Diaphorina citri psyllid: psy17942


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MSFLPKEERTKCWSARDKYWECLDSHEGNADSCKEFRTSYEQFCPGQWVKHFDRRYHFLKFKNKIETEGFEKFDSKQEYELPKGKSKAKT
cccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHcccccccccccc
*****KEERTKCWSARDKYWECLDSHEGNADSCKEFRTSYEQFCPGQWVKHFDRRYHFLKFKNKIETE**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFLPKEERTKCWSARDKYWECLDSHEGNADSCKEFRTSYEQFCPGQWVKHFDRRYHFLKFKNKIETEGFEKFDSKQEYELPKGKSKAKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c oxidase assembly factor 6 homolog confidentQ8BGD8
Cytochrome c oxidase subunit 6B-like protein new16 confidentG2TRP6
Cytochrome c oxidase assembly factor 6 homolog confidentQ2M2S5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004129 [MF]cytochrome-c oxidase activityprobableGO:0022891, GO:0022890, GO:0022892, GO:0005215, GO:0008324, GO:0022857, GO:0015075, GO:0003824, GO:0015077, GO:0016676, GO:0016675, GO:0003674, GO:0015078, GO:0015002, GO:0016491
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V54, chain H
Confidence level:very confident
Coverage over the Query: 1-65
View the alignment between query and template
View the model in PyMOL