Diaphorina citri psyllid: psy1792


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MSSSRWNFNLYEIGTIPDIFQGTIPDIFQVFVLATILQQYRYYRRDLFPSDYHCLGDNENRPVKWLAIESLVHKTFSTASDVVSFTASLLNFLLGINSFTRELSAQDFLHCLRCDNENRPVKWLAIESLVHKTFSTASDVWAFGVLLWELTTLAQQPYAEIDPFEMAASLQDGYRLNQPVNCPDEL
cccccccccccccccccccccccccEEEEEccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHccccEEccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccccccccccc
*****WNFNLYEIGTIPDIFQGTIPDIFQVFVLATILQQYRYYRRDLFPSDYHCLGDNENRPVKWLAIESLVHKTFSTASDVVSFTASLLNFLLGINSFTRELSAQDFLHCLRCDNENRPVKWLAIESLVHKTFSTASDVWAFGVLLWELTTLAQQPYAEIDPFEMAASLQDGYRLNQPVN*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSRWNFNLYEIGTIPDIFQGTIPDIFQVFVLATILQQYRYYRRDLFPSDYHCLGDNENRPVKWLAIESLVHKTFSTASDVVSFTASLLNFLLGINSFTRELSAQDFLHCLRCDNENRPVKWLAIESLVHKTFSTASDVWAFGVLLWELTTLAQQPYAEIDPFEMAASLQDGYRLNQPVNCPDEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tyrosine-protein kinase RYK May be a coreceptor along with FZD8 of Wnt proteins, such as WNT1, WNT3, WNT3A and WNT5A. Involved in neuron differentiation, axon guidance, corpus callosum establishment and neurite outgrowth. In response to WNT3 stimulation, receptor C-terminal cleavage occurs in its transmembrane region and allows the C-terminal intracellular product to translocate from the cytoplasm to the nucleus where it plays a crucial role in neuronal development.confidentQ01887
Tyrosine-protein kinase RYK May be a coreceptor along with FZD8 of Wnt proteins, such as WNT1, WNT3, WNT3A and WNT5A. Involved in neuron differentiation, axon guidance, corpus callosum establishment and neurite outgrowth. In response to WNT3 stimulation, receptor C-terminal cleavage occurs in its transmembrane region and allows the C-terminal intracellular product to translocate from the cytoplasm to the nucleus where it plays a crucial role in neuronal development.confidentP34925
Tyrosine-protein kinase Dnt May play an essential role in neuronal pathway recognition and ventral muscle attachment site selection.confidentQ9V422

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0018108 [BP]peptidyl-tyrosine phosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0040012 [BP]regulation of locomotionprobableGO:0008150, GO:0065007, GO:0050789
GO:0007166 [BP]cell surface receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:0017147 [MF]Wnt-protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045860 [BP]positive regulation of protein kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0043410 [BP]positive regulation of MAPK cascadeprobableGO:0023051, GO:0010646, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0010627, GO:0050789, GO:0043408
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0051270 [BP]regulation of cellular component movementprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789, GO:0050794
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0031175 [BP]neuron projection developmentprobableGO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0000904 [BP]cell morphogenesis involved in differentiationprobableGO:0032502, GO:0048856, GO:0000902, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009987, GO:0009653, GO:0044699
GO:0019838 [MF]growth factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004714 [MF]transmembrane receptor protein tyrosine kinase activityprobableGO:0038023, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0016740, GO:0060089, GO:0004888, GO:0003674, GO:0004713, GO:0004871, GO:0004672, GO:0019199, GO:0004872
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AOJ, chain A
Confidence level:very confident
Coverage over the Query: 23-98,117-185
View the alignment between query and template
View the model in PyMOL