Query         psy17940
Match_columns 81
No_of_seqs    102 out of 138
Neff          4.9 
Searched_HMMs 46136
Date          Fri Aug 16 18:13:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy17940.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/17940hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07718 Coatamer_beta_C:  Coat  99.0 1.9E-10 4.2E-15   80.2   2.7   48   24-81      1-48  (140)
  2 KOG1058|consensus               98.9   5E-10 1.1E-14   94.8   3.1   72    1-81    642-713 (948)
  3 PF05186 Dpy-30:  Dpy-30 motif;  20.7      22 0.00049   19.8  -0.7   10   23-32     24-33  (42)
  4 smart00394 RIIa RIIalpha, Regu  20.0      27 0.00058   18.6  -0.5   10   22-31     16-25  (38)
  5 PF02197 RIIa:  Regulatory subu  15.5      32  0.0007   18.6  -0.8   10   23-32     17-26  (38)
  6 PF05662 YadA_stalk:  Coiled st  14.1      69  0.0015   15.7   0.2   12   23-34     10-21  (21)
  7 PF13257 DUF4048:  Domain of un  13.6 1.3E+02  0.0027   23.1   1.6   17   48-64     99-115 (253)
  8 PRK13895 conjugal transfer pro  13.0      76  0.0016   22.5   0.3   18   17-34     14-31  (144)
  9 PF12196 hNIFK_binding:  FHA Ki   5.6   3E+02  0.0065   15.6   0.7    8   26-33     32-39  (41)
 10 PF03683 UPF0175:  Uncharacteri   5.3 2.8E+02   0.006   16.7   0.5   30   27-56     47-76  (76)

No 1  
>PF07718 Coatamer_beta_C:  Coatomer beta C-terminal region;  InterPro: IPR011710 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.  This entry represents the C-terminal domain of the beta subunit from coatomer proteins (Beta-coat proteins). The C-terminal domain probably adapts the function of the N-terminal IPR002553 from INTERPRO domain. Coatomer protein complex I (COPI)-coated vesicles are involved in transport between the endoplasmic reticulum and the Golgi but also participate in transport from early to late endosomes within the endocytic pathway [].  More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat
Probab=99.00  E-value=1.9e-10  Score=80.24  Aligned_cols=48  Identities=40%  Similarity=0.481  Sum_probs=37.5

Q ss_pred             CCCCceeecccccccCCCCCCchhhhHhHHHHHhccCCCcccccccCCCccccccCCC
Q psy17940         24 QPDDPISFLELSSARGSEFGGTENVFELSLNQALIGSGPAAAQTQAADPSGASKLNKM   81 (81)
Q Consensus        24 Q~DD~I~FrQL~~~~~~~~~~~ed~~e~dL~~A~g~~~~~~~~~~~~~~~~~SKLnKV   81 (81)
                      ||||+|+||||+++  ......++++++||.+|+|...     ..   ..+.|||+||
T Consensus         1 q~D~~i~f~ql~~~--~~~~~~~~~~~~dl~~a~g~~~-----~~---~~~~skL~kv   48 (140)
T PF07718_consen    1 QPDDLISFRQLKGK--KALSGDEDDFEDDLSRATGSID-----KS---EDFSSKLNKV   48 (140)
T ss_pred             CCCCcEeheccccC--ccccccchhhhhhHHHhhCCcc-----cc---chhhhhhccE
Confidence            89999999999887  4444455789999999998543     23   4557999986


No 2  
>KOG1058|consensus
Probab=98.93  E-value=5e-10  Score=94.78  Aligned_cols=72  Identities=38%  Similarity=0.421  Sum_probs=52.6

Q ss_pred             CchhhhHHHHHhhhhhhCCCCCCCCCCceeecccccccCCCCCCchhhhHhHHHHHhccCCCcccccccCCCccccccCC
Q psy17940          1 MLEAKSQEEASTQKAKEKPGHKVQPDDPISFLELSSARGSEFGGTENVFELSLNQALIGSGPAAAQTQAADPSGASKLNK   80 (81)
Q Consensus         1 mL~ak~~e~~~~~k~~~~~~~~vQ~DD~I~FrQL~~~~~~~~~~~ed~~e~dL~~A~g~~~~~~~~~~~~~~~~~SKLnK   80 (81)
                      |+.++..+++...+. +..+..+||||||+|+||++.  .+....+|.|++||.+|+|...     ... +.+.+|||+|
T Consensus       642 m~~~~~~~~~~~~~~-~~~~~~~~~ddpI~f~q~~~~--~s~~~~en~fe~~L~~A~g~~~-----~~~-~~s~~sKL~k  712 (948)
T KOG1058|consen  642 MIDAKKKRRKEELLK-KSQKTTAQPDDPINFRQLRSG--RSDERGENQFEEDLVQATGDAQ-----KAE-DGSPASKLNK  712 (948)
T ss_pred             HhhHHHHHHHHHHHh-hhccccCCCCCccchHhhccc--chhhhhhhHHHHHHHHHhcccc-----ccc-cCCcHHHhhc
Confidence            566766666654444 567788999999999999864  3434478899999999999664     332 2333799999


Q ss_pred             C
Q psy17940         81 M   81 (81)
Q Consensus        81 V   81 (81)
                      |
T Consensus       713 V  713 (948)
T KOG1058|consen  713 V  713 (948)
T ss_pred             e
Confidence            7


No 3  
>PF05186 Dpy-30:  Dpy-30 motif;  InterPro: IPR007858 This motif is about 40 residues long and is probably formed of two alpha-helices. It is found in the Dpy-30 proteins, hence the motifs name. Dpy-30 from Caenorhabditis elegans is an essential component of dosage compensation machinery and loss of dpy-30 activity results in XX-specific lethality; in XO animals, Dpy-30 is required for developmental processes other than dosage compensation []. In yeast, the homologue of DPY-30, Saf19p, functions as part of the Set1 complex that is necessary for the methylation of histone H3 at lysine residue 4; Set1 is a key part of epigenetic developmental control []. There is also a human homologue of Dpy-30 []. This Dpy-30 region may be a dimerisation motif analogous that found in the cAMP-dependent protein kinase regulator, type II PKA, R subunit IPR003117 from INTERPRO.; PDB: 3G36_D.
Probab=20.71  E-value=22  Score=19.79  Aligned_cols=10  Identities=60%  Similarity=1.245  Sum_probs=6.6

Q ss_pred             CCCCCceeec
Q psy17940         23 VQPDDPISFL   32 (81)
Q Consensus        23 vQ~DD~I~Fr   32 (81)
                      .+|+|||.|.
T Consensus        24 ~rP~DPi~~L   33 (42)
T PF05186_consen   24 ERPEDPIEFL   33 (42)
T ss_dssp             H--SSHHHHH
T ss_pred             HCCCChHHHH
Confidence            5789999885


No 4  
>smart00394 RIIa RIIalpha, Regulatory subunit portion of type II PKA R-subunit. RIIalpha, Regulatory subunit portion of type II PKA R-subunit. Contains dimerisation interface and binding site for A-kinase-anchoring proteins (AKAPs).
Probab=19.96  E-value=27  Score=18.55  Aligned_cols=10  Identities=40%  Similarity=0.876  Sum_probs=7.9

Q ss_pred             CCCCCCceee
Q psy17940         22 KVQPDDPISF   31 (81)
Q Consensus        22 ~vQ~DD~I~F   31 (81)
                      ..||+|+|.|
T Consensus        16 ~~qP~d~~~f   25 (38)
T smart00394       16 RAQPSDLVQF   25 (38)
T ss_pred             HHCCCcHHHH
Confidence            3589999977


No 5  
>PF02197 RIIa:  Regulatory subunit of type II PKA R-subunit;  InterPro: IPR003117 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases [].  In the absence of cAMP, Protein Kinase A (PKA) exists as an equimolar tetramer of regulatory (R) and catalytic (C) subunits []. In addition to its role as an inhibitor of the C subunit, the R subunit anchors the holoenzyme to specific intracellular locations and prevents the C subunit from entering the nucleus. All R subunits have a conserved domain structure consisting of the N-terminal dimerization domain, inhibitory region, cAMP-binding domain A and cAMP-binding domain B. R subunits interact with C subunits primarily through the inhibitory site. The cAMP-binding domains show extensive sequence similarity and bind cAMP cooperatively.  Two types of regulatory (R) subunits exist - types I and I - which differ in molecular weight, sequence, autophosphorylation cabaility, cellular location and tissue distribution. Types I and II were further sub-divided into alpha and beta subtypes, based mainly on sequence similarity. This entry represents types I-alpha, I-beta, II-alpha and II-beta regulatory subunits of PKA proteins. These subunits contain the dimerisation interface and binding site for A-kinase-anchoring proteins (AKAPs).; GO: 0008603 cAMP-dependent protein kinase regulator activity, 0007165 signal transduction; PDB: 2IZY_E 1R2A_A 1L6E_A 2IZX_B 2KYG_A 2EZW_B 3IM4_B 3IM3_A 4F9K_C 2HWN_B ....
Probab=15.47  E-value=32  Score=18.61  Aligned_cols=10  Identities=50%  Similarity=0.800  Sum_probs=4.9

Q ss_pred             CCCCCceeec
Q psy17940         23 VQPDDPISFL   32 (81)
Q Consensus        23 vQ~DD~I~Fr   32 (81)
                      .||+|++.|-
T Consensus        17 ~qP~Di~~F~   26 (38)
T PF02197_consen   17 EQPDDILQFA   26 (38)
T ss_dssp             H--S-HHHHH
T ss_pred             HCCCcHHHHH
Confidence            4889988763


No 6  
>PF05662 YadA_stalk:  Coiled stalk of trimeric autotransporter adhesin;  InterPro: IPR008635 This short motif is found in invasins and haemagglutinins, normally associated with the Hep_Hag repeat (IPR008640 from INTERPRO).; GO: 0009405 pathogenesis, 0019867 outer membrane; PDB: 3NTN_A 3PR7_A 1P9H_A 3D9X_A 3LAA_A 3LA9_A 3EMO_C.
Probab=14.13  E-value=69  Score=15.75  Aligned_cols=12  Identities=17%  Similarity=0.354  Sum_probs=8.0

Q ss_pred             CCCCCceeeccc
Q psy17940         23 VQPDDPISFLEL   34 (81)
Q Consensus        23 vQ~DD~I~FrQL   34 (81)
                      +..-|.++|.||
T Consensus        10 ~~~tDAVN~~QL   21 (21)
T PF05662_consen   10 TNDTDAVNVSQL   21 (21)
T ss_dssp             TTTTSB-BHHHH
T ss_pred             CCCccceecccC
Confidence            355688888887


No 7  
>PF13257 DUF4048:  Domain of unknown function (DUF4048)
Probab=13.63  E-value=1.3e+02  Score=23.08  Aligned_cols=17  Identities=29%  Similarity=0.503  Sum_probs=14.4

Q ss_pred             hhHhHHHHHhccCCCcc
Q psy17940         48 VFELSLNQALIGSGPAA   64 (81)
Q Consensus        48 ~~e~dL~~A~g~~~~~~   64 (81)
                      .|-+||-|||-|+.+|.
T Consensus        99 TFvEDIRQATVGDEpIn  115 (253)
T PF13257_consen   99 TFVEDIRQATVGDEPIN  115 (253)
T ss_pred             HHHHHHHHhhccccccC
Confidence            68999999999997553


No 8  
>PRK13895 conjugal transfer protein TraM; Provisional
Probab=12.97  E-value=76  Score=22.50  Aligned_cols=18  Identities=44%  Similarity=0.591  Sum_probs=15.6

Q ss_pred             hCCCCCCCCCCceeeccc
Q psy17940         17 EKPGHKVQPDDPISFLEL   34 (81)
Q Consensus        17 ~~~~~~vQ~DD~I~FrQL   34 (81)
                      .+++.++-.||||...|-
T Consensus        14 ~KHGIal~rDDPILilqT   31 (144)
T PRK13895         14 AKHGIAVGRDDPILILQT   31 (144)
T ss_pred             HHcCcccCCCCCchhHHH
Confidence            478889999999998876


No 9  
>PF12196 hNIFK_binding:  FHA Ki67 binding domain of hNIFK;  InterPro: IPR021043  This entry represents eukaryotic proteins that contain a domain of approximately 40 amino acids in length. These proteins are found in association with PF00076 from PFAM. There are two conserved sequence motifs: TPVCTP and LERRKS. This domain is found on the human nucleolar protein hNIFK. It binds to the fork-head-associated domain of human Ki67. High-affinity binding requires sequential phosphorylation by two kinases, CDK1 and GSK3, yielding pThr238, pThr234 and pSer230. This interaction is involved in cell cycle regulation []. ; PDB: 2AFF_B.
Probab=5.56  E-value=3e+02  Score=15.63  Aligned_cols=8  Identities=50%  Similarity=0.771  Sum_probs=5.8

Q ss_pred             CCceeecc
Q psy17940         26 DDPISFLE   33 (81)
Q Consensus        26 DD~I~FrQ   33 (81)
                      ||-|.|.|
T Consensus        32 D~EIv~K~   39 (41)
T PF12196_consen   32 DDEIVFKQ   39 (41)
T ss_dssp             S-SEEESS
T ss_pred             CCeeEecc
Confidence            78899986


No 10 
>PF03683 UPF0175:  Uncharacterised protein family (UPF0175);  InterPro: IPR005368 This entry contains small proteins of unknown function.
Probab=5.32  E-value=2.8e+02  Score=16.74  Aligned_cols=30  Identities=33%  Similarity=0.381  Sum_probs=16.6

Q ss_pred             CceeecccccccCCCCCCchhhhHhHHHHH
Q psy17940         27 DPISFLELSSARGSEFGGTENVFELSLNQA   56 (81)
Q Consensus        27 D~I~FrQL~~~~~~~~~~~ed~~e~dL~~A   56 (81)
                      ....|.++-+.+|-....++++++.||..|
T Consensus        47 s~~eF~~~L~~~gI~~~~~~eel~~dle~a   76 (76)
T PF03683_consen   47 SRWEFLELLKERGIPINYDEEELEEDLETA   76 (76)
T ss_pred             CHHHHHHHHHHCCCCCCCCHHHHHHHHHhC
Confidence            346677774442333344566777777543


Done!