Diaphorina citri psyllid: psy17926

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MKLDLEKVRRVQTYVAYGTGKATGIVTNTRVTHATPAAFYGHSPSRYWEDDGKVPVISRKSCKDLARQLVEDYPGKDINSFDEFYPGKDINAHQH
ccccHHHHHcHHHHHHHHccccEEEEEEEcccccccHHHHcccccccccccccccccccccHHHHHHHHHHccccccccccEEECcccccccccc
********RRVQTYVAYGTGKATGIVTNTRVTHATPAAFYGHSPSRYWEDDGKVPVISRKSCKDLARQLVEDYPGKDINSFDEFYPG*D******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLDLEKVRRVQTYVAYGTGKATGIVTNTRVTHATPAAFYGHSPSRYWEDDGKVPVISRKSCKDLARQLVEDYPGKDINSFDEFYPGKDINAHQH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alkaline phosphatase, tissue-nonspecific isozyme confidentQ92058

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016787 [MF]hydrolase activityprobableGO:0003824, GO:0003674
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K7H, chain A
Confidence level:very confident
Coverage over the Query: 6-92
View the alignment between query and template
View the model in PyMOL