Query         psy17930
Match_columns 110
No_of_seqs    49 out of 51
Neff          2.6 
Searched_HMMs 46136
Date          Fri Aug 16 17:47:44 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17930.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17930hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1064|consensus               99.6 3.3E-17 7.2E-22  157.2   1.9   53    3-55    220-272 (2439)
  2 PF00400 WD40:  WD domain, G-be  94.3   0.038 8.3E-07   29.9   2.0   17   23-39     23-39  (39)
  3 smart00320 WD40 WD40 repeats.   91.9    0.16 3.4E-06   23.8   1.9   16   24-39     25-40  (40)
  4 KOG0272|consensus               83.1    0.61 1.3E-05   41.4   1.4   23   15-40    352-374 (459)
  5 cd01784 rasfadin_RA Ubiquitin-  74.3     1.8 3.8E-05   30.9   1.2   21   11-31      2-23  (87)
  6 KOG0283|consensus               71.4       2 4.4E-05   39.8   1.2   17   23-39    380-396 (712)
  7 KOG0278|consensus               71.1     2.7 5.9E-05   36.0   1.9   28   13-43    272-299 (334)
  8 KOG1408|consensus               70.3     2.9 6.2E-05   40.2   2.0   29   11-43    384-412 (1080)
  9 KOG0266|consensus               68.7     3.5 7.7E-05   34.2   2.0   27   11-40    249-275 (456)
 10 KOG0277|consensus               64.1     5.9 0.00013   33.8   2.5   27   21-48     71-97  (311)
 11 KOG0285|consensus               61.5     4.8  0.0001   35.8   1.6   17   24-40    248-264 (460)
 12 PF02870 Methyltransf_1N:  6-O-  60.3      11 0.00023   23.8   2.6   20   22-41     11-30  (77)
 13 KOG0283|consensus               59.5     5.5 0.00012   37.1   1.6   17   26-42    282-298 (712)
 14 KOG0645|consensus               58.0     6.9 0.00015   33.5   1.9   23   15-39    287-309 (312)
 15 KOG0315|consensus               56.3     6.5 0.00014   33.6   1.4   15   26-40     98-112 (311)
 16 KOG0646|consensus               53.3     9.6 0.00021   34.2   2.0   22   20-41    185-206 (476)
 17 KOG0263|consensus               52.7     7.4 0.00016   36.4   1.3   17   24-40    464-480 (707)
 18 KOG0309|consensus               52.0     7.8 0.00017   37.4   1.4   30    7-39    304-337 (1081)
 19 KOG0291|consensus               51.0     9.8 0.00021   36.4   1.8   17   23-39    404-420 (893)
 20 KOG2445|consensus               49.7      13 0.00029   32.3   2.3   25   23-47     73-97  (361)
 21 KOG0974|consensus               47.5      15 0.00033   35.5   2.5   34    5-38    210-243 (967)
 22 KOG0266|consensus               45.6      13 0.00028   31.0   1.6   16   24-39    301-316 (456)
 23 PTZ00421 coronin; Provisional   44.9      16 0.00034   31.6   2.0   16   24-39     89-104 (493)
 24 KOG0277|consensus               44.1      14 0.00031   31.6   1.7   19   21-39    158-176 (311)
 25 PTZ00420 coronin; Provisional   43.8      16 0.00035   32.5   2.0   17   23-39     87-103 (568)
 26 KOG0272|consensus               42.2      16 0.00036   32.7   1.8   24   15-40    394-417 (459)
 27 KOG2096|consensus               41.7      18 0.00039   32.0   1.9   16   25-40    100-115 (420)
 28 KOG0276|consensus               40.9      16 0.00036   34.5   1.6   18   25-42    241-258 (794)
 29 KOG0284|consensus               40.2      21 0.00046   32.0   2.1   26   24-49    193-218 (464)
 30 PTZ00421 coronin; Provisional   39.5      22 0.00047   30.7   2.1   16   24-39    139-154 (493)
 31 KOG4283|consensus               38.8      19  0.0004   31.7   1.6   16   25-40    203-218 (397)
 32 PF11319 DUF3121:  Protein of u  38.1      23  0.0005   26.8   1.8   18   23-40     86-103 (183)
 33 cd00200 WD40 WD40 domain, foun  37.8      22 0.00048   23.5   1.5   16   24-39    274-289 (289)
 34 KOG0271|consensus               37.7      18 0.00038   32.6   1.3   20   23-42    217-236 (480)
 35 KOG0284|consensus               37.1      20 0.00044   32.1   1.6   24   15-41    271-294 (464)
 36 COG3981 Predicted acetyltransf  36.7      24 0.00053   27.8   1.8   14   21-34    130-143 (174)
 37 KOG0649|consensus               35.6      20 0.00044   30.8   1.3   18   24-41    169-186 (325)
 38 PTZ00420 coronin; Provisional   34.5      29 0.00064   30.9   2.1   16   24-39    139-154 (568)
 39 KOG0313|consensus               34.4      25 0.00055   31.2   1.7   16   25-40    117-132 (423)
 40 KOG0302|consensus               34.1      27 0.00058   31.2   1.8   36    5-48    260-295 (440)
 41 KOG0645|consensus               33.7      36 0.00077   29.3   2.4   19   24-42    163-181 (312)
 42 PF11715 Nup160:  Nucleoporin N  33.7      29 0.00063   29.1   1.9   17   23-39    230-246 (547)
 43 KOG1188|consensus               33.6      27  0.0006   30.6   1.8   28   22-49     83-110 (376)
 44 KOG1034|consensus               32.0      30 0.00066   30.4   1.8   17   24-40    149-165 (385)
 45 KOG0643|consensus               31.7      26 0.00057   30.2   1.3   17   23-39     64-80  (327)
 46 PLN00181 protein SPA1-RELATED;  31.7      32 0.00069   30.4   1.9   16   24-39    589-604 (793)
 47 KOG0285|consensus               31.4      32 0.00069   30.8   1.8   16   25-40    291-306 (460)
 48 KOG0772|consensus               31.2      28 0.00061   32.3   1.5   16   24-39    282-297 (641)
 49 PF03581 Herpes_UL33:  Herpesvi  30.8      13 0.00029   25.6  -0.4   13   36-48      1-13  (75)
 50 KOG0303|consensus               30.5      42 0.00091   30.2   2.4   68   24-96     95-170 (472)
 51 PF14783 BBS2_Mid:  Ciliary BBS  29.2      43 0.00094   24.4   2.0   18   24-41     16-33  (111)
 52 PF03106 WRKY:  WRKY DNA -bindi  28.8      18 0.00038   23.4  -0.1   16    5-20      2-17  (60)
 53 KOG0273|consensus               28.5      35 0.00076   31.1   1.6   22   15-39    366-387 (524)
 54 smart00774 WRKY DNA binding do  28.2      29 0.00062   22.8   0.8   18    5-22      2-19  (59)
 55 cd06409 PB1_MUG70 The MUG70 pr  27.4      76  0.0016   22.1   2.8   26   75-100    28-62  (86)
 56 KOG0296|consensus               27.4      31 0.00068   30.5   1.1   18   24-41    339-356 (399)
 57 KOG1188|consensus               27.3      52  0.0011   28.9   2.4   18   23-40    328-345 (376)
 58 KOG0263|consensus               27.1      38 0.00083   31.8   1.7   24   23-46    631-654 (707)
 59 PHA00442 host recBCD nuclease   27.0      38 0.00083   22.9   1.2   19   68-86     25-43  (59)
 60 PHA03229 DNA packaging protein  26.5      31 0.00068   26.3   0.8   15   33-47     43-57  (132)
 61 PHA03236 DNA packaging protein  26.3      32  0.0007   26.0   0.9   16   31-46     35-50  (127)
 62 KOG0301|consensus               26.3      43 0.00094   31.7   1.9   25   25-49    233-263 (745)
 63 COG2319 FOG: WD40 repeat [Gene  26.3      54  0.0012   22.4   1.9   24   15-41    248-271 (466)
 64 PF01321 Creatinase_N:  Creatin  26.2      62  0.0014   20.9   2.1   21   72-92      3-23  (132)
 65 KOG0313|consensus               26.0      49  0.0011   29.5   2.1   17   24-40    359-375 (423)
 66 KOG1009|consensus               25.6      44 0.00096   29.8   1.7   17   23-39    135-151 (434)
 67 KOG0316|consensus               25.1      43 0.00092   28.7   1.5   22   15-39     24-45  (307)
 68 KOG0273|consensus               24.7      23  0.0005   32.2  -0.2   19   23-41    247-265 (524)
 69 KOG0319|consensus               24.6      49  0.0011   31.5   1.9   20   21-40    374-394 (775)
 70 KOG0308|consensus               24.4 1.1E+02  0.0024   29.1   4.1   61   21-100    35-95  (735)
 71 KOG0306|consensus               23.3      54  0.0012   31.6   1.9   16   24-39    162-177 (888)
 72 KOG4328|consensus               23.2   1E+02  0.0022   28.1   3.5   60   26-94    384-455 (498)
 73 KOG0303|consensus               22.9      32 0.00069   31.0   0.4   18   22-39    143-160 (472)
 74 KOG0296|consensus               21.8      68  0.0015   28.5   2.1   25   12-39    194-218 (399)
 75 KOG0315|consensus               21.7      54  0.0012   28.2   1.5   26   25-50     12-44  (311)
 76 KOG1517|consensus               21.4      50  0.0011   33.2   1.3   20   24-43   1124-1143(1387)
 77 PF02579 Nitro_FeMo-Co:  Dinitr  21.3      88  0.0019   19.6   2.1   22   72-93     64-85  (94)
 78 PLN00181 protein SPA1-RELATED;  21.2      67  0.0015   28.4   2.0   17   23-39    545-561 (793)
 79 KOG0271|consensus               20.9      56  0.0012   29.5   1.4   15   25-39    129-143 (480)
 80 TIGR03360 VI_minor_1 type VI s  20.8      64  0.0014   25.5   1.6   15   24-38     82-96  (185)
 81 PF08832 SRC-1:  Steroid recept  20.1      62  0.0013   22.8   1.2   16   67-82     51-66  (78)

No 1  
>KOG1064|consensus
Probab=99.65  E-value=3.3e-17  Score=157.24  Aligned_cols=53  Identities=45%  Similarity=0.721  Sum_probs=48.7

Q ss_pred             cCCCCccCCcccccccccccceeeeeeeeCceeeEEeeecCCCCCcccccccC
Q psy17930          3 KADGGGQGPSRSVKTLEGSVSNMLVTSCRDNICRLWVETVLPDDGLINMSQFD   55 (110)
Q Consensus         3 ~~~~g~~wrktsrYMprg~V~NVLLT~C~DniCRiW~ET~lPeDsLL~~s~~~   55 (110)
                      ++--||+||||++|||||+|||||+|||+||+||||+||.+|+|+++++..+.
T Consensus       220 ~~Vs~~~WRktskymp~gsv~nvL~T~C~D~v~RIW~et~~p~~~l~~~~~~~  272 (2439)
T KOG1064|consen  220 RRVSGFQWRKTSKYMPRGSVSNVLMTCCLDNVCRIWCETDLPKDCLVMLTGFD  272 (2439)
T ss_pred             cccccceeccccccCCccchhhhHHhhhccCceEEEEEeccCCCeEeeecccc
Confidence            34569999999999999999999999999999999999999999999766654


No 2  
>PF00400 WD40:  WD domain, G-beta repeat;  InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide. WD40 repeats usually assume a 7-8 bladed beta-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised beta-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in a variety of functions ranging from signal transduction and transcription regulation to cell cycle control and apoptosis. Repeated WD40 motifs act as a site for protein-protein interaction, and proteins containing WD40 repeats are known to serve as platforms for the assembly of protein complexes or mediators of transient interplay among other proteins. The specificity of the proteins is determined by the sequences outside the repeats themselves. Examples of such complexes are G proteins (beta subunit is a beta-propeller), TAFII transcription factor, and E3 ubiquitin ligase [, ]. In Arabidopsis spp., several WD40-containing proteins act as key regulators of plant-specific developmental events.; PDB: 2ZKQ_a 3CFV_B 3CFS_B 1PEV_A 1NR0_A 1VYH_T 3RFH_A 3O2Z_T 3FRX_C 3U5G_g ....
Probab=94.30  E-value=0.038  Score=29.92  Aligned_cols=17  Identities=29%  Similarity=0.646  Sum_probs=15.5

Q ss_pred             ceeeeeeeeCceeeEEe
Q psy17930         23 SNMLVTSCRDNICRLWV   39 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~   39 (110)
                      .+.|+|+|.|+.+|||.
T Consensus        23 ~~~~~s~~~D~~i~vwd   39 (39)
T PF00400_consen   23 GNFLASGSSDGTIRVWD   39 (39)
T ss_dssp             SSEEEEEETTSEEEEEE
T ss_pred             cccceeeCCCCEEEEEC
Confidence            57889999999999994


No 3  
>smart00320 WD40 WD40 repeats. Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.
Probab=91.86  E-value=0.16  Score=23.75  Aligned_cols=16  Identities=25%  Similarity=0.594  Sum_probs=14.3

Q ss_pred             eeeeeeeeCceeeEEe
Q psy17930         24 NMLVTSCRDNICRLWV   39 (110)
Q Consensus        24 NVLLT~C~DniCRiW~   39 (110)
                      +.+++++.|+.+|+|.
T Consensus        25 ~~~~~~~~d~~~~~~~   40 (40)
T smart00320       25 KYLASASDDGTIKLWD   40 (40)
T ss_pred             CEEEEecCCCeEEEcC
Confidence            6789999999999994


No 4  
>KOG0272|consensus
Probab=83.14  E-value=0.61  Score=41.36  Aligned_cols=23  Identities=26%  Similarity=0.476  Sum_probs=18.9

Q ss_pred             ccccccccceeeeeeeeCceeeEEee
Q psy17930         15 VKTLEGSVSNMLVTSCRDNICRLWVE   40 (110)
Q Consensus        15 rYMprg~V~NVLLT~C~DniCRiW~E   40 (110)
                      -|+|.|.--   .||+.||+||||-=
T Consensus       352 ~fsPNGy~l---ATgs~Dnt~kVWDL  374 (459)
T KOG0272|consen  352 AFSPNGYHL---ATGSSDNTCKVWDL  374 (459)
T ss_pred             eECCCceEE---eecCCCCcEEEeee
Confidence            467888754   89999999999963


No 5  
>cd01784 rasfadin_RA Ubiquitin-like domain of Rasfadin. rasfadin_RA  Rasfadin (RASSF2) belongs to a family of Ras effectors/tumor suppressors that includes RASSF1 and NORE1.  RASSF2 binds directly to K-Ras in a GTP-dependent manner via its RA (RAS-associated) domain. RASSF2 promotes apoptosis and cell cycle arrest and is frequently down-regulated in lung tumor cell lines
Probab=74.29  E-value=1.8  Score=30.89  Aligned_cols=21  Identities=38%  Similarity=0.347  Sum_probs=19.2

Q ss_pred             Ccccccccc-cccceeeeeeee
Q psy17930         11 PSRSVKTLE-GSVSNMLVTSCR   31 (110)
Q Consensus        11 rktsrYMpr-g~V~NVLLT~C~   31 (110)
                      ++||-|+|. |+|.||=++|++
T Consensus         2 ~~TS~f~P~~gs~~~v~VsS~~   23 (87)
T cd01784           2 HKTSVFTPAYGSVTNVRINSTM   23 (87)
T ss_pred             CcccEeCCCCCceeEEEEecCC
Confidence            589999999 999999999875


No 6  
>KOG0283|consensus
Probab=71.35  E-value=2  Score=39.84  Aligned_cols=17  Identities=41%  Similarity=0.784  Sum_probs=15.4

Q ss_pred             ceeeeeeeeCceeeEEe
Q psy17930         23 SNMLVTSCRDNICRLWV   39 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~   39 (110)
                      -|-||++++|.++|||-
T Consensus       380 n~fLLSSSMDKTVRLWh  396 (712)
T KOG0283|consen  380 NNFLLSSSMDKTVRLWH  396 (712)
T ss_pred             CCeeEeccccccEEeec
Confidence            37899999999999995


No 7  
>KOG0278|consensus
Probab=71.11  E-value=2.7  Score=35.98  Aligned_cols=28  Identities=21%  Similarity=0.283  Sum_probs=24.1

Q ss_pred             ccccccccccceeeeeeeeCceeeEEeeecC
Q psy17930         13 RSVKTLEGSVSNMLVTSCRDNICRLWVETVL   43 (110)
Q Consensus        13 tsrYMprg~V~NVLLT~C~DniCRiW~ET~l   43 (110)
                      -=||-|.|-++   .++++|++.|||.-++-
T Consensus       272 cVrFSPdGE~y---AsGSEDGTirlWQt~~~  299 (334)
T KOG0278|consen  272 CVRFSPDGELY---ASGSEDGTIRLWQTTPG  299 (334)
T ss_pred             EEEECCCCcee---eccCCCceEEEEEecCC
Confidence            34789999999   89999999999987754


No 8  
>KOG1408|consensus
Probab=70.33  E-value=2.9  Score=40.17  Aligned_cols=29  Identities=21%  Similarity=0.310  Sum_probs=23.6

Q ss_pred             CcccccccccccceeeeeeeeCceeeEEeeecC
Q psy17930         11 PSRSVKTLEGSVSNMLVTSCRDNICRLWVETVL   43 (110)
Q Consensus        11 rktsrYMprg~V~NVLLT~C~DniCRiW~ET~l   43 (110)
                      +.++--+|++|    .+||+.|++.|+|-=-+-
T Consensus       384 ~~~~aclp~~c----F~TCSsD~TIRlW~l~~c  412 (1080)
T KOG1408|consen  384 SPTAACLPRGC----FTTCSSDGTIRLWDLAFC  412 (1080)
T ss_pred             CcccccCCccc----eeEecCCCcEEEeecccc
Confidence            45677789998    589999999999975543


No 9  
>KOG0266|consensus
Probab=68.67  E-value=3.5  Score=34.24  Aligned_cols=27  Identities=26%  Similarity=0.506  Sum_probs=20.5

Q ss_pred             CcccccccccccceeeeeeeeCceeeEEee
Q psy17930         11 PSRSVKTLEGSVSNMLVTSCRDNICRLWVE   40 (110)
Q Consensus        11 rktsrYMprg~V~NVLLT~C~DniCRiW~E   40 (110)
                      ...--|-|.+   |.+++++.|++||||.=
T Consensus       249 v~~~~f~p~g---~~i~Sgs~D~tvriWd~  275 (456)
T KOG0266|consen  249 VTSVAFSPDG---NLLVSGSDDGTVRIWDV  275 (456)
T ss_pred             eEEEEecCCC---CEEEEecCCCcEEEEec
Confidence            3444555665   78899999999999963


No 10 
>KOG0277|consensus
Probab=64.13  E-value=5.9  Score=33.83  Aligned_cols=27  Identities=19%  Similarity=0.373  Sum_probs=21.1

Q ss_pred             ccceeeeeeeeCceeeEEeeecCCCCCc
Q psy17930         21 SVSNMLVTSCRDNICRLWVETVLPDDGL   48 (110)
Q Consensus        21 ~V~NVLLT~C~DniCRiW~ET~lPeDsL   48 (110)
                      +-.|++++||.|+..|||. +..|+--|
T Consensus        71 ~~e~~~~~a~GDGSLrl~d-~~~~s~Pi   97 (311)
T KOG0277|consen   71 NHENQVIAASGDGSLRLFD-LTMPSKPI   97 (311)
T ss_pred             CCcceEEEEecCceEEEec-cCCCCcch
Confidence            4468999999999999999 44555443


No 11 
>KOG0285|consensus
Probab=61.45  E-value=4.8  Score=35.81  Aligned_cols=17  Identities=41%  Similarity=0.702  Sum_probs=15.2

Q ss_pred             eeeeeeeeCceeeEEee
Q psy17930         24 NMLVTSCRDNICRLWVE   40 (110)
Q Consensus        24 NVLLT~C~DniCRiW~E   40 (110)
                      -||+|+..|.+||+|-=
T Consensus       248 dvl~t~grDst~RvWDi  264 (460)
T KOG0285|consen  248 DVLVTGGRDSTIRVWDI  264 (460)
T ss_pred             eeEEecCCcceEEEeee
Confidence            58999999999999953


No 12 
>PF02870 Methyltransf_1N:  6-O-methylguanine DNA methyltransferase, ribonuclease-like domain;  InterPro: IPR008332 Synonym(s): 6-O-methylguanine-DNA methyltransferase, O-6-methylguanine-DNA-alkyltransferase The repair of DNA containing O6-alkylated guanine is carried out by DNA-[protein]-cysteine S-methyltransferase (2.1.1.63 from EC). The major mutagenic and carcinogenic effect of methylating agents in DNA is the formation of O6-alkylguanine. The alkyl group at the O-6 position is transferred to a cysteine residue in the enzyme []. This is a suicide reaction since the enzyme is irreversibly inactivated and the methylated protein accumulates as a dead-end product. Most, but not all of the methyltransferases are also able to repair O-4-methylthymine. DNA-[protein]-cysteine S-methyltransferases are widely distributed and are found in various prokaryotic and eukaryotic sources []. This group of proteins are characterised by having an N-terminal ribonuclease-like domain associated with 6-O-methylguanine DNA methyltransferase activity (IPR001497 from INTERPRO).; GO: 0003908 methylated-DNA-[protein]-cysteine S-methyltransferase activity, 0006281 DNA repair; PDB: 1SFE_A 1T39_B 1T38_A 1EH7_A 1EH6_A 1YFH_C 1EH8_A 1QNT_A.
Probab=60.29  E-value=11  Score=23.81  Aligned_cols=20  Identities=15%  Similarity=0.461  Sum_probs=18.1

Q ss_pred             cceeeeeeeeCceeeEEeee
Q psy17930         22 VSNMLVTSCRDNICRLWVET   41 (110)
Q Consensus        22 V~NVLLT~C~DniCRiW~ET   41 (110)
                      |-+++|.++++++|.||.+-
T Consensus        11 lG~l~l~a~e~gL~~i~f~~   30 (77)
T PF02870_consen   11 LGPLLLAASEKGLCGIDFED   30 (77)
T ss_dssp             TEEEEEEEETTCEEEEEEEC
T ss_pred             CeEEEEEEECCeEEEEEECC
Confidence            66788999999999999986


No 13 
>KOG0283|consensus
Probab=59.55  E-value=5.5  Score=37.13  Aligned_cols=17  Identities=24%  Similarity=0.526  Sum_probs=14.7

Q ss_pred             eeeeeeCceeeEEeeec
Q psy17930         26 LVTSCRDNICRLWVETV   42 (110)
Q Consensus        26 LLT~C~DniCRiW~ET~   42 (110)
                      |.|+|+|++.|||+=.-
T Consensus       282 LAsaGeD~virVWkVie  298 (712)
T KOG0283|consen  282 LASAGEDGVIRVWKVIE  298 (712)
T ss_pred             eeecCCCceEEEEEEec
Confidence            48999999999998663


No 14 
>KOG0645|consensus
Probab=58.02  E-value=6.9  Score=33.47  Aligned_cols=23  Identities=30%  Similarity=0.413  Sum_probs=19.6

Q ss_pred             ccccccccceeeeeeeeCceeeEEe
Q psy17930         15 VKTLEGSVSNMLVTSCRDNICRLWV   39 (110)
Q Consensus        15 rYMprg~V~NVLLT~C~DniCRiW~   39 (110)
                      .|-|  -+.|-|+++.-|++||+|.
T Consensus       287 ~w~p--~~~~~L~s~~DDG~v~~W~  309 (312)
T KOG0645|consen  287 QWNP--KVSNRLASGGDDGIVNFWE  309 (312)
T ss_pred             EEcC--CCCCceeecCCCceEEEEE
Confidence            4566  4689999999999999996


No 15 
>KOG0315|consensus
Probab=56.30  E-value=6.5  Score=33.56  Aligned_cols=15  Identities=20%  Similarity=0.525  Sum_probs=13.4

Q ss_pred             eeeeeeCceeeEEee
Q psy17930         26 LVTSCRDNICRLWVE   40 (110)
Q Consensus        26 LLT~C~DniCRiW~E   40 (110)
                      +.|+++|++||||-=
T Consensus        98 MyTgseDgt~kIWdl  112 (311)
T KOG0315|consen   98 MYTGSEDGTVKIWDL  112 (311)
T ss_pred             EEecCCCceEEEEec
Confidence            689999999999963


No 16 
>KOG0646|consensus
Probab=53.26  E-value=9.6  Score=34.23  Aligned_cols=22  Identities=27%  Similarity=0.499  Sum_probs=17.9

Q ss_pred             cccceeeeeeeeCceeeEEeee
Q psy17930         20 GSVSNMLVTSCRDNICRLWVET   41 (110)
Q Consensus        20 g~V~NVLLT~C~DniCRiW~ET   41 (110)
                      |-+-..|+|+++|++||+|-=+
T Consensus       185 Gg~~~rl~TaS~D~t~k~wdlS  206 (476)
T KOG0646|consen  185 GGTNARLYTASEDRTIKLWDLS  206 (476)
T ss_pred             CCccceEEEecCCceEEEEEec
Confidence            3356689999999999999653


No 17 
>KOG0263|consensus
Probab=52.66  E-value=7.4  Score=36.35  Aligned_cols=17  Identities=29%  Similarity=0.642  Sum_probs=15.0

Q ss_pred             eeeeeeeeCceeeEEee
Q psy17930         24 NMLVTSCRDNICRLWVE   40 (110)
Q Consensus        24 NVLLT~C~DniCRiW~E   40 (110)
                      +-||+|++|.+.|||.=
T Consensus       464 rfLlScSED~svRLWsl  480 (707)
T KOG0263|consen  464 RFLLSCSEDSSVRLWSL  480 (707)
T ss_pred             cceeeccCCcceeeeec
Confidence            56899999999999963


No 18 
>KOG0309|consensus
Probab=51.99  E-value=7.8  Score=37.44  Aligned_cols=30  Identities=27%  Similarity=0.221  Sum_probs=22.5

Q ss_pred             CccCCcccc----cccccccceeeeeeeeCceeeEEe
Q psy17930          7 GGQGPSRSV----KTLEGSVSNMLVTSCRDNICRLWV   39 (110)
Q Consensus         7 g~~wrktsr----YMprg~V~NVLLT~C~DniCRiW~   39 (110)
                      .|.||+...    |=.|. .  -|+||++|...|+|-
T Consensus       304 eFlWR~r~e~~~d~d~rd-f--QLVTWSkD~~lrlWp  337 (1081)
T KOG0309|consen  304 EFLWRKRKECDGDYDSRD-F--QLVTWSKDQTLRLWP  337 (1081)
T ss_pred             HHhhhhcccccCCCCccc-e--eEEEeecCCceEeee
Confidence            478998765    43433 2  389999999999995


No 19 
>KOG0291|consensus
Probab=50.98  E-value=9.8  Score=36.40  Aligned_cols=17  Identities=35%  Similarity=0.638  Sum_probs=15.3

Q ss_pred             ceeeeeeeeCceeeEEe
Q psy17930         23 SNMLVTSCRDNICRLWV   39 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~   39 (110)
                      .||||++|.|+++|.|-
T Consensus       404 g~~llssSLDGtVRAwD  420 (893)
T KOG0291|consen  404 GNVLLSSSLDGTVRAWD  420 (893)
T ss_pred             CCEEEEeecCCeEEeee
Confidence            47889999999999994


No 20 
>KOG2445|consensus
Probab=49.70  E-value=13  Score=32.33  Aligned_cols=25  Identities=16%  Similarity=0.411  Sum_probs=19.4

Q ss_pred             ceeeeeeeeCceeeEEeeecCCCCC
Q psy17930         23 SNMLVTSCRDNICRLWVETVLPDDG   47 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~ET~lPeDs   47 (110)
                      --|+.|||.|.+.+||-|-..-+++
T Consensus        73 GqvvA~cS~Drtv~iWEE~~~~~~~   97 (361)
T KOG2445|consen   73 GQVVATCSYDRTVSIWEEQEKSEEA   97 (361)
T ss_pred             cceEEEEecCCceeeeeeccccccc
Confidence            3478999999999999997443443


No 21 
>KOG0974|consensus
Probab=47.52  E-value=15  Score=35.47  Aligned_cols=34  Identities=21%  Similarity=0.206  Sum_probs=25.2

Q ss_pred             CCCccCCcccccccccccceeeeeeeeCceeeEE
Q psy17930          5 DGGGQGPSRSVKTLEGSVSNMLVTSCRDNICRLW   38 (110)
Q Consensus         5 ~~g~~wrktsrYMprg~V~NVLLT~C~DniCRiW   38 (110)
                      +++.-|+++.|-------+|-++|+.+|-+||+|
T Consensus       210 ~~~~~fgHsaRvw~~~~~~n~i~t~gedctcrvW  243 (967)
T KOG0974|consen  210 LGCTGFGHSARVWACCFLPNRIITVGEDCTCRVW  243 (967)
T ss_pred             cCcccccccceeEEEEeccceeEEeccceEEEEE
Confidence            3446677777644434456789999999999999


No 22 
>KOG0266|consensus
Probab=45.62  E-value=13  Score=30.98  Aligned_cols=16  Identities=38%  Similarity=0.752  Sum_probs=14.2

Q ss_pred             eeeeeeeeCceeeEEe
Q psy17930         24 NMLVTSCRDNICRLWV   39 (110)
Q Consensus        24 NVLLT~C~DniCRiW~   39 (110)
                      |.|+++|.|++||||-
T Consensus       301 ~~l~s~s~d~~i~vwd  316 (456)
T KOG0266|consen  301 NLLVSASYDGTIRVWD  316 (456)
T ss_pred             CEEEEcCCCccEEEEE
Confidence            5679999999999995


No 23 
>PTZ00421 coronin; Provisional
Probab=44.91  E-value=16  Score=31.58  Aligned_cols=16  Identities=25%  Similarity=0.329  Sum_probs=14.8

Q ss_pred             eeeeeeeeCceeeEEe
Q psy17930         24 NMLVTSCRDNICRLWV   39 (110)
Q Consensus        24 NVLLT~C~DniCRiW~   39 (110)
                      +.|+|++.|+++|||-
T Consensus        89 ~~LaSgS~DgtIkIWd  104 (493)
T PTZ00421         89 QKLFTASEDGTIMGWG  104 (493)
T ss_pred             CEEEEEeCCCEEEEEe
Confidence            5799999999999996


No 24 
>KOG0277|consensus
Probab=44.10  E-value=14  Score=31.55  Aligned_cols=19  Identities=26%  Similarity=0.644  Sum_probs=17.8

Q ss_pred             ccceeeeeeeeCceeeEEe
Q psy17930         21 SVSNMLVTSCRDNICRLWV   39 (110)
Q Consensus        21 ~V~NVLLT~C~DniCRiW~   39 (110)
                      .+.|++.+++.|++||||-
T Consensus       158 ~~~nlfas~Sgd~~l~lwd  176 (311)
T KOG0277|consen  158 HIPNLFASASGDGTLRLWD  176 (311)
T ss_pred             CCCCeEEEccCCceEEEEE
Confidence            4789999999999999998


No 25 
>PTZ00420 coronin; Provisional
Probab=43.81  E-value=16  Score=32.50  Aligned_cols=17  Identities=29%  Similarity=0.606  Sum_probs=15.5

Q ss_pred             ceeeeeeeeCceeeEEe
Q psy17930         23 SNMLVTSCRDNICRLWV   39 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~   39 (110)
                      .|+|+|++.|+++|||.
T Consensus        87 ~~lLASgS~DgtIrIWD  103 (568)
T PTZ00420         87 SEILASGSEDLTIRVWE  103 (568)
T ss_pred             CCEEEEEeCCCeEEEEE
Confidence            46899999999999996


No 26 
>KOG0272|consensus
Probab=42.17  E-value=16  Score=32.66  Aligned_cols=24  Identities=25%  Similarity=0.419  Sum_probs=19.2

Q ss_pred             ccccccccceeeeeeeeCceeeEEee
Q psy17930         15 VKTLEGSVSNMLVTSCRDNICRLWVE   40 (110)
Q Consensus        15 rYMprg~V~NVLLT~C~DniCRiW~E   40 (110)
                      ||-|  -.-+.|+||+-||+.+||.-
T Consensus       394 k~~p--~~g~fL~TasyD~t~kiWs~  417 (459)
T KOG0272|consen  394 KYSP--QEGYFLVTASYDNTVKIWST  417 (459)
T ss_pred             Eecc--cCCeEEEEcccCcceeeecC
Confidence            5666  34568999999999999964


No 27 
>KOG2096|consensus
Probab=41.65  E-value=18  Score=31.98  Aligned_cols=16  Identities=38%  Similarity=0.474  Sum_probs=14.2

Q ss_pred             eeeeeeeCceeeEEee
Q psy17930         25 MLVTSCRDNICRLWVE   40 (110)
Q Consensus        25 VLLT~C~DniCRiW~E   40 (110)
                      -|.|+|.|++.|||.-
T Consensus       100 ~lat~~~Dr~Ir~w~~  115 (420)
T KOG2096|consen  100 KLATISGDRSIRLWDV  115 (420)
T ss_pred             eeEEEeCCceEEEEec
Confidence            3799999999999973


No 28 
>KOG0276|consensus
Probab=40.89  E-value=16  Score=34.50  Aligned_cols=18  Identities=17%  Similarity=0.650  Sum_probs=15.3

Q ss_pred             eeeeeeeCceeeEEeeec
Q psy17930         25 MLVTSCRDNICRLWVETV   42 (110)
Q Consensus        25 VLLT~C~DniCRiW~ET~   42 (110)
                      .++|+++|++.|||-.+.
T Consensus       241 iiisgsEDGTvriWhs~T  258 (794)
T KOG0276|consen  241 IIISGSEDGTVRIWNSKT  258 (794)
T ss_pred             EEEEecCCccEEEecCcc
Confidence            469999999999997643


No 29 
>KOG0284|consensus
Probab=40.24  E-value=21  Score=32.03  Aligned_cols=26  Identities=12%  Similarity=0.379  Sum_probs=20.7

Q ss_pred             eeeeeeeeCceeeEEeeecCCCCCcc
Q psy17930         24 NMLVTSCRDNICRLWVETVLPDDGLI   49 (110)
Q Consensus        24 NVLLT~C~DniCRiW~ET~lPeDsLL   49 (110)
                      ++.+||+.||+.+||.-..+-|.+.|
T Consensus       193 skF~t~SdDg~ikiWdf~~~kee~vL  218 (464)
T KOG0284|consen  193 SKFLTCSDDGTIKIWDFRMPKEERVL  218 (464)
T ss_pred             ceeEEecCCCeEEEEeccCCchhhee
Confidence            34699999999999987766665555


No 30 
>PTZ00421 coronin; Provisional
Probab=39.46  E-value=22  Score=30.72  Aligned_cols=16  Identities=25%  Similarity=0.594  Sum_probs=15.0

Q ss_pred             eeeeeeeeCceeeEEe
Q psy17930         24 NMLVTSCRDNICRLWV   39 (110)
Q Consensus        24 NVLLT~C~DniCRiW~   39 (110)
                      |+|+|++.|+++|||-
T Consensus       139 ~iLaSgs~DgtVrIWD  154 (493)
T PTZ00421        139 NVLASAGADMVVNVWD  154 (493)
T ss_pred             CEEEEEeCCCEEEEEE
Confidence            7899999999999995


No 31 
>KOG4283|consensus
Probab=38.84  E-value=19  Score=31.69  Aligned_cols=16  Identities=38%  Similarity=0.596  Sum_probs=14.5

Q ss_pred             eeeeeeeCceeeEEee
Q psy17930         25 MLVTSCRDNICRLWVE   40 (110)
Q Consensus        25 VLLT~C~DniCRiW~E   40 (110)
                      ||.|++-|+.||||-=
T Consensus       203 vLatgsaDg~irlWDi  218 (397)
T KOG4283|consen  203 VLATGSADGAIRLWDI  218 (397)
T ss_pred             EEEecCCCceEEEEEe
Confidence            6899999999999964


No 32 
>PF11319 DUF3121:  Protein of unknown function (DUF3121);  InterPro: IPR017738 Proteins in this entry, including VC_A0118 from Vibrio cholerae O1 biovar eltor str. N16961, are restricted to a subset of bacteria with the type VI secretion system, and are encoded among the type VI-associated pathogenicity islands. However, many species with type VI secretion lack a member of this family, suggesting that members of this family may be targets rather than components of the type VI secretion system.
Probab=38.10  E-value=23  Score=26.82  Aligned_cols=18  Identities=44%  Similarity=0.678  Sum_probs=15.8

Q ss_pred             ceeeeeeeeCceeeEEee
Q psy17930         23 SNMLVTSCRDNICRLWVE   40 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~E   40 (110)
                      -+||+=+|.|||-|+..=
T Consensus        86 rpvL~isC~~niTr~~l~  103 (183)
T PF11319_consen   86 RPVLMISCIDNITRLQLA  103 (183)
T ss_pred             CceEEeEeccCceEEEEE
Confidence            389999999999999763


No 33 
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto
Probab=37.77  E-value=22  Score=23.48  Aligned_cols=16  Identities=25%  Similarity=0.559  Sum_probs=14.5

Q ss_pred             eeeeeeeeCceeeEEe
Q psy17930         24 NMLVTSCRDNICRLWV   39 (110)
Q Consensus        24 NVLLT~C~DniCRiW~   39 (110)
                      +.|++++.|+.+++|.
T Consensus       274 ~~l~~~~~d~~i~iw~  289 (289)
T cd00200         274 KRLASGSADGTIRIWD  289 (289)
T ss_pred             CEEEEecCCCeEEecC
Confidence            6899999999999994


No 34 
>KOG0271|consensus
Probab=37.72  E-value=18  Score=32.59  Aligned_cols=20  Identities=25%  Similarity=0.554  Sum_probs=16.3

Q ss_pred             ceeeeeeeeCceeeEEeeec
Q psy17930         23 SNMLVTSCRDNICRLWVETV   42 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~ET~   42 (110)
                      |--|.++++||.||||--+.
T Consensus       217 ~r~las~skDg~vrIWd~~~  236 (480)
T KOG0271|consen  217 CRRLASSSKDGSVRIWDTKL  236 (480)
T ss_pred             ccceecccCCCCEEEEEccC
Confidence            34688999999999997654


No 35 
>KOG0284|consensus
Probab=37.10  E-value=20  Score=32.12  Aligned_cols=24  Identities=25%  Similarity=0.451  Sum_probs=20.2

Q ss_pred             ccccccccceeeeeeeeCceeeEEeee
Q psy17930         15 VKTLEGSVSNMLVTSCRDNICRLWVET   41 (110)
Q Consensus        15 rYMprg~V~NVLLT~C~DniCRiW~ET   41 (110)
                      +|+|.+   |-|||.++|..||+---.
T Consensus       271 ~f~~n~---N~Llt~skD~~~kv~DiR  294 (464)
T KOG0284|consen  271 KFNPNG---NWLLTGSKDQSCKVFDIR  294 (464)
T ss_pred             EEcCCC---CeeEEccCCceEEEEehh
Confidence            678887   999999999999986433


No 36 
>COG3981 Predicted acetyltransferase [General function prediction only]
Probab=36.65  E-value=24  Score=27.82  Aligned_cols=14  Identities=43%  Similarity=0.667  Sum_probs=11.5

Q ss_pred             ccceeeeeeeeCce
Q psy17930         21 SVSNMLVTSCRDNI   34 (110)
Q Consensus        21 ~V~NVLLT~C~Dni   34 (110)
                      .|--|||||-.||+
T Consensus       130 gi~~Vlvtcd~dN~  143 (174)
T COG3981         130 GIKKVLVTCDKDNI  143 (174)
T ss_pred             CCCeEEEEeCCCCc
Confidence            46679999999986


No 37 
>KOG0649|consensus
Probab=35.60  E-value=20  Score=30.78  Aligned_cols=18  Identities=17%  Similarity=0.540  Sum_probs=14.9

Q ss_pred             eeeeeeeeCceeeEEeee
Q psy17930         24 NMLVTSCRDNICRLWVET   41 (110)
Q Consensus        24 NVLLT~C~DniCRiW~ET   41 (110)
                      .-+||+.||++.|||---
T Consensus       169 ~qilsG~EDGtvRvWd~k  186 (325)
T KOG0649|consen  169 GQILSGAEDGTVRVWDTK  186 (325)
T ss_pred             cceeecCCCccEEEEecc
Confidence            346899999999999654


No 38 
>PTZ00420 coronin; Provisional
Probab=34.48  E-value=29  Score=30.94  Aligned_cols=16  Identities=19%  Similarity=0.488  Sum_probs=14.4

Q ss_pred             eeeeeeeeCceeeEEe
Q psy17930         24 NMLVTSCRDNICRLWV   39 (110)
Q Consensus        24 NVLLT~C~DniCRiW~   39 (110)
                      ++|+|++.|+++|||-
T Consensus       139 ~iLaSgS~DgtIrIWD  154 (568)
T PTZ00420        139 YIMCSSGFDSFVNIWD  154 (568)
T ss_pred             eEEEEEeCCCeEEEEE
Confidence            5788999999999995


No 39 
>KOG0313|consensus
Probab=34.45  E-value=25  Score=31.22  Aligned_cols=16  Identities=25%  Similarity=0.530  Sum_probs=14.0

Q ss_pred             eeeeeeeCceeeEEee
Q psy17930         25 MLVTSCRDNICRLWVE   40 (110)
Q Consensus        25 VLLT~C~DniCRiW~E   40 (110)
                      -+||+|-||+.|||--
T Consensus       117 ~IltgsYDg~~riWd~  132 (423)
T KOG0313|consen  117 WILTGSYDGTSRIWDL  132 (423)
T ss_pred             eEEEeecCCeeEEEec
Confidence            3699999999999964


No 40 
>KOG0302|consensus
Probab=34.12  E-value=27  Score=31.21  Aligned_cols=36  Identities=14%  Similarity=0.152  Sum_probs=25.8

Q ss_pred             CCCccCCcccccccccccceeeeeeeeCceeeEEeeecCCCCCc
Q psy17930          5 DGGGQGPSRSVKTLEGSVSNMLVTSCRDNICRLWVETVLPDDGL   48 (110)
Q Consensus         5 ~~g~~wrktsrYMprg~V~NVLLT~C~DniCRiW~ET~lPeDsL   48 (110)
                      -.+++|--|-        -||+.+|+-|+..|||-=-.-|-++-
T Consensus       260 VEDLqWSptE--------~~vfaScS~DgsIrIWDiRs~~~~~~  295 (440)
T KOG0302|consen  260 VEDLQWSPTE--------DGVFASCSCDGSIRIWDIRSGPKKAA  295 (440)
T ss_pred             hhhhccCCcc--------CceEEeeecCceEEEEEecCCCccce
Confidence            3456665443        48899999999999998766655443


No 41 
>KOG0645|consensus
Probab=33.69  E-value=36  Score=29.27  Aligned_cols=19  Identities=16%  Similarity=0.389  Sum_probs=17.1

Q ss_pred             eeeeeeeeCceeeEEeeec
Q psy17930         24 NMLVTSCRDNICRLWVETV   42 (110)
Q Consensus        24 NVLLT~C~DniCRiW~ET~   42 (110)
                      -+|.+|+-||+.|+|.+-.
T Consensus       163 dlL~S~SYDnTIk~~~~~~  181 (312)
T KOG0645|consen  163 DLLFSCSYDNTIKVYRDED  181 (312)
T ss_pred             ceeEEeccCCeEEEEeecC
Confidence            4789999999999999974


No 42 
>PF11715 Nup160:  Nucleoporin Nup120/160;  InterPro: IPR021717  Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates. The nuclear core complex, or NPC, mediates macromolecular transport across the nuclear envelope. Deletion of the NUP120 gene causes clustering of NPCs at one side of the nuclear envelope, moderate nucleolar fragmentation and slower cell growth []. The vertebrate NPC is estimated to contain between 30 and 60 different proteins. most of which are not known. Two important ones in creating the nucleoporin basket are Nup98 and Nup153, and Nup120, in conjunction with Nup 133, interacts with these two and itself plays a role in mRNA export []. Nup160, Nup133, Nup96, and Nup107 are all targets of phosphorylation. The phosphorylation sites are clustered mainly at the N-terminal regions of these proteins, which are predicted to be natively disordered. The entire Nup107-160 subcomplex is stable throughout the cell cycle, thus it seems unlikely that phosphorylation affects interactions within the Nup107-160 subcomplex, but rather that it regulates the association of the subcomplex with the NPC and other proteins []. ; PDB: 3F7F_D 3H7N_D 3HXR_A.
Probab=33.67  E-value=29  Score=29.08  Aligned_cols=17  Identities=35%  Similarity=0.714  Sum_probs=14.7

Q ss_pred             ceeeeeeeeCceeeEEe
Q psy17930         23 SNMLVTSCRDNICRLWV   39 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~   39 (110)
                      .+.|+|-|.|+..|+|.
T Consensus       230 ~~~l~tl~~D~~LRiW~  246 (547)
T PF11715_consen  230 DTFLFTLSRDHTLRIWS  246 (547)
T ss_dssp             TTEEEEEETTSEEEEEE
T ss_pred             CCEEEEEeCCCeEEEEE
Confidence            35678999999999996


No 43 
>KOG1188|consensus
Probab=33.56  E-value=27  Score=30.60  Aligned_cols=28  Identities=18%  Similarity=0.338  Sum_probs=20.7

Q ss_pred             cceeeeeeeeCceeeEEeeecCCCCCcc
Q psy17930         22 VSNMLVTSCRDNICRLWVETVLPDDGLI   49 (110)
Q Consensus        22 V~NVLLT~C~DniCRiW~ET~lPeDsLL   49 (110)
                      =++++++||-|+++|+|-=-+--+-.-+
T Consensus        83 s~h~v~s~ssDG~Vr~wD~Rs~~e~a~~  110 (376)
T KOG1188|consen   83 SPHGVISCSSDGTVRLWDIRSQAESARI  110 (376)
T ss_pred             CCCeeEEeccCCeEEEEEeecchhhhhe
Confidence            4678999999999999976544343333


No 44 
>KOG1034|consensus
Probab=31.99  E-value=30  Score=30.42  Aligned_cols=17  Identities=24%  Similarity=0.679  Sum_probs=15.3

Q ss_pred             eeeeeeeeCceeeEEee
Q psy17930         24 NMLVTSCRDNICRLWVE   40 (110)
Q Consensus        24 NVLLT~C~DniCRiW~E   40 (110)
                      |.||++++|...|||-=
T Consensus       149 qlvls~SkD~svRlwnI  165 (385)
T KOG1034|consen  149 QLVLSASKDHSVRLWNI  165 (385)
T ss_pred             cEEEEecCCceEEEEec
Confidence            68999999999999964


No 45 
>KOG0643|consensus
Probab=31.75  E-value=26  Score=30.20  Aligned_cols=17  Identities=35%  Similarity=0.677  Sum_probs=14.7

Q ss_pred             ceeeeeeeeCceeeEEe
Q psy17930         23 SNMLVTSCRDNICRLWV   39 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~   39 (110)
                      .--|+|++-||+||||-
T Consensus        64 s~~liTGSAD~t~kLWD   80 (327)
T KOG0643|consen   64 SKHLITGSADQTAKLWD   80 (327)
T ss_pred             cceeeeccccceeEEEE
Confidence            34589999999999995


No 46 
>PLN00181 protein SPA1-RELATED; Provisional
Probab=31.69  E-value=32  Score=30.38  Aligned_cols=16  Identities=25%  Similarity=0.673  Sum_probs=14.7

Q ss_pred             eeeeeeeeCceeeEEe
Q psy17930         24 NMLVTSCRDNICRLWV   39 (110)
Q Consensus        24 NVLLT~C~DniCRiW~   39 (110)
                      +.|+|++.|+++|||-
T Consensus       589 ~~L~Sgs~Dg~v~iWd  604 (793)
T PLN00181        589 TLLASGSDDGSVKLWS  604 (793)
T ss_pred             CEEEEEcCCCEEEEEE
Confidence            5789999999999996


No 47 
>KOG0285|consensus
Probab=31.41  E-value=32  Score=30.85  Aligned_cols=16  Identities=31%  Similarity=0.619  Sum_probs=14.4

Q ss_pred             eeeeeeeCceeeEEee
Q psy17930         25 MLVTSCRDNICRLWVE   40 (110)
Q Consensus        25 VLLT~C~DniCRiW~E   40 (110)
                      -.+||++|.++|||-+
T Consensus       291 qvit~S~D~tvrlWDl  306 (460)
T KOG0285|consen  291 QVITGSHDSTVRLWDL  306 (460)
T ss_pred             ceEEecCCceEEEeee
Confidence            3689999999999988


No 48 
>KOG0772|consensus
Probab=31.22  E-value=28  Score=32.31  Aligned_cols=16  Identities=25%  Similarity=0.530  Sum_probs=14.4

Q ss_pred             eeeeeeeeCceeeEEe
Q psy17930         24 NMLVTSCRDNICRLWV   39 (110)
Q Consensus        24 NVLLT~C~DniCRiW~   39 (110)
                      +-.|||+.|++.|||-
T Consensus       282 ~~FlT~s~DgtlRiWd  297 (641)
T KOG0772|consen  282 EEFLTCSYDGTLRIWD  297 (641)
T ss_pred             cceEEecCCCcEEEEe
Confidence            5689999999999995


No 49 
>PF03581 Herpes_UL33:  Herpesvirus UL33-like protein;  InterPro: IPR005208 This is a family of Herpesvirus proteins including UL33 P10217 from SWISSPROT,UL51 P16792 from SWISSPROT. The proteins in this family are involved in packaging viral DNA.; GO: 0019073 viral DNA genome packaging
Probab=30.82  E-value=13  Score=25.60  Aligned_cols=13  Identities=38%  Similarity=0.777  Sum_probs=10.8

Q ss_pred             eEEeeecCCCCCc
Q psy17930         36 RLWVETVLPDDGL   48 (110)
Q Consensus        36 RiW~ET~lPeDsL   48 (110)
                      |||+|-++|++--
T Consensus         1 ~l~Fe~mlP~~~e   13 (75)
T PF03581_consen    1 ELWFEPMLPPEIE   13 (75)
T ss_pred             CccccccCchHHH
Confidence            6899999998644


No 50 
>KOG0303|consensus
Probab=30.48  E-value=42  Score=30.25  Aligned_cols=68  Identities=21%  Similarity=0.403  Sum_probs=40.8

Q ss_pred             eeeeeeeeCceeeEEeeecCCCCCcc-cccccCCCCCCCCccccc--ccchhHHHHHHHHhccceee-----eccCceeE
Q psy17930         24 NMLVTSCRDNICRLWVETVLPDDGLI-NMSQFDPMAAQNPKFIQV--TPTLDRDMYNLLQCGMDTYL-----ATEGSLVS   95 (110)
Q Consensus        24 NVLLT~C~DniCRiW~ET~lPeDsLL-~~s~~~~~~s~~~~f~~~--~~~K~ri~~~L~~~~~~~~~-----~~~~~~~~   95 (110)
                      ||+.+|++|-+|-||.   .|++.+. +++  .+..-..+.-++.  ..-+-...|.|.+-|.|--+     .|--.++.
T Consensus        95 ~vIASgSeD~~v~vW~---IPe~~l~~~lt--epvv~L~gH~rrVg~V~wHPtA~NVLlsag~Dn~v~iWnv~tgeali~  169 (472)
T KOG0303|consen   95 CVIASGSEDTKVMVWQ---IPENGLTRDLT--EPVVELYGHQRRVGLVQWHPTAPNVLLSAGSDNTVSIWNVGTGEALIT  169 (472)
T ss_pred             ceeecCCCCceEEEEE---CCCcccccCcc--cceEEEeecceeEEEEeecccchhhHhhccCCceEEEEeccCCceeee
Confidence            6889999999999996   5787776 433  1111111111111  11236778999999988543     34444544


Q ss_pred             e
Q psy17930         96 L   96 (110)
Q Consensus        96 ~   96 (110)
                      |
T Consensus       170 l  170 (472)
T KOG0303|consen  170 L  170 (472)
T ss_pred             c
Confidence            3


No 51 
>PF14783 BBS2_Mid:  Ciliary BBSome complex subunit 2, middle region
Probab=29.24  E-value=43  Score=24.41  Aligned_cols=18  Identities=22%  Similarity=0.246  Sum_probs=16.6

Q ss_pred             eeeeeeeeCceeeEEeee
Q psy17930         24 NMLVTSCRDNICRLWVET   41 (110)
Q Consensus        24 NVLLT~C~DniCRiW~ET   41 (110)
                      |-||.+|+|...|++++.
T Consensus        16 ~eLlvGs~D~~IRvf~~~   33 (111)
T PF14783_consen   16 NELLVGSDDFEIRVFKGD   33 (111)
T ss_pred             ceEEEecCCcEEEEEeCC
Confidence            789999999999999974


No 52 
>PF03106 WRKY:  WRKY DNA -binding domain;  InterPro: IPR003657 The WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger- like motif. The WRKY domain is found in one or two copies in a superfamily of plant transcription factors involved in the regulation of various physiological programs that are unique to plants, including pathogen defence, senescence, trichome development and the biosynthesis of secondary metabolites. The WRKY domain binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core of the W box is essential for function and WRKY binding []. Some proteins known to contain a WRKY domain include Arabidopsis thaliana ZAP1 (Zinc-dependent Activator Protein-1) and AtWRKY44/TTG2, a protein involved in trichome development and anthocyanin pigmentation; and wild oat ABF1-2, two proteins involved in the gibberelic acid-induced expression of the alpha-Amy2 gene. Structural studies indicate that this domain is a four-stranded beta-sheet with a zinc binding pocket, forming a novel zinc and DNA binding structure []. The WRKYGQK residues correspond to the most N-terminal beta-strand, which enables extensive hydrophobic interactions, contributing to the structural stability of the beta-sheet.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2AYD_A 1WJ2_A 2LEX_A.
Probab=28.79  E-value=18  Score=23.41  Aligned_cols=16  Identities=25%  Similarity=0.324  Sum_probs=9.7

Q ss_pred             CCCccCCccccccccc
Q psy17930          5 DGGGQGPSRSVKTLEG   20 (110)
Q Consensus         5 ~~g~~wrktsrYMprg   20 (110)
                      |+|+.|||-+.-.=.|
T Consensus         2 ~Dgy~WRKYGqK~i~g   17 (60)
T PF03106_consen    2 DDGYRWRKYGQKNIKG   17 (60)
T ss_dssp             -SSS-EEEEEEEEETT
T ss_pred             CCCCchhhccCcccCC
Confidence            6899999977554333


No 53 
>KOG0273|consensus
Probab=28.47  E-value=35  Score=31.12  Aligned_cols=22  Identities=23%  Similarity=0.481  Sum_probs=17.8

Q ss_pred             ccccccccceeeeeeeeCceeeEEe
Q psy17930         15 VKTLEGSVSNMLVTSCRDNICRLWV   39 (110)
Q Consensus        15 rYMprg~V~NVLLT~C~DniCRiW~   39 (110)
                      ||=|+++   +|+||+-|.+.+||.
T Consensus       366 k~n~tg~---LLaS~SdD~TlkiWs  387 (524)
T KOG0273|consen  366 KWNPTGS---LLASCSDDGTLKIWS  387 (524)
T ss_pred             EECCCCc---eEEEecCCCeeEeee
Confidence            4556654   579999999999998


No 54 
>smart00774 WRKY DNA binding domain. The WRKY domain is a DNA binding domain found in one or two copies in a superfamily of plant transcription factors. These transcription factors are involved in the regulation of various physiological programs that are unique to plants, including pathogen defense, senescence and trichome development. The domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger-like motif. It binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core is essential for function and WRKY binding.
Probab=28.20  E-value=29  Score=22.76  Aligned_cols=18  Identities=33%  Similarity=0.309  Sum_probs=13.5

Q ss_pred             CCCccCCccccccccccc
Q psy17930          5 DGGGQGPSRSVKTLEGSV   22 (110)
Q Consensus         5 ~~g~~wrktsrYMprg~V   22 (110)
                      ++|+.|||-+--+-.++.
T Consensus         2 ~DGy~WRKYGQK~ikgs~   19 (59)
T smart00774        2 DDGYQWRKYGQKVIKGSP   19 (59)
T ss_pred             CCcccccccCcEecCCCc
Confidence            789999998876655543


No 55 
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domains depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic amino acid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is
Probab=27.40  E-value=76  Score=22.11  Aligned_cols=26  Identities=27%  Similarity=0.437  Sum_probs=19.8

Q ss_pred             HHHHHHhccce---------eeeccCceeEeeeec
Q psy17930         75 MYNLLQCGMDT---------YLATEGSLVSLSTDI  100 (110)
Q Consensus        75 ~~~L~~~~~~~---------~~~~~~~~~~~~~~~  100 (110)
                      ....+.+|+|.         |+--||..|+|.+|-
T Consensus        28 ~~I~~Rl~~d~~~~~~~~L~YlDDEgD~VllT~D~   62 (86)
T cd06409          28 TLISQRLGDDDFETHLYALSYVDDEGDIVLITSDS   62 (86)
T ss_pred             HHHHHHhCCccccCCcccEEEEcCCCCEEEEeccc
Confidence            34445567774         899999999999983


No 56 
>KOG0296|consensus
Probab=27.39  E-value=31  Score=30.48  Aligned_cols=18  Identities=28%  Similarity=0.685  Sum_probs=15.6

Q ss_pred             eeeeeeeeCceeeEEeee
Q psy17930         24 NMLVTSCRDNICRLWVET   41 (110)
Q Consensus        24 NVLLT~C~DniCRiW~ET   41 (110)
                      -.|+|+|-|++.|+|---
T Consensus       339 ~~l~t~c~~g~v~~wDaR  356 (399)
T KOG0296|consen  339 DYLLTACANGKVRQWDAR  356 (399)
T ss_pred             chheeeccCceEEeeecc
Confidence            478999999999999653


No 57 
>KOG1188|consensus
Probab=27.26  E-value=52  Score=28.92  Aligned_cols=18  Identities=22%  Similarity=0.486  Sum_probs=16.2

Q ss_pred             ceeeeeeeeCceeeEEee
Q psy17930         23 SNMLVTSCRDNICRLWVE   40 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~E   40 (110)
                      -++|.|+.||+..-+|+-
T Consensus       328 ~~~l~TGGEDG~l~~Wk~  345 (376)
T KOG1188|consen  328 NDVLYTGGEDGLLQAWKV  345 (376)
T ss_pred             cceeeccCCCceEEEEec
Confidence            378999999999999994


No 58 
>KOG0263|consensus
Probab=27.09  E-value=38  Score=31.83  Aligned_cols=24  Identities=33%  Similarity=0.443  Sum_probs=19.1

Q ss_pred             ceeeeeeeeCceeeEEeeecCCCC
Q psy17930         23 SNMLVTSCRDNICRLWVETVLPDD   46 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~ET~lPeD   46 (110)
                      -|||+++..||.+|+|-=+.+-++
T Consensus       631 g~vLasgg~DnsV~lWD~~~~~~~  654 (707)
T KOG0263|consen  631 GNVLASGGADNSVRLWDLTKVIEL  654 (707)
T ss_pred             CCEEEecCCCCeEEEEEchhhccc
Confidence            478999999999999965555444


No 59 
>PHA00442 host recBCD nuclease inhibitor
Probab=27.02  E-value=38  Score=22.86  Aligned_cols=19  Identities=21%  Similarity=0.412  Sum_probs=15.2

Q ss_pred             ccchhHHHHHHHHhcccee
Q psy17930         68 TPTLDRDMYNLLQCGMDTY   86 (110)
Q Consensus        68 ~~~K~ri~~~L~~~~~~~~   86 (110)
                      -.+....+++|++||.|.+
T Consensus        25 Lek~~~~L~~Lea~GVDNW   43 (59)
T PHA00442         25 LEKDNEFLKALRACGVDNW   43 (59)
T ss_pred             HHHhhHHHHHHHHcCCcch
Confidence            3355788999999999864


No 60 
>PHA03229 DNA packaging protein UL33; Provisional
Probab=26.45  E-value=31  Score=26.32  Aligned_cols=15  Identities=20%  Similarity=0.439  Sum_probs=12.6

Q ss_pred             ceeeEEeeecCCCCC
Q psy17930         33 NICRLWVETVLPDDG   47 (110)
Q Consensus        33 niCRiW~ET~lPeDs   47 (110)
                      ..++||+|-++|++-
T Consensus        43 ~~~~iwFE~llP~ei   57 (132)
T PHA03229         43 GDAAVWFEDLTPVEL   57 (132)
T ss_pred             cceeeeecccCchHH
Confidence            578999999999853


No 61 
>PHA03236 DNA packaging protein UL33; Provisional
Probab=26.33  E-value=32  Score=26.04  Aligned_cols=16  Identities=38%  Similarity=0.875  Sum_probs=13.5

Q ss_pred             eCceeeEEeeecCCCC
Q psy17930         31 RDNICRLWVETVLPDD   46 (110)
Q Consensus        31 ~DniCRiW~ET~lPeD   46 (110)
                      .+...+||+|-++|++
T Consensus        35 ~~~~~~iwFE~llP~e   50 (127)
T PHA03236         35 DDFQYRIWFEYLIPDE   50 (127)
T ss_pred             CccceeeeecccCchH
Confidence            5578899999999985


No 62 
>KOG0301|consensus
Probab=26.32  E-value=43  Score=31.73  Aligned_cols=25  Identities=24%  Similarity=0.626  Sum_probs=18.9

Q ss_pred             eeeeeeeCceeeEEee------ecCCCCCcc
Q psy17930         25 MLVTSCRDNICRLWVE------TVLPDDGLI   49 (110)
Q Consensus        25 VLLT~C~DniCRiW~E------T~lPeDsLL   49 (110)
                      ..+||.||++.|||+-      -.+|..|+-
T Consensus       233 ~Ivs~gEDrtlriW~~~e~~q~I~lPttsiW  263 (745)
T KOG0301|consen  233 LIVSTGEDRTLRIWKKDECVQVITLPTTSIW  263 (745)
T ss_pred             eEEEecCCceEEEeecCceEEEEecCccceE
Confidence            4589999999999973      446665554


No 63 
>COG2319 FOG: WD40 repeat [General function prediction only]
Probab=26.30  E-value=54  Score=22.39  Aligned_cols=24  Identities=25%  Similarity=0.476  Sum_probs=18.5

Q ss_pred             ccccccccceeeeeeeeCceeeEEeee
Q psy17930         15 VKTLEGSVSNMLVTSCRDNICRLWVET   41 (110)
Q Consensus        15 rYMprg~V~NVLLT~C~DniCRiW~ET   41 (110)
                      .+.|.+   +.+++++.|+.+|+|...
T Consensus       248 ~~~~~~---~~~~~~~~d~~~~~~~~~  271 (466)
T COG2319         248 SFSPDG---SLLASGSSDGTIRLWDLR  271 (466)
T ss_pred             eECCCC---CEEEEecCCCcEEEeeec
Confidence            355555   677799999999999654


No 64 
>PF01321 Creatinase_N:  Creatinase/Prolidase N-terminal domain;  InterPro: IPR000587 Creatinase or creatine amidinohydrolase (3.5.3.3 from EC) catalyses the conversion of creatine and water to sarcosine and urea. The enzyme works as a homodimer, and is induced by choline chloride. Each monomer of creatinase has two clearly defined domains, a small N-terminal domain, and a large C-terminal domain. The structure of the C-terminal region represents the "pita-bread" fold. The fold contains both alpha helices and an anti-parallel beta sheet within two structurally similar domains that are thought to be derived from an ancient gene duplication. The active site, where conserved, is located between the two domains. The fold is common to methionine aminopeptidase (3.4.11.18 from EC), aminopeptidase P (3.4.11.9 from EC), prolidase (3.4.13.9 from EC), agropine synthase and creatinase (3.5.3.3 from EC). Though many of these peptidases require a divalent cation, creatinase is not a metal-dependent enzyme [, , ]. ; GO: 0016787 hydrolase activity; PDB: 1PV9_A 3CTZ_A 3IL0_B 3PN9_A 2HOW_A 1WN1_B 3I7M_A 1CHM_B 3QOC_D 1KP0_B ....
Probab=26.20  E-value=62  Score=20.87  Aligned_cols=21  Identities=24%  Similarity=0.343  Sum_probs=17.2

Q ss_pred             hHHHHHHHHhccceeeeccCc
Q psy17930         72 DRDMYNLLQCGMDTYLATEGS   92 (110)
Q Consensus        72 ~ri~~~L~~~~~~~~~~~~~~   92 (110)
                      +|++++|++.|+|.++.+...
T Consensus         3 ~rl~~~m~~~gid~lll~~~~   23 (132)
T PF01321_consen    3 ERLRAAMAEAGIDALLLTSPE   23 (132)
T ss_dssp             HHHHHHHHHTT-SEEEEESHH
T ss_pred             HHHHHHHHHCCCCEEEEcChh
Confidence            689999999999999887654


No 65 
>KOG0313|consensus
Probab=26.03  E-value=49  Score=29.48  Aligned_cols=17  Identities=35%  Similarity=0.540  Sum_probs=14.6

Q ss_pred             eeeeeeeeCceeeEEee
Q psy17930         24 NMLVTSCRDNICRLWVE   40 (110)
Q Consensus        24 NVLLT~C~DniCRiW~E   40 (110)
                      +.|++.+.||+|++|-=
T Consensus       359 ~~~~S~S~D~t~klWDv  375 (423)
T KOG0313|consen  359 FQLVSGSYDNTVKLWDV  375 (423)
T ss_pred             eEEEEEecCCeEEEEEe
Confidence            35899999999999964


No 66 
>KOG1009|consensus
Probab=25.56  E-value=44  Score=29.85  Aligned_cols=17  Identities=53%  Similarity=0.817  Sum_probs=14.9

Q ss_pred             ceeeeeeeeCceeeEEe
Q psy17930         23 SNMLVTSCRDNICRLWV   39 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~   39 (110)
                      .|-|+++|.||.||+|-
T Consensus       135 ~~~l~s~s~dns~~l~D  151 (434)
T KOG1009|consen  135 SNFLVSGSVDNSVRLWD  151 (434)
T ss_pred             CceeeeeeccceEEEEE
Confidence            36679999999999995


No 67 
>KOG0316|consensus
Probab=25.09  E-value=43  Score=28.69  Aligned_cols=22  Identities=27%  Similarity=0.527  Sum_probs=17.6

Q ss_pred             ccccccccceeeeeeeeCceeeEEe
Q psy17930         15 VKTLEGSVSNMLVTSCRDNICRLWV   39 (110)
Q Consensus        15 rYMprg~V~NVLLT~C~DniCRiW~   39 (110)
                      ||=-.|+-|   |||..|.+.|||.
T Consensus        24 ryN~dGnY~---ltcGsdrtvrLWN   45 (307)
T KOG0316|consen   24 RYNVDGNYC---LTCGSDRTVRLWN   45 (307)
T ss_pred             EEccCCCEE---EEcCCCceEEeec
Confidence            455555556   9999999999996


No 68 
>KOG0273|consensus
Probab=24.75  E-value=23  Score=32.25  Aligned_cols=19  Identities=26%  Similarity=0.611  Sum_probs=16.9

Q ss_pred             ceeeeeeeeCceeeEEeee
Q psy17930         23 SNMLVTSCRDNICRLWVET   41 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~ET   41 (110)
                      -+.|+|+.+|+..|||..+
T Consensus       247 G~~LatG~~~G~~riw~~~  265 (524)
T KOG0273|consen  247 GTLLATGSEDGEARIWNKD  265 (524)
T ss_pred             CCeEEEeecCcEEEEEecC
Confidence            4679999999999999876


No 69 
>KOG0319|consensus
Probab=24.64  E-value=49  Score=31.53  Aligned_cols=20  Identities=30%  Similarity=0.428  Sum_probs=16.0

Q ss_pred             ccce-eeeeeeeCceeeEEee
Q psy17930         21 SVSN-MLVTSCRDNICRLWVE   40 (110)
Q Consensus        21 ~V~N-VLLT~C~DniCRiW~E   40 (110)
                      +..+ .|+||++|+..|||.=
T Consensus       374 ~~~g~llat~sKD~svilWr~  394 (775)
T KOG0319|consen  374 WSSGDLLATGSKDKSVILWRL  394 (775)
T ss_pred             cccCcEEEEecCCceEEEEEe
Confidence            3455 6789999999999953


No 70 
>KOG0308|consensus
Probab=24.38  E-value=1.1e+02  Score=29.06  Aligned_cols=61  Identities=26%  Similarity=0.401  Sum_probs=35.4

Q ss_pred             ccceeeeeeeeCceeeEEeeecCCCCCcccccccCCCCCCCCcccccccchhHHHHHHHHhccceeeeccCceeEeeeec
Q psy17930         21 SVSNMLVTSCRDNICRLWVETVLPDDGLINMSQFDPMAAQNPKFIQVTPTLDRDMYNLLQCGMDTYLATEGSLVSLSTDI  100 (110)
Q Consensus        21 ~V~NVLLT~C~DniCRiW~ET~lPeDsLL~~s~~~~~~s~~~~f~~~~~~K~ri~~~L~~~~~~~~~~~~~~~~~~~~~~  100 (110)
                      ..-+-|.|+.+|++.|+|.=+-.   +          ..+.-.+...+-++.-=.|-+--|||.-      .|+|.|.|-
T Consensus        35 ~~~ryLfTgGRDg~i~~W~~~~d---~----------~~~s~~~~asme~HsDWVNDiiL~~~~~------tlIS~SsDt   95 (735)
T KOG0308|consen   35 PNGRYLFTGGRDGIIRLWSVTQD---S----------NEPSTPYIASMEHHSDWVNDIILCGNGK------TLISASSDT   95 (735)
T ss_pred             CCCceEEecCCCceEEEeccccc---c----------CCcccchhhhhhhhHhHHhhHHhhcCCC------ceEEecCCc
Confidence            44457999999999999987632   1          0111113334444444445555555542      567777664


No 71 
>KOG0306|consensus
Probab=23.33  E-value=54  Score=31.63  Aligned_cols=16  Identities=25%  Similarity=0.754  Sum_probs=14.7

Q ss_pred             eeeeeeeeCceeeEEe
Q psy17930         24 NMLVTSCRDNICRLWV   39 (110)
Q Consensus        24 NVLLT~C~DniCRiW~   39 (110)
                      ++|+++|+|++.++|-
T Consensus       162 ~~lvS~sKDs~iK~Wd  177 (888)
T KOG0306|consen  162 SFLVSVSKDSMIKFWD  177 (888)
T ss_pred             eEEEEeccCceEEEEe
Confidence            6899999999999994


No 72 
>KOG4328|consensus
Probab=23.20  E-value=1e+02  Score=28.11  Aligned_cols=60  Identities=23%  Similarity=0.325  Sum_probs=36.0

Q ss_pred             eeeeeeCceeeEEeee----cCCCCCccccc--------ccCCCCCCCCcccccccchhHHHHHHHHhccceeeeccCce
Q psy17930         26 LVTSCRDNICRLWVET----VLPDDGLINMS--------QFDPMAAQNPKFIQVTPTLDRDMYNLLQCGMDTYLATEGSL   93 (110)
Q Consensus        26 LLT~C~DniCRiW~ET----~lPeDsLL~~s--------~~~~~~s~~~~f~~~~~~K~ri~~~L~~~~~~~~~~~~~~~   93 (110)
                      |||-|.||..|||-..    ..+.-..+..+        -++..-....++.-.+..+.+         +|.|=++-|.+
T Consensus       384 l~TT~~D~~IRv~dss~~sa~~~p~~~I~Hn~~t~RwlT~fKA~W~P~~~li~vg~~~r~---------IDv~~~~~~q~  454 (498)
T KOG4328|consen  384 LLTTCQDNEIRVFDSSCISAKDEPLGTIPHNNRTGRWLTPFKAAWDPDYNLIVVGRYPRP---------IDVFDGNGGQM  454 (498)
T ss_pred             eEeeccCCceEEeecccccccCCccceeeccCcccccccchhheeCCCccEEEEeccCcc---------eeEEcCCCCEE
Confidence            8999999999999984    23333333211        222333345566666666555         67776666665


Q ss_pred             e
Q psy17930         94 V   94 (110)
Q Consensus        94 ~   94 (110)
                      |
T Consensus       455 v  455 (498)
T KOG4328|consen  455 V  455 (498)
T ss_pred             e
Confidence            4


No 73 
>KOG0303|consensus
Probab=22.89  E-value=32  Score=30.98  Aligned_cols=18  Identities=28%  Similarity=0.641  Sum_probs=16.5

Q ss_pred             cceeeeeeeeCceeeEEe
Q psy17930         22 VSNMLVTSCRDNICRLWV   39 (110)
Q Consensus        22 V~NVLLT~C~DniCRiW~   39 (110)
                      -.|||+|+.-||+.-||.
T Consensus       143 A~NVLlsag~Dn~v~iWn  160 (472)
T KOG0303|consen  143 APNVLLSAGSDNTVSIWN  160 (472)
T ss_pred             chhhHhhccCCceEEEEe
Confidence            369999999999999995


No 74 
>KOG0296|consensus
Probab=21.78  E-value=68  Score=28.46  Aligned_cols=25  Identities=16%  Similarity=0.214  Sum_probs=20.2

Q ss_pred             cccccccccccceeeeeeeeCceeeEEe
Q psy17930         12 SRSVKTLEGSVSNMLVTSCRDNICRLWV   39 (110)
Q Consensus        12 ktsrYMprg~V~NVLLT~C~DniCRiW~   39 (110)
                      ..+++||.|--.   +|.+.|++.|+|-
T Consensus       194 t~G~f~pdGKr~---~tgy~dgti~~Wn  218 (399)
T KOG0296|consen  194 TCGEFIPDGKRI---LTGYDDGTIIVWN  218 (399)
T ss_pred             ccccccCCCceE---EEEecCceEEEEe
Confidence            357888887544   8999999999995


No 75 
>KOG0315|consensus
Probab=21.65  E-value=54  Score=28.15  Aligned_cols=26  Identities=31%  Similarity=0.576  Sum_probs=19.1

Q ss_pred             eeeeeeeCceeeEEee-------ecCCCCCccc
Q psy17930         25 MLVTSCRDNICRLWVE-------TVLPDDGLIN   50 (110)
Q Consensus        25 VLLT~C~DniCRiW~E-------T~lPeDsLL~   50 (110)
                      .|+|++-|.+.|||.-       |+.=.|+-+|
T Consensus        12 iLvsA~YDhTIRfWqa~tG~C~rTiqh~dsqVN   44 (311)
T KOG0315|consen   12 ILVSAGYDHTIRFWQALTGICSRTIQHPDSQVN   44 (311)
T ss_pred             EEEeccCcceeeeeehhcCeEEEEEecCcccee
Confidence            4789999999999963       5555555553


No 76 
>KOG1517|consensus
Probab=21.43  E-value=50  Score=33.22  Aligned_cols=20  Identities=25%  Similarity=0.597  Sum_probs=17.3

Q ss_pred             eeeeeeeeCceeeEEeeecC
Q psy17930         24 NMLVTSCRDNICRLWVETVL   43 (110)
Q Consensus        24 NVLLT~C~DniCRiW~ET~l   43 (110)
                      ..|||++.|+++|||+.-..
T Consensus      1124 aLlLtas~dGvIRIwk~y~~ 1143 (1387)
T KOG1517|consen 1124 ALLLTASSDGVIRIWKDYAD 1143 (1387)
T ss_pred             hheeeeccCceEEEeccccc
Confidence            36899999999999998754


No 77 
>PF02579 Nitro_FeMo-Co:  Dinitrogenase iron-molybdenum cofactor;  InterPro: IPR003731 This entry represents several Nif (B, X and Y) proteins, which are involved in the biosynthesis of the iron-molybdenum cofactor (FeMo-co) found in the dinitrogenase enzyme of the nitrogenase complex in nitrogen-fixing bacteria. The nitrogenase complex catalyses the reduction of atmospheric dinitrogen to ammonia, and is composed of an iron metalloprotein (dinitrogenase reductase; homodimer of NifH; IPR000392 from INTERPRO) and a Fe-Mo metalloprotein (dinitrogenase; heterotetramer of NifD and NifK; IPR000318 from INTERPRO). The pathway for the synthesis of the Fe-Mo cofactor involves several proteins, including NifB, NifE, NifH, NifN, NifQ, NifV and NifX. NifB appears to be an iron-sulphur source for FeMo-co biosynthesis, while NifX may be associated with the mature FeMo-co, in particular with the addition of homocitrate during the last step of biosynthesis []. The NifX protein shows sequence similarity with the C terminus of NifB [], as well as to the conserved protein MTH1175 from the archaeon Methanobacterium thermoautotrophicum, which displays a ribonuclease H-like motif of three layers, alpha/beta/alpha, with a single mixed beta-sheet [].; PDB: 2QTD_A 2KLA_A 1EO1_A 1P90_A 1RDU_A 2YX6_D 1O13_A 1T3V_A 2RE2_B 2WFB_A.
Probab=21.32  E-value=88  Score=19.59  Aligned_cols=22  Identities=18%  Similarity=0.471  Sum_probs=16.3

Q ss_pred             hHHHHHHHHhccceeeeccCce
Q psy17930         72 DRDMYNLLQCGMDTYLATEGSL   93 (110)
Q Consensus        72 ~ri~~~L~~~~~~~~~~~~~~~   93 (110)
                      ....++|++.|+..|.+.+|++
T Consensus        64 ~~~~~~L~~~gI~v~~~~~~~i   85 (94)
T PF02579_consen   64 EGAFRALKEAGIKVYQGAGGDI   85 (94)
T ss_dssp             HHHHHHHHHTTSEEEESTSSBH
T ss_pred             HHHHHHHHHCCCEEEEcCCCCH
Confidence            6777888888888888755543


No 78 
>PLN00181 protein SPA1-RELATED; Provisional
Probab=21.23  E-value=67  Score=28.41  Aligned_cols=17  Identities=12%  Similarity=0.421  Sum_probs=15.2

Q ss_pred             ceeeeeeeeCceeeEEe
Q psy17930         23 SNMLVTSCRDNICRLWV   39 (110)
Q Consensus        23 ~NVLLT~C~DniCRiW~   39 (110)
                      .+.|+|++.|+++|||-
T Consensus       545 ~~~las~~~Dg~v~lWd  561 (793)
T PLN00181        545 KSQVASSNFEGVVQVWD  561 (793)
T ss_pred             CCEEEEEeCCCeEEEEE
Confidence            36799999999999995


No 79 
>KOG0271|consensus
Probab=20.93  E-value=56  Score=29.52  Aligned_cols=15  Identities=47%  Similarity=0.718  Sum_probs=13.8

Q ss_pred             eeeeeeeCceeeEEe
Q psy17930         25 MLVTSCRDNICRLWV   39 (110)
Q Consensus        25 VLLT~C~DniCRiW~   39 (110)
                      .|+|++.|.+.|||-
T Consensus       129 ~l~tGsGD~TvR~WD  143 (480)
T KOG0271|consen  129 RLVTGSGDTTVRLWD  143 (480)
T ss_pred             eEEecCCCceEEeec
Confidence            679999999999995


No 80 
>TIGR03360 VI_minor_1 type VI secretion-associated protein, VC_A0118 family. Members of this protein family, including VC_A0118 from Vibrio cholerae El Tor N16961, are restricted to a subset of bacteria with the type VI secretion system, and are encoded among the type VI-associated pathogenicity islands. However, many species with type VI secretion lack a member of this family. This lack suggests that members of this family may be targets rather than components of the type VI secretion system.
Probab=20.79  E-value=64  Score=25.46  Aligned_cols=15  Identities=53%  Similarity=0.787  Sum_probs=13.1

Q ss_pred             eeeeeeeeCceeeEE
Q psy17930         24 NMLVTSCRDNICRLW   38 (110)
Q Consensus        24 NVLLT~C~DniCRiW   38 (110)
                      .||+-+|.|||-||=
T Consensus        82 PvL~lsC~dnITrl~   96 (185)
T TIGR03360        82 PVLMISCVDNITRLQ   96 (185)
T ss_pred             CeEEEEeccCceEEE
Confidence            469999999999984


No 81 
>PF08832 SRC-1:  Steroid receptor coactivator;  InterPro: IPR014935 This domain is found in steroid/nuclear receptor coactivators and contains two LXXLL motifs that are involved in receptor binding [] and includes SRC-1/NcoA-1, NcoA-2/TIF2, pCIP/ACTR/GRIP-1/AIB1. ; PDB: 4DMA_F 2O9I_D 2QXM_D 2QGT_D 2QA8_D 2QSE_C 2QA6_D 2QAB_D 2QR9_D 1WM0_Y ....
Probab=20.06  E-value=62  Score=22.78  Aligned_cols=16  Identities=25%  Similarity=0.231  Sum_probs=12.7

Q ss_pred             cccchhHHHHHHHHhc
Q psy17930         67 VTPTLDRDMYNLLQCG   82 (110)
Q Consensus        67 ~~~~K~ri~~~L~~~~   82 (110)
                      .-.-|.||+|+|.|-|
T Consensus        51 SL~EKHKILHrLLQng   66 (78)
T PF08832_consen   51 SLQEKHKILHRLLQNG   66 (78)
T ss_dssp             -CCCCTHHHHHHHHCS
T ss_pred             cHHHHHHHHHHHHhcC
Confidence            4446799999999987


Done!