylphosphonate (AEP) transaminase, phosphonoacetaldehyde. This degradation pathway for AEP may be related to its toxic properties which are utilized by microorganisms as a chemical warfare agent.
Probab=28.34  E-value=45  Score=24.28  Aligned_cols=21  Identities=19%  Similarity=0.064  Sum_probs=17.2

Q ss_pred             ccHHHHHHHHcCCcEeEEeecc
Q psy17926          9 RRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         9 ~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      ..+ ++..+++|...||||+..
T Consensus       105 ~e~-L~~L~~~g~~l~IvT~~~  125 (253)
T TIGR01422       105 IEV-IAYLRARGIKIGSTTGYT  125 (253)
T ss_pred             HHH-HHHHHHCCCeEEEECCCc
Confidence            445 788889999999998765


No 38 
>PLN02811 hydrolase
Probab=28.21  E-value=52  Score=23.52  Aligned_cols=23  Identities=17%  Similarity=0.183  Sum_probs=18.1

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRV   31 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~v   31 (95)
                      +..+ ++..++.|...||||++.-
T Consensus        83 v~e~-l~~L~~~g~~~~i~S~~~~  105 (220)
T PLN02811         83 AERL-VRHLHAKGIPIAIATGSHK  105 (220)
T ss_pred             HHHH-HHHHHHCCCcEEEEeCCch
Confidence            3444 7888999999999997643


No 39 
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional
Probab=28.08  E-value=47  Score=24.55  Aligned_cols=22  Identities=23%  Similarity=0.134  Sum_probs=17.4

Q ss_pred             cccHHHHHHHHcCCcEeEEeecc
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      +..+ ++..+++|...||||+..
T Consensus       106 ~~el-L~~L~~~g~~l~I~T~~~  127 (267)
T PRK13478        106 VLEV-IAALRARGIKIGSTTGYT  127 (267)
T ss_pred             HHHH-HHHHHHCCCEEEEEcCCc
Confidence            3445 788999999999998653


No 40 
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated
Probab=28.07  E-value=48  Score=26.85  Aligned_cols=26  Identities=12%  Similarity=-0.024  Sum_probs=20.4

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccCCCC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRVTHA   34 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~vthA   34 (95)
                      +..+ +++.+++|+.+||||+++-..+
T Consensus       335 ~~e~-L~~Lk~~g~~l~IvS~~~~~~~  360 (459)
T PRK06698        335 VKEI-FTYIKENNCSIYIASNGLTEYL  360 (459)
T ss_pred             HHHH-HHHHHHCCCeEEEEeCCchHHH
Confidence            4556 8899999999999999755433


No 41 
>TIGR01990 bPGM beta-phosphoglucomutase. The enzyme from L. lactis has been extensively characterized including a remarkable crystal structure which traps the pentacoordinate transition state.
Probab=26.93  E-value=58  Score=21.99  Aligned_cols=20  Identities=0%  Similarity=-0.042  Sum_probs=16.4

Q ss_pred             ccHHHHHHHHcCCcEeEEeec
Q psy17926          9 RRVQTYVAYGTGKATGIVTNT   29 (95)
Q Consensus         9 ~ti~le~Ak~~Gk~tGiVTT~   29 (95)
                      ..+ +++.+++|+.+||+|+.
T Consensus        93 ~~~-L~~L~~~g~~~~i~s~~  112 (185)
T TIGR01990        93 KNL-LDDLKKNNIKIALASAS  112 (185)
T ss_pred             HHH-HHHHHHCCCeEEEEeCC
Confidence            344 78899999999999864


No 42 
>PLN02779 haloacid dehalogenase-like hydrolase family protein
Probab=26.30  E-value=56  Score=24.86  Aligned_cols=23  Identities=17%  Similarity=0.226  Sum_probs=18.0

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRV   31 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~v   31 (95)
                      +..+ ++..++.|+.+||||++..
T Consensus       149 v~el-L~~L~~~g~~l~IvTn~~~  171 (286)
T PLN02779        149 VLRL-MDEALAAGIKVAVCSTSNE  171 (286)
T ss_pred             HHHH-HHHHHHCCCeEEEEeCCCH
Confidence            3344 7788899999999999743


No 43 
>TIGR00338 serB phosphoserine phosphatase SerB. Phosphoserine phosphatase catalyzes the reaction 3-phospho-serine + H2O = L-serine + phosphate. It catalyzes the last of three steps in the biosynthesis of serine from D-3-phosphoglycerate. Note that this enzyme acts on free phosphoserine, not on phosphoserine residues of phosphoproteins.
Probab=26.11  E-value=57  Score=22.94  Aligned_cols=22  Identities=5%  Similarity=0.078  Sum_probs=17.8

Q ss_pred             cccHHHHHHHHcCCcEeEEeecc
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      +..+ ++..+++|..++|||.+.
T Consensus        90 ~~~~-l~~l~~~g~~~~IvS~~~  111 (219)
T TIGR00338        90 AEEL-VKTLKEKGYKVAVISGGF  111 (219)
T ss_pred             HHHH-HHHHHHCCCEEEEECCCc
Confidence            3445 788899999999999864


No 44 
>PRK13226 phosphoglycolate phosphatase; Provisional
Probab=25.80  E-value=58  Score=23.54  Aligned_cols=22  Identities=32%  Similarity=0.214  Sum_probs=18.3

Q ss_pred             cccHHHHHHHHcCCcEeEEeecc
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      +..+ +++.+++|+..||||+..
T Consensus       100 ~~~~-L~~L~~~g~~l~i~Tn~~  121 (229)
T PRK13226        100 VEGM-LQRLECAGCVWGIVTNKP  121 (229)
T ss_pred             HHHH-HHHHHHCCCeEEEECCCC
Confidence            3445 889999999999999975


No 45 
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459. This hypothetical equivalog is a member of the Class IIA subfamily of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases. The sequences modelled by this equivalog are all gram negative and primarily alpha proteobacteria. Only one sequence hase been annotated as other than "hypothetical." That one, from Brucella, is annotated as related to NagD, but only by sequence similarity and should be treated with some skepticism. (See comments for Class IIA subfamily)
Probab=24.65  E-value=67  Score=23.47  Aligned_cols=18  Identities=22%  Similarity=0.206  Sum_probs=15.7

Q ss_pred             HHHHHHcCCcEeEEeecc
Q psy17926         13 TYVAYGTGKATGIVTNTR   30 (95)
Q Consensus        13 le~Ak~~Gk~tGiVTT~~   30 (95)
                      +++.+++|+.++|||+..
T Consensus        33 L~~L~~~G~~~~ivTN~~   50 (242)
T TIGR01459        33 LNKIIAQGKPVYFVSNSP   50 (242)
T ss_pred             HHHHHHCCCEEEEEeCCC
Confidence            677888999999999964


No 46 
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain. DevT is a component in the C-signal response pathway in Myxococcus xanthus that stimulates the developmentally regulated expression of the FruA response regulator protein and is required for methylation of FrzCD during fruiting body formation.  DevT mutants having an in-frame deletion in the devT gene, display delayed aggregation and a cell autonomous sporulation defect.  DevT belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomy
Probab=24.44  E-value=1.1e+02  Score=23.39  Aligned_cols=49  Identities=18%  Similarity=0.294  Sum_probs=32.7

Q ss_pred             ccCCCCCcccceeccCC---CCCccCCCCccccccChHHHHHHHhhcCCCCCccEEE
Q psy17926         29 TRVTHATPAAFYGHSPS---RYWEDDGKVPVISRKSCKDLARQLVEDYPGKDINSFD   82 (95)
Q Consensus        29 ~~vthATPAa~yAH~~~---R~we~d~~~~~~~~~~~~dIA~Qlv~~~~g~~~dVil   82 (95)
                      .=|+|..|++.-....+   |+|...+     .-.||.|+++.+-.-..++.+++..
T Consensus       150 VliaH~~~~G~g~~~~~~cg~d~~~~~-----~~~G~~~l~~ai~~~~~~~~~~l~~  201 (238)
T cd07397         150 ILLAHNGPSGLGSDAEDPCGRDWKPPG-----GDWGDPDLALAISQIQQGRQVPLVV  201 (238)
T ss_pred             EEEeCcCCcCCCcccccccccccCCcC-----CCCCCHHHHHHHHHHhccCCCCEEE
Confidence            45789999988766665   7776321     1248999987775433556677764


No 47 
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal. This hypothetical equivalog is a member of the IB subfamily (TIGR01488) of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. The sequences modelled by this alignment are all from archaeal species. The phylogenetically closest group of sequences to these are phosphoserine phosphatases (TIGR00338). There are no known archaeal phosphoserine phosphatases, and no archaea fall within TIGR00338. It is likely, then, that This model represents the archaeal branch of the PSPase equivalog.
Probab=24.22  E-value=68  Score=21.90  Aligned_cols=22  Identities=18%  Similarity=0.111  Sum_probs=17.7

Q ss_pred             cccHHHHHHHHcCCcEeEEeecc
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      +..+ +++.+++|..++|||.+.
T Consensus        85 ~~e~-l~~l~~~g~~~~IvS~~~  106 (201)
T TIGR01491        85 AEEL-VRWLKEKGLKTAIVSGGI  106 (201)
T ss_pred             HHHH-HHHHHHCCCEEEEEeCCc
Confidence            3445 788999999999999764


No 48 
>PF14502 HTH_41:  Helix-turn-helix domain
Probab=24.06  E-value=30  Score=20.65  Aligned_cols=22  Identities=9%  Similarity=0.211  Sum_probs=17.8

Q ss_pred             ccccccHHHHHHHHcCCcEeEEe
Q psy17926          5 LEKVRRVQTYVAYGTGKATGIVT   27 (95)
Q Consensus         5 ~~~~~ti~le~Ak~~Gk~tGiVT   27 (95)
                      ++++.+| -|++++-+-+.|.|-
T Consensus         3 GdRi~tI-~e~~~~~~vs~GtiQ   24 (48)
T PF14502_consen    3 GDRIPTI-SEYSEKFGVSRGTIQ   24 (48)
T ss_pred             CcccCCH-HHHHHHhCcchhHHH
Confidence            5678888 799999888888763


No 49 
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548. All but the Halobacterium sequence currently found are annotated as "Imidazoleglycerol-phosphate dehydratase", however, the source of the annotation could not be traced and significant homology could not be found between any of these sequences and known IGPD's.
Probab=23.90  E-value=75  Score=22.16  Aligned_cols=23  Identities=13%  Similarity=0.047  Sum_probs=18.5

Q ss_pred             ccHHHHHHHHcCCcEeEEeeccCC
Q psy17926          9 RRVQTYVAYGTGKATGIVTNTRVT   32 (95)
Q Consensus         9 ~ti~le~Ak~~Gk~tGiVTT~~vt   32 (95)
                      ..+ ++..+++|...||+|+..-.
T Consensus       112 ~~~-L~~l~~~g~~~~i~T~~~~~  134 (197)
T TIGR01548       112 KGL-LRELHRAPKGMAVVTGRPRK  134 (197)
T ss_pred             HHH-HHHHHHcCCcEEEECCCCHH
Confidence            455 78889999999999988544


No 50 
>TIGR02335 hydr_PhnA phosphonoacetate hydrolase. This family consists of examples of phosphonoacetate hydrolase, an enzyme specific for the cleavage of the C-P bond in phosphonoacetate. Phosphonates are organic compounds with a direct C-P bond that is far less labile that the C-O-P bonds of phosphate attachment sites. Phosphonates may be degraded for phosphorus and energy by broad spectrum C-P lyase encoded by large operon or by specific enzymes for some of the more common phosphonates in nature. This family represents an enzyme from the latter category. It may be found encoded near genes for phosphonate transport and for pther specific phosphonatases.
Probab=23.65  E-value=73  Score=25.91  Aligned_cols=20  Identities=20%  Similarity=0.172  Sum_probs=18.0

Q ss_pred             ccccHHHHHHHHcCCcEeEEe
Q psy17926          7 KVRRVQTYVAYGTGKATGIVT   27 (95)
Q Consensus         7 ~~~ti~le~Ak~~Gk~tGiVT   27 (95)
                      +..+| .+.|+++|++|+.|+
T Consensus       101 ~~pTi-~e~a~~aG~~ta~v~  120 (408)
T TIGR02335       101 RAPTI-LGEMSKAGVLTAVVT  120 (408)
T ss_pred             CCchH-HHHHHHcCCeEEEEe
Confidence            56788 999999999999987


No 51 
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase. This enzyme is the enolase-phosphatase of methionine salvage, a pathway that regenerates methionine from methylthioadenosine (MTA). Adenosylmethionine (AdoMet) is a donor of different moieties for various processes, including methylation reactions. Use of AdoMet for spermidine biosynthesis, which leads to polyamine biosynthesis, leaves MTA as a by-product that must be cleared. In Bacillus subtilis and related species, this single protein is replaced by separate enzymes with enolase and phosphatase activities.
Probab=22.91  E-value=71  Score=23.76  Aligned_cols=22  Identities=9%  Similarity=-0.026  Sum_probs=17.7

Q ss_pred             ccHHHHHHHHcCCcEeEEeeccC
Q psy17926          9 RRVQTYVAYGTGKATGIVTNTRV   31 (95)
Q Consensus         9 ~ti~le~Ak~~Gk~tGiVTT~~v   31 (95)
                      ..+ ++..+++|+.+||+|+...
T Consensus       101 ~e~-L~~Lk~~G~~l~I~Sn~s~  122 (220)
T TIGR01691       101 PPA-LEAWLQLGLRLAVYSSGSV  122 (220)
T ss_pred             HHH-HHHHHHCCCEEEEEeCCCH
Confidence            344 6788889999999999853


No 52 
>PF13419 HAD_2:  Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A ....
Probab=22.86  E-value=79  Score=20.42  Aligned_cols=21  Identities=24%  Similarity=0.158  Sum_probs=16.9

Q ss_pred             ccHHHHHHHHcCCcEeEEeecc
Q psy17926          9 RRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         9 ~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      ..+ ++..++.|..+++||+..
T Consensus        83 ~~~-L~~l~~~~~~~~i~Sn~~  103 (176)
T PF13419_consen   83 REL-LERLKAKGIPLVIVSNGS  103 (176)
T ss_dssp             HHH-HHHHHHTTSEEEEEESSE
T ss_pred             hhh-hhhcccccceeEEeecCC
Confidence            344 677888999999999884


No 53 
>TIGR03172 probable selenium-dependent hydroxylase accessory protein YqeC. This uncharacterized protein family includes YqeC from Escherichia coli. A phylogenetic profiling analysis shows correlation with SelD, the selenium donor protein, even in species where SelD contributes to neither selenocysteine nor selenouridine biosynthesis. Instead, this family, and families TIGR03309 and TIGR03310 appear to mark selenium-dependent molybdenum hydroxylase maturation systems.
Probab=22.50  E-value=65  Score=24.52  Aligned_cols=23  Identities=17%  Similarity=0.029  Sum_probs=18.1

Q ss_pred             HHHHHHcCCcEeEEeeccCCCCC
Q psy17926         13 TYVAYGTGKATGIVTNTRVTHAT   35 (95)
Q Consensus        13 le~Ak~~Gk~tGiVTT~~vthAT   35 (95)
                      +...+.+|+++++-||+++--..
T Consensus        18 ~~~~~~~g~~v~~TTTT~m~~P~   40 (232)
T TIGR03172        18 AAEYRKEGYRVLVTTTTRMFLPE   40 (232)
T ss_pred             HHHHHHCCCeEEEECCccccCCC
Confidence            44556689999999999996543


No 54 
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase. All of these are members of the larger Haloacid dehalogenase (HAD) subfamily IA and include the "variant 3" glu-asp version of the third conserved HAD domain (TIGR01509).
Probab=22.34  E-value=80  Score=21.31  Aligned_cols=20  Identities=15%  Similarity=0.135  Sum_probs=16.5

Q ss_pred             ccHHHHHHHHcCCcEeEEeec
Q psy17926          9 RRVQTYVAYGTGKATGIVTNT   29 (95)
Q Consensus         9 ~ti~le~Ak~~Gk~tGiVTT~   29 (95)
                      ..+ +++.++.|..++|+|+.
T Consensus        94 ~~~-l~~l~~~g~~i~i~S~~  113 (185)
T TIGR02009        94 ENF-LKRLKKKGIAVGLGSSS  113 (185)
T ss_pred             HHH-HHHHHHcCCeEEEEeCc
Confidence            344 78888899999999976


No 55 
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668. This family consists of sequences from fungi, plants, cyanobacteria, gram-positive bacteria and Deinococcus. There is presently no characterization of any sequence in this family.
Probab=22.21  E-value=75  Score=22.16  Aligned_cols=18  Identities=22%  Similarity=0.158  Sum_probs=16.2

Q ss_pred             HHHHHHcCCcEeEEeecc
Q psy17926         13 TYVAYGTGKATGIVTNTR   30 (95)
Q Consensus        13 le~Ak~~Gk~tGiVTT~~   30 (95)
                      ++..++.|+.++|+|+..
T Consensus        52 L~~Lk~~g~~l~I~Sn~~   69 (170)
T TIGR01668        52 IEELKAAGRKLLIVSNNA   69 (170)
T ss_pred             HHHHHHcCCEEEEEeCCc
Confidence            788899999999999975


No 56 
>PLN02954 phosphoserine phosphatase
Probab=22.18  E-value=73  Score=22.47  Aligned_cols=25  Identities=8%  Similarity=0.016  Sum_probs=19.4

Q ss_pred             ccccHHHHHHHHcCCcEeEEeeccCC
Q psy17926          7 KVRRVQTYVAYGTGKATGIVTNTRVT   32 (95)
Q Consensus         7 ~~~ti~le~Ak~~Gk~tGiVTT~~vt   32 (95)
                      -+..+ +++.+++|..++|||...-.
T Consensus        88 g~~e~-l~~l~~~g~~~~IvS~~~~~  112 (224)
T PLN02954         88 GIPEL-VKKLRARGTDVYLVSGGFRQ  112 (224)
T ss_pred             cHHHH-HHHHHHCCCEEEEECCCcHH
Confidence            34455 78999999999999987533


No 57 
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed
Probab=22.07  E-value=73  Score=22.78  Aligned_cols=27  Identities=4%  Similarity=-0.141  Sum_probs=20.4

Q ss_pred             cccHHHHHHHHcCCcEeEEeeccCCCCC
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTRVTHAT   35 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~vthAT   35 (95)
                      +..+ ++++++.|..++|||+..-..+.
T Consensus        79 ~~e~-l~~l~~~g~~~~IvS~~~~~~i~  105 (219)
T PRK09552         79 FHEF-VQFVKENNIPFYVVSGGMDFFVY  105 (219)
T ss_pred             HHHH-HHHHHHcCCeEEEECCCcHHHHH
Confidence            3445 78999999999999988644333


No 58 
>PRK13225 phosphoglycolate phosphatase; Provisional
Probab=21.59  E-value=78  Score=24.09  Aligned_cols=22  Identities=14%  Similarity=0.140  Sum_probs=18.3

Q ss_pred             cccHHHHHHHHcCCcEeEEeecc
Q psy17926          8 VRRVQTYVAYGTGKATGIVTNTR   30 (95)
Q Consensus         8 ~~ti~le~Ak~~Gk~tGiVTT~~   30 (95)
                      +..+ +++.+++|...||||+.+
T Consensus       147 ~~e~-L~~L~~~gi~laIvSn~~  168 (273)
T PRK13225        147 VADL-LAQLRSRSLCLGILSSNS  168 (273)
T ss_pred             HHHH-HHHHHHCCCeEEEEeCCC
Confidence            4455 788999999999999876


No 59 
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family. The Methanosarcina sequence is distinctive in that it is linked to an N-terminal cytidylyltransferase domain (pfam02348) and is annotated as acylneuraminate cytidylyltransferase. This may give some clue as the function of these phosphatases. Several eukaryotic sequences scoring between trusted and noise are also closely related to this function such as the CMP-N-acetylneuraminic acid synthetase from mouse, but in these cases the phosphatase domain is clearly inactive as many of the active site residues are not conserved.
Probab=20.83  E-value=1e+02  Score=21.12  Aligned_cols=22  Identities=18%  Similarity=0.249  Sum_probs=18.2

Q ss_pred             HHHHHHcCCcEeEEeeccCCCC
Q psy17926         13 TYVAYGTGKATGIVTNTRVTHA   34 (95)
Q Consensus        13 le~Ak~~Gk~tGiVTT~~vthA   34 (95)
                      ++..+++|..++|||+..-..+
T Consensus        37 i~~Lk~~G~~i~IvTn~~~~~~   58 (154)
T TIGR01670        37 IRCALKSGIEVAIITGRKAKLV   58 (154)
T ss_pred             HHHHHHCCCEEEEEECCCCHHH
Confidence            6889999999999999765433


No 60 
>cd07372 2A5CPDO_B The beta subunit of the Class III extradiol dioxygenase, 2-amino-5-chlorophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol. 2-amino-5-chlorophenol 1,6-dioxygenase (2A5CPDO), catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol, which is an intermediate during p-chloronitrobenzene degradation. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. The active 2A5CPDO enzyme is probably a heterotetramer, composed of two alpha and two beta subunits. The alpha and beta subunits share significant sequence similarity and may have evolved by gene duplication. This model describes the beta subunit, which contains a putative metal binding site with two conserved histidines; these residues are equivalent to two out of three Fe(II) bindin
Probab=20.58  E-value=1.4e+02  Score=23.31  Aligned_cols=31  Identities=19%  Similarity=0.204  Sum_probs=24.9

Q ss_pred             HHHHHHcCCcEeEEeeccCCCC----Ccccceecc
Q psy17926         13 TYVAYGTGKATGIVTNTRVTHA----TPAAFYGHS   43 (95)
Q Consensus        13 le~Ak~~Gk~tGiVTT~~vthA----TPAa~yAH~   43 (95)
                      .+.+++.|+++.||-+..++|.    +|.+-+...
T Consensus       173 ~~al~~~~~RV~vIaSG~LSH~l~~~~~~~p~~~~  207 (294)
T cd07372         173 REAIRKTGRRAVLLASNTLSHWHFHEEPAPPEDMS  207 (294)
T ss_pred             HHHHHhcCCeEEEEEeCcccccCccCCCCCccccc
Confidence            4446778999999999999998    688777543


Done!