Diaphorina citri psyllid: psy18026


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MSRRRRPQRRRRHRPPALSRTSSFSSITDSSMSLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDPGAWVAHTAAIRGDGFPLRPPSVSTLTSTSSSLTSSIAETEKAFEELSLTINTDMATIVRVMARPESGLEIRDRMWLKITIPNAFIGKCERIIFIYSCEP
cccccccccccccccccccccccccccccccccEEEEEEEEEccccccccEEEEccccccccccEEEEEEccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHccccccccccccEEEEccccccECccccEEEEEEEccc
********************************SLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDPGAWVAHTAAIRGDGF*****************************ELSLTINTDMATIVRVMARPESGLEIRDRMWLKITIPNAFIGKCERIIFIYSCEP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRRRRPQRRRRHRPPALSRTSSFSSITDSSMSLNIITVTLNMDTVNFLGISIVGQSNKGGDGGIYVGSIMKGGAVALDGRIEPGDMILQVNDINFENMSNDEAVRVLREVVQKPGPIKLVVAKCWDPNPKGYFTIPRTEPVRPIDPGAWVAHTAAIRGDGFPLRPPSVSTLTSTSSSLTSSIAETEKAFEELSLTINTDMATIVRVMARPESGLEIRDRMWLKITIPNAFIGKCERIIFIYSCEP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Segment polarity protein dishevelled Required to establish coherent arrays of polarized cells and segments in embryos. Plays a role in wingless (wg) signaling, possibly through the reception of the wg signal by target cells and subsequent redistribution of arm protein in response to that signal in embryos. This signal seems to be required to establish planar cell polarity and identity.confidentP51140
Segment polarity protein dishevelled homolog DVL-2 Involved in at least 2 independent signaling cascades, controlling cell fate via canonical Wnt signaling and cell polarity via a planar cell polarity (PCP) cascade. Acts synergistically with dal/dapple-like to activate Wnt signaling, stabilizing ctnnb1/beta-catenin and leading to dorsal axis formation. Also prevents degradation of ctnnb1/beta-catenin by displacing gsk3 from a complex with ARP/Axin-related protein. Has an additional role in anterior-posterior (A/P) axis formation, specifying different neuroectodermal cell fates along the A/P axis in a dose-dependent manner by activating several early patterning genes. In the PCP pathway, required at the cell membrane for PCP-mediated neural and mesodermal convergent extension during gastrulation and subsequent neural tube closure, acting to activate jnk. Also involved in blastopore closure and archenteron elongation during early, but not late, gastrulation. Associates with ephrin receptors and ligands and acts as part of a downstream PCP pathway to mediate ephrin-mediated cell repulsion via activation of rhoa. Required for efnb1/ephrin-B1-driven movement of non-retinal progenitor cells into the retina during eye field formation. Patterns the hindbrain. Required for ciliogenesis. Controls the docking of basal bodies to the apical plasma membrane; mediates the activation, but not localization of rhoa at the apical surface of ciliated cells during basal body docking. Furthermore, required for the association of basal bodies with membrane-bound vesicles and the vesicle-trafficking protein exoc4/sec8, and this association is in turn required for basal body docking. Once basal bodies are docked, required for the planar polarization of basal bodies that underlies ciliary beating and the directional fluid flow across ciliated epithelia.confidentQ05AS8
Segment polarity protein dishevelled homolog DVL-2 Participates in Wnt signaling by binding to the cytoplasmic C-terminus of frizzled family members and transducing the Wnt signal to down-stream effectors. Promotes internalization and degradation of frizzled proteins upon Wnt signaling. Plays a role both in canonical and non-canonical Wnt signaling. Plays a role in the signal transduction pathways mediated by multiple Wnt genes.confidentQ60838

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070300 [MF]phosphatidic acid bindingconfidentGO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0048106 [BP]establishment of thoracic bristle planar orientationprobableGO:0007164, GO:0048104, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0008407, GO:0048513, GO:0048729, GO:0032502, GO:0009887, GO:0032501, GO:0060429, GO:0009888, GO:0044767, GO:0022416, GO:0008150, GO:0001736, GO:0007423, GO:0044707, GO:0048856, GO:0001738, GO:0048731
GO:0090163 [BP]establishment of epithelial cell planar polarityprobableGO:0009987, GO:0090162, GO:0007163, GO:0044763, GO:0030010, GO:0008150, GO:0044699
GO:0060914 [BP]heart formationprobableGO:0032502, GO:0007507, GO:0009887, GO:0032501, GO:0044707, GO:0008150, GO:0048513, GO:0048856, GO:0007275, GO:0003007, GO:0072359, GO:0072358, GO:0044767, GO:0044699, GO:0048731, GO:0009653, GO:0048645, GO:0048646
GO:0035019 [BP]somatic stem cell maintenanceprobableGO:0030154, GO:0048468, GO:0050789, GO:0044699, GO:0048863, GO:0048864, GO:0048869, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0044767, GO:0045596, GO:0045595, GO:0008150, GO:0051093, GO:0019827, GO:0044707, GO:0048856, GO:0044763, GO:0048523
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054
GO:0030032 [BP]lamellipodium assemblyprobableGO:0022607, GO:0030030, GO:0030031, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0048675 [BP]axon extensionprobableGO:0032502, GO:0044707, GO:0048589, GO:0048588, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000902, GO:0000904, GO:0016049, GO:0040007, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0060560, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0022008, GO:0048858, GO:0048699, GO:0032990, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0031290 [BP]retinal ganglion cell axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0007435 [BP]salivary gland morphogenesisprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0007431, GO:0048856, GO:0044767, GO:0035272, GO:0008150, GO:0048731, GO:0022612, GO:0048732, GO:0009653, GO:0007275, GO:0044699
GO:0048730 [BP]epidermis morphogenesisprobableGO:0032502, GO:0009887, GO:0008544, GO:0044707, GO:0032501, GO:0048856, GO:0009888, GO:0044767, GO:0048513, GO:0008150, GO:0048729, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0001737 [BP]establishment of imaginal disc-derived wing hair orientationprobableGO:0048563, GO:0030030, GO:0030154, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0007164, GO:0009653, GO:0035316, GO:0007275, GO:0044699, GO:0035315, GO:0002009, GO:0008544, GO:0007472, GO:0048869, GO:0007552, GO:0007476, GO:0016043, GO:0035317, GO:0048569, GO:0048513, GO:0071840, GO:0048729, GO:0030855, GO:0032502, GO:0048707, GO:0009886, GO:0030182, GO:0060429, GO:0009888, GO:0035114, GO:0001738, GO:0008150, GO:0048731, GO:0022008, GO:0001736, GO:0044767, GO:0048699, GO:0007399, GO:0044707, GO:0007444, GO:0009913, GO:0048856, GO:0007560, GO:0044763, GO:0009987, GO:0048736, GO:0048737
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0032231 [BP]regulation of actin filament bundle assemblyprobableGO:0033043, GO:0032970, GO:0051493, GO:0050794, GO:0044087, GO:0065007, GO:0032956, GO:0008150, GO:0051128, GO:0050789
GO:0035159 [BP]regulation of tube length, open tracheal systemprobableGO:0035150, GO:0035151, GO:0035152, GO:0032501, GO:0044707, GO:0007424, GO:0060541, GO:0048856, GO:0090066, GO:0032502, GO:0065007, GO:0048731, GO:0008150, GO:0065008, GO:0007275, GO:0044699
GO:0035309 [BP]wing and notum subfield formationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0007444, GO:0048856, GO:0035220, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007275, GO:0044699
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0048076 [BP]regulation of compound eye pigmentationprobableGO:0050793, GO:0048073, GO:0048070, GO:0065007, GO:0008150, GO:0050789
GO:0007298 [BP]border follicle cell migrationprobableGO:0048610, GO:0048870, GO:0030154, GO:0048468, GO:0019953, GO:0006928, GO:0007292, GO:0051674, GO:0007297, GO:0001667, GO:0044699, GO:0000003, GO:0048869, GO:0030707, GO:0051179, GO:0007276, GO:0016477, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0090132, GO:0090130, GO:0040011, GO:0044702, GO:0010631, GO:0044707, GO:0003006, GO:0048856, GO:0044763
GO:0008585 [BP]female gonad developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0008406, GO:0045137, GO:0044767, GO:0003006, GO:0048513, GO:0008150, GO:0048731, GO:0046545, GO:0046660, GO:0007275, GO:0044699
GO:0046847 [BP]filopodium assemblyprobableGO:0022607, GO:0030030, GO:0030031, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0045198 [BP]establishment of epithelial cell apical/basal polarityprobableGO:0061245, GO:0030154, GO:0045197, GO:0007163, GO:0030010, GO:0009653, GO:0044699, GO:0002009, GO:0035088, GO:0035089, GO:0048869, GO:0090162, GO:0061162, GO:0048729, GO:0030855, GO:0030859, GO:0032502, GO:0009987, GO:0061339, GO:0060429, GO:0009888, GO:0044767, GO:0001738, GO:0044763, GO:0048856, GO:0008150
GO:0007394 [BP]dorsal closure, elongation of leading edge cellsprobableGO:0022604, GO:0032502, GO:0016331, GO:0051239, GO:0048589, GO:0022603, GO:0051128, GO:0009790, GO:0009792, GO:0009653, GO:0007275, GO:0044699, GO:0009826, GO:0001700, GO:0016049, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0065007, GO:0071840, GO:0048729, GO:0016476, GO:0060560, GO:0048598, GO:0060429, GO:0002009, GO:0050793, GO:0032501, GO:0009987, GO:0009888, GO:0050794, GO:0044767, GO:0008360, GO:0044763, GO:0045995, GO:0040007, GO:0065008, GO:0044707, GO:0048856, GO:0007392, GO:0007391, GO:0050789, GO:2000026, GO:0008150
GO:0003136 [BP]negative regulation of heart induction by canonical Wnt receptor signaling pathwayprobableGO:0016055, GO:0009997, GO:0009996, GO:0023057, GO:0072359, GO:0072358, GO:0023052, GO:0010648, GO:0007166, GO:0023051, GO:2000736, GO:0051890, GO:0050789, GO:0044699, GO:1901320, GO:0010646, GO:0003306, GO:0090381, GO:0007275, GO:0048513, GO:0065007, GO:0048519, GO:0061311, GO:0042686, GO:0061316, GO:0032502, GO:0032501, GO:0044700, GO:0050793, GO:0009987, GO:0051716, GO:0050794, GO:0044767, GO:0060070, GO:0045595, GO:0042659, GO:0051239, GO:0048731, GO:0007154, GO:0048856, GO:0051093, GO:0007507, GO:2000043, GO:2000044, GO:0044707, GO:0045596, GO:0050896, GO:0010453, GO:0010454, GO:0044763, GO:2000026, GO:0008150, GO:0048523, GO:0007165
GO:0003151 [BP]outflow tract morphogenesisprobableGO:0032502, GO:0044767, GO:0009887, GO:0032501, GO:0044707, GO:0007507, GO:0048513, GO:0048856, GO:0003007, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0001843 [BP]neural tube closureprobableGO:0032502, GO:0016331, GO:0035148, GO:0009790, GO:0072175, GO:0009792, GO:0021915, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0001841, GO:0060562, GO:0043009, GO:0048646, GO:0048598, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0060606, GO:0008150, GO:0035295, GO:0001838, GO:0014020, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048731
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0032091 [BP]negative regulation of protein bindingprobableGO:0051098, GO:0051100, GO:0008150, GO:0065007, GO:0044092, GO:0043393, GO:0065009
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0071340 [BP]skeletal muscle acetylcholine-gated channel clusteringprobableGO:0050808, GO:0048869, GO:0030154, GO:0048468, GO:0061024, GO:0014706, GO:0008104, GO:0051146, GO:0061061, GO:0007275, GO:0044699, GO:0007517, GO:0070727, GO:0001941, GO:0007519, GO:0016043, GO:0048513, GO:0071840, GO:0033036, GO:0032502, GO:0055001, GO:0055002, GO:0034613, GO:0048741, GO:0032501, GO:0009987, GO:0009888, GO:0048747, GO:0048731, GO:0007528, GO:0044763, GO:0072657, GO:0060537, GO:0051179, GO:0051641, GO:0044767, GO:0044707, GO:0048856, GO:0016044, GO:0060538, GO:0008150, GO:0043113, GO:0042692
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0016328 [CC]lateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0060029 [BP]convergent extension involved in organogenesisprobableGO:0032502, GO:0002009, GO:0048856, GO:0060026, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0006469 [BP]negative regulation of protein kinase activityprobableGO:0033673, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0009892, GO:0043086, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0050789, GO:0065007, GO:0044092, GO:0048519, GO:0065009, GO:0045859, GO:0045936, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0051348, GO:0042325, GO:0032269, GO:0042326, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0048365 [MF]Rac GTPase bindingprobableGO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0017048, GO:0005515, GO:0005488
GO:0090179 [BP]planar cell polarity pathway involved in neural tube closureprobableGO:0090178, GO:0051239, GO:0022603, GO:0023052, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0051716, GO:0065007, GO:0050793, GO:0009987, GO:0050794, GO:0060071, GO:0044763, GO:0045995, GO:0007154, GO:0035567, GO:0044700, GO:0090175, GO:0050896, GO:0016055, GO:0051960, GO:2000026, GO:2000027, GO:0008150
GO:0005112 [MF]Notch bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0044340 [BP]canonical Wnt receptor signaling pathway involved in regulation of cell proliferationprobableGO:0042127, GO:0044700, GO:0051716, GO:0009987, GO:0050896, GO:0016055, GO:0044763, GO:0050794, GO:0008150, GO:0060070, GO:0065007, GO:0007165, GO:0007166, GO:0007154, GO:0023052, GO:0050789, GO:0044699
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0090263 [BP]positive regulation of canonical Wnt receptor signaling pathwayprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0030111, GO:0050794, GO:0023056, GO:0030177, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0060828, GO:0048522
GO:0005109 [MF]frizzled bindingprobableGO:0001664, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0045202 [CC]synapseprobableGO:0005575
GO:0007464 [BP]R3/R4 cell fate commitmentprobableGO:0046552, GO:0032502, GO:0030154, GO:0007163, GO:0007164, GO:0009653, GO:0042706, GO:0044699, GO:0002009, GO:0001745, GO:0048869, GO:0007275, GO:0008150, GO:0048513, GO:0048729, GO:0032501, GO:0048749, GO:0009887, GO:0060429, GO:0048663, GO:0030182, GO:0042067, GO:0048592, GO:0009987, GO:0009888, GO:0044767, GO:0048056, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0001736, GO:0001752, GO:0048699, GO:0045165, GO:0044707, GO:0007423, GO:0048856, GO:0007399, GO:0046530, GO:0001738, GO:0044763
GO:0046875 [MF]ephrin receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0035253 [CC]ciliary rootletprobableGO:0005856, GO:0005575, GO:0043228, GO:0043231, GO:0043232, GO:0031514, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0044422, GO:0044441
GO:0048013 [BP]ephrin receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699
GO:0008013 [MF]beta-catenin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0090103 [BP]cochlea morphogenesisprobableGO:0032502, GO:0048562, GO:0048568, GO:0009790, GO:0009653, GO:0007275, GO:0044699, GO:0090102, GO:0048513, GO:0043583, GO:0048598, GO:0009887, GO:0032501, GO:0044767, GO:0008150, GO:0042471, GO:0048839, GO:0042472, GO:0044707, GO:0007423, GO:0048856, GO:0048731
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0038031 [BP]non-canonical Wnt receptor signaling pathway via JNK cascadeprobableGO:0038030, GO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0044699, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0035567
GO:0043507 [BP]positive regulation of JUN kinase activityprobableGO:0080135, GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0023056, GO:0043406, GO:0043405, GO:0051174, GO:0046328, GO:0043506, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0023051, GO:0060255, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0070302, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0032872, GO:0032268, GO:0008150, GO:0042325, GO:0043410, GO:0042327, GO:0001932, GO:0080134, GO:0031401, GO:0051338, GO:0045860, GO:0001934, GO:0048522
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000226 [BP]microtubule cytoskeleton organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0048668 [BP]collateral sproutingprobableGO:0032502, GO:0044707, GO:0048589, GO:0048588, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000902, GO:0000904, GO:0016049, GO:0040007, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0060560, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0022008, GO:0048858, GO:0048699, GO:0032990, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0016318 [BP]ommatidial rotationprobableGO:0048749, GO:0060429, GO:0007163, GO:0007164, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0001745, GO:0008150, GO:0048513, GO:0048729, GO:0032502, GO:0009887, GO:0032501, GO:0002009, GO:0042067, GO:0048592, GO:0009987, GO:0009888, GO:0044767, GO:0001738, GO:0001654, GO:0048731, GO:0001736, GO:0007423, GO:0044707, GO:0048856, GO:0044763
GO:0043621 [MF]protein self-associationprobableGO:0003674, GO:0005488, GO:0005515
GO:0051091 [BP]positive regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:0044093, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0031329 [BP]regulation of cellular catabolic processprobableGO:0009894, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0030136 [CC]clathrin-coated vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0031982
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0004871 [MF]signal transducer activityprobableGO:0060089, GO:0003674

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XKX, chain A
Confidence level:very confident
Coverage over the Query: 31-126
View the alignment between query and template
View the model in PyMOL
Template: 1FSH, chain A
Confidence level:very confident
Coverage over the Query: 192-241
View the alignment between query and template
View the model in PyMOL