BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy180
(77 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2NV4|A Chain A, Crystal Structure Of Upf0066 Protein Af0241 In Complex
With S-Adenosylmethionine. Northeast Structural
Genomics Consortium Target Gr27
pdb|2NV4|B Chain B, Crystal Structure Of Upf0066 Protein Af0241 In Complex
With S-Adenosylmethionine. Northeast Structural
Genomics Consortium Target Gr27
Length = 147
Score = 26.6 bits (57), Expect = 3.7, Method: Compositional matrix adjust.
Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
Query: 24 LQSFATIVNPDGKMSDATIKARFTQAVSELQFLGFIKNCKQKID---HVSRLTWGD 76
L+ + +P +DA + RF+ AVSE+ + KI+ H+ L W D
Sbjct: 3 LKPIGVVKSPFKTQNDAPRQGRFSDAVSEIAIFDEYADGLHKIENLRHIIVLYWXD 58
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.131 0.398
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,992,406
Number of Sequences: 62578
Number of extensions: 53359
Number of successful extensions: 168
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 167
Number of HSP's gapped (non-prelim): 2
length of query: 77
length of database: 14,973,337
effective HSP length: 46
effective length of query: 31
effective length of database: 12,094,749
effective search space: 374937219
effective search space used: 374937219
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)