BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy17946
         (223 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2L5S|A Chain A, Solution Structure Of The Extracellular Domain Of The
           Tgf-Beta Type I Receptor
          Length = 88

 Score = 30.4 bits (67), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 11/51 (21%), Positives = 26/51 (50%)

Query: 105 VVDNPLRFQDYNIVPRTQPLPNLPEGPHHVLSANYYVNRDGSHEVKPPATL 155
           V+ N +   + +++PR +P    P      ++  Y  N+D  ++++ P T+
Sbjct: 37  VIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTV 87


>pdb|3KFD|I Chain I, Ternary Complex Of Tgf-B1 Reveals Isoform-Specific Ligand
           Re And Receptor Recruitment In The Superfamily
 pdb|3KFD|J Chain J, Ternary Complex Of Tgf-B1 Reveals Isoform-Specific Ligand
           Re And Receptor Recruitment In The Superfamily
 pdb|3KFD|K Chain K, Ternary Complex Of Tgf-B1 Reveals Isoform-Specific Ligand
           Re And Receptor Recruitment In The Superfamily
 pdb|3KFD|L Chain L, Ternary Complex Of Tgf-B1 Reveals Isoform-Specific Ligand
           Re And Receptor Recruitment In The Superfamily
          Length = 85

 Score = 30.0 bits (66), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 11/51 (21%), Positives = 26/51 (50%)

Query: 105 VVDNPLRFQDYNIVPRTQPLPNLPEGPHHVLSANYYVNRDGSHEVKPPATL 155
           V+ N +   + +++PR +P    P      ++  Y  N+D  ++++ P T+
Sbjct: 35  VIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTV 85


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.137    0.420 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,643,212
Number of Sequences: 62578
Number of extensions: 260896
Number of successful extensions: 393
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 391
Number of HSP's gapped (non-prelim): 2
length of query: 223
length of database: 14,973,337
effective HSP length: 95
effective length of query: 128
effective length of database: 9,028,427
effective search space: 1155638656
effective search space used: 1155638656
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)