Query         psy18027
Match_columns 165
No_of_seqs    169 out of 1054
Neff          6.0 
Searched_HMMs 46136
Date          Fri Aug 16 20:37:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy18027.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/18027hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00894 PI3Kc_IB_gamma Phospho 100.0 1.6E-43 3.4E-48  308.8  10.0  151    1-152   179-345 (365)
  2 cd05165 PI3Kc_I Phosphoinositi 100.0 7.3E-43 1.6E-47  304.9  10.5  151    1-152   179-346 (366)
  3 cd05177 PI3Kc_C2_gamma Phospho 100.0 1.1E-42 2.3E-47  302.7  10.3  151    1-152   170-335 (354)
  4 cd00891 PI3Kc Phosphoinositide 100.0 1.1E-42 2.3E-47  302.8   9.3  151    1-152   170-333 (352)
  5 cd00895 PI3Kc_C2_beta Phosphoi 100.0 3.5E-42 7.7E-47  299.2  10.9  152    1-153   170-336 (354)
  6 cd00893 PI4Kc_III Phosphoinosi 100.0 5.5E-42 1.2E-46  291.5  11.2  151    1-152   104-267 (289)
  7 cd05176 PI3Kc_C2_alpha Phospho 100.0 3.9E-42 8.4E-47  298.8   9.9  151    1-152   169-334 (353)
  8 cd05166 PI3Kc_II Phosphoinosit 100.0 7.3E-42 1.6E-46  297.6  10.9  151    1-152   169-334 (353)
  9 cd05168 PI4Kc_III_beta Phospho 100.0 9.9E-42 2.1E-46  290.5  10.4  150    1-152   107-271 (293)
 10 cd05174 PI3Kc_IA_delta Phospho 100.0 9.2E-42   2E-46  297.3  10.4  153    1-155   176-344 (361)
 11 cd05175 PI3Kc_IA_alpha Phospho 100.0   1E-41 2.2E-46  297.1  10.3  150    1-152   179-346 (366)
 12 cd05167 PI4Kc_III_alpha Phosph 100.0 1.8E-41   4E-46  290.8  10.4  151    1-152   125-289 (311)
 13 cd05173 PI3Kc_IA_beta Phosphoi 100.0 4.6E-41   1E-45  293.2  10.3  150    2-153   177-342 (362)
 14 cd00896 PI3Kc_III Phosphoinosi 100.0 1.7E-40 3.8E-45  288.7   9.9  147    1-152   165-329 (350)
 15 cd05172 PIKKc_DNA-PK DNA-depen 100.0 2.3E-40   5E-45  274.1   9.9  122    1-124   103-229 (235)
 16 cd05169 PIKKc_TOR TOR (Target  100.0 4.1E-40 8.8E-45  277.6   9.5  122    1-124   148-274 (280)
 17 cd05171 PIKKc_ATM Ataxia telan 100.0 7.7E-39 1.7E-43  270.5   9.9  121    1-124   148-273 (279)
 18 cd00892 PIKKc_ATR ATR (Ataxia  100.0 1.7E-38 3.6E-43  263.2  10.3  121    1-124   106-231 (237)
 19 cd05164 PIKKc Phosphoinositide 100.0 3.8E-38 8.3E-43  258.7  10.6  111    1-114    98-208 (222)
 20 cd05170 PIKKc_SMG1 Suppressor  100.0 7.5E-38 1.6E-42  267.7  10.9  121    1-124   176-301 (307)
 21 smart00146 PI3Kc Phosphoinosit 100.0 1.4E-37   3E-42  251.2  11.6  111    1-114    68-178 (202)
 22 cd05163 TRRAP TRansformation/t 100.0   1E-37 2.2E-42  260.7  10.4  122    1-124   121-247 (253)
 23 cd00142 PI3Kc_like Phosphoinos 100.0 3.3E-37 7.2E-42  251.9  11.0  111    1-114    95-205 (219)
 24 KOG0904|consensus              100.0   4E-36 8.6E-41  279.8   4.0  150    1-151   890-1056(1076)
 25 KOG0890|consensus              100.0 7.7E-35 1.7E-39  289.3  10.3  121    1-124  2186-2311(2382)
 26 KOG0905|consensus              100.0   7E-35 1.5E-39  276.9   4.7  159    1-160  1163-1336(1639)
 27 PF00454 PI3_PI4_kinase:  Phosp 100.0 9.9E-34 2.2E-38  230.7   8.7  109    1-113   101-213 (235)
 28 COG5032 TEL1 Phosphatidylinosi 100.0 1.2E-33 2.6E-38  286.3  10.8  155    1-157  1909-2083(2105)
 29 KOG0892|consensus              100.0 2.1E-33 4.5E-38  280.8   7.6  110    1-113  2592-2701(2806)
 30 KOG0906|consensus              100.0 4.9E-31 1.1E-35  240.6   6.9  145    3-152   659-821 (843)
 31 KOG0902|consensus              100.0 3.9E-30 8.5E-35  247.9  12.1  149    1-152  1617-1780(1803)
 32 KOG0903|consensus              100.0 9.3E-29   2E-33  228.3  12.2  139    2-144   662-817 (847)
 33 KOG0891|consensus               99.8 3.4E-21 7.3E-26  195.5   4.1  122    1-124  2105-2231(2341)
 34 PTZ00303 phosphatidylinositol   99.8 3.4E-19 7.3E-24  166.0   6.4   71   18-90   1129-1199(1374)
 35 KOG0889|consensus               99.4 4.8E-13   1E-17  138.3   7.1  111    1-112  3350-3460(3550)
 36 TIGR03724 arch_bud32 Kae1-asso  89.5     1.1 2.4E-05   34.5   5.8   41   21-63     94-136 (199)
 37 cd05145 RIO1_like RIO kinase f  89.3    0.29 6.2E-06   38.3   2.4   25   39-65    142-166 (190)
 38 COG0661 AarF Predicted unusual  89.2    0.27 5.9E-06   45.5   2.5   25   39-64    289-313 (517)
 39 KOG0616|consensus               88.9    0.28   6E-06   43.1   2.2   44   21-65    140-193 (355)
 40 cd05147 RIO1_euk RIO kinase fa  88.8    0.27 5.9E-06   38.9   1.9   35   30-66    128-167 (190)
 41 PRK14879 serine/threonine prot  88.7     1.3 2.8E-05   34.4   5.8   24   39-64    119-142 (211)
 42 TIGR03843 conserved hypothetic  88.4    0.42 9.2E-06   40.5   2.9   45   23-68    132-176 (253)
 43 TIGR01982 UbiB 2-polyprenylphe  88.1    0.99 2.1E-05   40.6   5.3   24   39-63    281-304 (437)
 44 cd05151 ChoK Choline Kinase (C  87.9     0.5 1.1E-05   35.2   2.8   26   38-65    111-136 (170)
 45 PRK04750 ubiB putative ubiquin  87.0    0.39 8.5E-06   44.7   2.0   26   39-65    284-313 (537)
 46 PRK10359 lipopolysaccharide co  86.4    0.49 1.1E-05   39.4   2.2   23   39-63    159-181 (232)
 47 cd05144 RIO2_C RIO kinase fami  86.2    0.72 1.6E-05   36.0   2.9   29   39-68    149-177 (198)
 48 KOG0608|consensus               85.2    0.88 1.9E-05   44.0   3.4   26   39-65    753-778 (1034)
 49 PF01636 APH:  Phosphotransfera  84.2    0.75 1.6E-05   35.4   2.2   33   32-64    164-196 (239)
 50 cd05119 RIO RIO kinase family,  83.8    0.89 1.9E-05   34.6   2.4   28   38-67    138-165 (187)
 51 cd05069 PTKc_Yes Catalytic dom  82.8     3.6 7.8E-05   32.6   5.7   25   39-64    126-150 (260)
 52 PRK01723 3-deoxy-D-manno-octul  81.5     1.3 2.8E-05   36.4   2.6   25   39-64    166-190 (239)
 53 cd05120 APH_ChoK_like Aminogly  79.4       2 4.2E-05   30.2   2.7   25   39-64    113-137 (155)
 54 cd05122 PKc_STE Catalytic doma  79.2      17 0.00038   27.7   8.3   51   36-87    119-170 (253)
 55 TIGR02172 Fb_sc_TIGR02172 Fibr  78.1     1.7 3.7E-05   35.4   2.3   25   37-63    156-180 (226)
 56 PRK12274 serine/threonine prot  77.7       2 4.4E-05   35.6   2.6   29   35-64    109-140 (218)
 57 smart00090 RIO RIO-like kinase  77.3     1.9 4.2E-05   35.3   2.5   28   39-68    173-200 (237)
 58 cd05068 PTKc_Frk_like Catalyti  77.2     7.3 0.00016   30.8   5.8   27   39-66    127-153 (261)
 59 KOG0598|consensus               77.1     1.2 2.7E-05   39.5   1.3   43   21-64    121-173 (357)
 60 cd05034 PTKc_Src_like Catalyti  76.5     7.5 0.00016   30.6   5.6   27   38-65    126-152 (261)
 61 cd06656 STKc_PAK3 Catalytic do  76.3     7.3 0.00016   31.9   5.6   48   39-87    139-188 (297)
 62 cd05042 PTKc_Aatyk Catalytic d  75.9     5.8 0.00013   31.5   4.8   26   39-65    124-149 (269)
 63 PTZ00426 cAMP-dependent protei  75.3     5.2 0.00011   34.0   4.6   26   39-65    155-180 (340)
 64 cd05153 HomoserineK_II Homoser  75.0     2.4 5.2E-05   35.0   2.4   30   34-64    175-204 (296)
 65 cd05156 ChoK_euk Choline Kinas  74.8     3.5 7.5E-05   34.2   3.4   36   32-67    177-215 (302)
 66 cd05154 ACAD10_11_like Acyl-Co  74.7     2.7 5.9E-05   32.3   2.5   31   34-64    174-205 (223)
 67 cd05627 STKc_NDR2 Catalytic do  74.6     5.6 0.00012   33.6   4.7   25   39-64    125-149 (360)
 68 cd07861 STKc_CDK1_euk Catalyti  74.6     5.2 0.00011   31.9   4.3   25   39-64    125-149 (285)
 69 PF06293 Kdo:  Lipopolysacchari  74.5     8.5 0.00018   30.6   5.4   46   18-64    119-169 (206)
 70 cd05594 STKc_PKB_alpha Catalyt  74.3     8.3 0.00018   32.1   5.6   25   39-64    120-144 (325)
 71 cd05072 PTKc_Lyn Catalytic dom  73.6     8.2 0.00018   30.4   5.1   27   39-66    127-153 (261)
 72 cd06640 STKc_MST4 Catalytic do  73.2     6.7 0.00015   31.5   4.6   27   38-65    124-150 (277)
 73 PRK10271 thiK thiamine kinase;  73.1     3.4 7.5E-05   33.4   2.8   52   14-68     58-109 (188)
 74 cd05598 STKc_LATS Catalytic do  73.0     6.7 0.00015   33.3   4.8   24   39-63    125-148 (376)
 75 cd05590 STKc_nPKC_eta Catalyti  72.6     6.9 0.00015   32.6   4.7   25   39-64    120-144 (320)
 76 cd07871 STKc_PCTAIRE3 Catalyti  72.3     6.5 0.00014   32.0   4.4   26   39-65    127-152 (288)
 77 cd06631 STKc_YSK4 Catalytic do  72.1      10 0.00022   30.0   5.3   27   38-65    125-151 (265)
 78 cd07863 STKc_CDK4 Catalytic do  71.6     8.4 0.00018   30.9   4.8   25   39-64    132-156 (288)
 79 PF06176 WaaY:  Lipopolysacchar  71.5     3.8 8.2E-05   34.4   2.8   24   37-62    157-180 (229)
 80 cd05626 STKc_LATS2 Catalytic d  71.4     7.4 0.00016   33.3   4.7   24   39-63    125-148 (381)
 81 cd05574 STKc_phototropin_like   71.3      11 0.00023   30.9   5.5   28   38-66    126-153 (316)
 82 cd05155 APH_ChoK_like_1 Unchar  71.3     4.1 8.8E-05   32.7   2.9   29   33-63    163-192 (235)
 83 cd05604 STKc_SGK3 Catalytic do  71.3     7.8 0.00017   32.2   4.7   25   39-64    120-144 (325)
 84 PHA00451 protein kinase         71.1     5.2 0.00011   34.9   3.6   76    2-85    156-232 (362)
 85 cd05083 PTKc_Chk Catalytic dom  70.9      12 0.00027   29.3   5.6   26   39-65    124-149 (254)
 86 PF13575 DUF4135:  Domain of un  70.9     9.7 0.00021   33.3   5.4   48   17-66    131-178 (370)
 87 cd05617 STKc_aPKC_zeta Catalyt  70.9     8.1 0.00017   32.3   4.7   26   39-65    120-145 (327)
 88 cd05588 STKc_aPKC Catalytic do  70.9     7.3 0.00016   32.6   4.5   25   39-64    120-144 (329)
 89 cd05607 STKc_GRK7 Catalytic do  70.8      11 0.00024   30.4   5.4   26   39-65    119-144 (277)
 90 PF00069 Pkinase:  Protein kina  70.6     4.7  0.0001   31.5   3.1   48   39-87    122-171 (260)
 91 cd05573 STKc_ROCK_NDR_like Cat  70.4       8 0.00017   32.2   4.6   26   39-65    125-150 (350)
 92 PRK05231 homoserine kinase; Pr  70.1     4.1 8.9E-05   34.1   2.8   26   36-63    189-215 (319)
 93 cd05071 PTKc_Src Catalytic dom  69.8      14 0.00031   29.3   5.8   25   39-64    126-150 (262)
 94 cd06624 STKc_ASK Catalytic dom  69.8     9.6 0.00021   30.2   4.8   26   39-64    132-157 (268)
 95 cd05586 STKc_Sck1_like Catalyt  69.6     8.4 0.00018   32.0   4.5   25   39-64    120-144 (330)
 96 cd05157 ETNK_euk Ethanolamine   69.4     5.1 0.00011   31.8   3.0   35   34-68    170-204 (235)
 97 cd05628 STKc_NDR1 Catalytic do  69.3     8.6 0.00019   32.6   4.6   25   39-64    125-149 (363)
 98 PRK09605 bifunctional UGMP fam  68.4      12 0.00025   34.3   5.5   49   14-64    425-475 (535)
 99 cd05039 PTKc_Csk_like Catalyti  68.3      21 0.00046   28.0   6.4   27   39-66    126-152 (256)
100 cd05600 STKc_Sid2p_Dbf2p Catal  68.3      10 0.00022   31.6   4.8   26   39-65    125-150 (333)
101 cd05054 PTKc_VEGFR Catalytic d  68.3      14  0.0003   31.2   5.6   25   39-64    197-221 (337)
102 cd05101 PTKc_FGFR2 Catalytic d  68.0      14 0.00031   30.0   5.5   26   39-65    161-186 (304)
103 PHA03212 serine/threonine kina  67.7      12 0.00027   32.5   5.3   24   39-63    206-229 (391)
104 cd05096 PTKc_DDR1 Catalytic do  67.4      12 0.00026   30.5   5.0   25   39-64    162-186 (304)
105 cd05587 STKc_cPKC Catalytic do  67.3     3.2 6.8E-05   34.6   1.5   25   39-64    125-149 (324)
106 cd06613 STKc_MAP4K3_like Catal  67.3      10 0.00022   29.7   4.3   27   38-65    124-150 (262)
107 cd05593 STKc_PKB_gamma Catalyt  67.0      10 0.00022   31.8   4.5   25   39-64    119-143 (328)
108 cd05625 STKc_LATS1 Catalytic d  67.0      11 0.00023   32.2   4.8   24   39-63    125-148 (382)
109 TIGR00938 thrB_alt homoserine   66.8     5.3 0.00012   33.4   2.8   29   34-63    187-215 (307)
110 cd06625 STKc_MEKK3_like Cataly  66.8      14  0.0003   29.0   5.0   25   39-64    128-152 (263)
111 cd05086 PTKc_Aatyk2 Catalytic   66.8      15 0.00033   29.3   5.4   26   39-65    123-148 (268)
112 cd05059 PTKc_Tec_like Catalyti  66.7      12 0.00027   29.5   4.8   25   39-64    124-148 (256)
113 cd05082 PTKc_Csk Catalytic dom  66.3      15 0.00032   29.0   5.1   26   39-65    126-151 (256)
114 cd05070 PTKc_Fyn_Yrk Catalytic  66.2      18  0.0004   28.4   5.7   26   39-65    126-151 (260)
115 KOG0583|consensus               66.0      13 0.00028   32.8   5.1   85    2-89    108-196 (370)
116 cd06608 STKc_myosinIII_like Ca  65.9      12 0.00025   29.4   4.5   25   39-64    137-161 (275)
117 PHA03207 serine/threonine kina  65.9      11 0.00023   32.6   4.5   25   39-64    209-233 (392)
118 cd05075 PTKc_Axl Catalytic dom  65.7      13 0.00029   29.3   4.8   26   39-65    136-161 (272)
119 cd05052 PTKc_Abl Catalytic dom  65.5      37  0.0008   26.8   7.4   28   39-67    128-155 (263)
120 cd06655 STKc_PAK2 Catalytic do  65.2     9.9 0.00021   31.1   4.1   27   38-65    138-164 (296)
121 cd05067 PTKc_Lck_Blk Catalytic  65.1      15 0.00032   29.0   5.0   26   39-65    126-151 (260)
122 cd05618 STKc_aPKC_iota Catalyt  65.1      13 0.00027   31.2   4.7   25   39-64    120-144 (329)
123 cd05597 STKc_DMPK_like Catalyt  65.1      13 0.00027   31.2   4.7   26   39-65    126-151 (331)
124 KOG0603|consensus               64.9     4.7  0.0001   38.3   2.2   31   38-68    438-468 (612)
125 cd05621 STKc_ROCK2 Catalytic d  64.9      12 0.00027   32.1   4.7   27   39-66    166-192 (370)
126 cd05048 PTKc_Ror Catalytic Dom  64.8      12 0.00026   29.9   4.4   25   39-64    148-172 (283)
127 cd07847 STKc_CDKL1_4 Catalytic  64.7      16 0.00035   29.0   5.1   27   39-66    124-150 (286)
128 cd07835 STKc_CDK1_like Catalyt  64.5      15 0.00033   29.2   5.0   26   39-65    123-148 (283)
129 PF01163 RIO1:  RIO1 family;  I  64.4     7.5 0.00016   31.2   3.1   28   39-68    131-158 (188)
130 cd06657 STKc_PAK4 Catalytic do  64.4     9.9 0.00021   31.1   3.9   27   38-65    139-165 (292)
131 cd06644 STKc_STK10_LOK Catalyt  64.2      16 0.00034   29.5   5.0   26   39-65    134-159 (292)
132 COG3642 Mn2+-dependent serine/  64.1     6.4 0.00014   32.5   2.6   28   39-68    116-143 (204)
133 PF01633 Choline_kinase:  Choli  63.9     4.3 9.3E-05   32.0   1.6   30   34-63    143-172 (211)
134 cd05150 APH Aminoglycoside 3'-  63.7     6.8 0.00015   31.3   2.8   28   35-63    164-191 (244)
135 cd05585 STKc_YPK1_like Catalyt  63.7     4.2 9.2E-05   33.6   1.6   25   39-64    117-141 (312)
136 cd06637 STKc_TNIK Catalytic do  63.6      14  0.0003   29.2   4.5   26   39-65    135-160 (272)
137 cd05088 PTKc_Tie2 Catalytic do  63.4      21 0.00045   29.3   5.7   26   39-65    148-173 (303)
138 cd05605 STKc_GRK4_like Catalyt  63.4      17 0.00037   29.4   5.1   26   39-65    126-151 (285)
139 cd05601 STKc_CRIK Catalytic do  63.4     4.4 9.6E-05   33.6   1.7   25   39-64    126-150 (330)
140 cd05116 PTKc_Syk Catalytic dom  63.3      16 0.00035   28.8   4.9   26   39-65    119-144 (257)
141 cd05032 PTKc_InsR_like Catalyt  63.2      18 0.00039   28.6   5.1   25   39-64    143-167 (277)
142 cd07859 STKc_TDY_MAPK_plant Ca  62.9      13 0.00029   30.5   4.4   25   39-64    127-151 (338)
143 cd07862 STKc_CDK6 Catalytic do  62.8       4 8.6E-05   32.9   1.2   25   39-64    134-158 (290)
144 cd07853 STKc_NLK Catalytic dom  62.8      15 0.00032   31.2   4.8   25   39-64    127-151 (372)
145 cd05616 STKc_cPKC_beta Catalyt  62.4     4.1 8.9E-05   33.9   1.3   26   39-65    125-150 (323)
146 cd05614 STKc_MSK2_N N-terminal  62.3     4.4 9.6E-05   33.7   1.5   25   39-64    129-153 (332)
147 cd05603 STKc_SGK2 Catalytic do  61.8     4.2 9.2E-05   33.7   1.3   25   39-64    120-144 (321)
148 cd05582 STKc_RSK_N N-terminal   61.6      16 0.00034   30.2   4.7   26   39-65    122-147 (318)
149 KOG1235|consensus               61.4       7 0.00015   36.6   2.7   28   39-66    325-355 (538)
150 KOG0612|consensus               61.3     9.6 0.00021   39.0   3.7   53   39-92    199-254 (1317)
151 cd05581 STKc_PDK1 Catalytic do  61.2     4.3 9.3E-05   32.1   1.2   29   38-67    125-153 (280)
152 cd05589 STKc_PKN Catalytic dom  61.2      14 0.00031   30.6   4.4   25   39-64    125-149 (324)
153 PHA02882 putative serine/threo  61.2     5.8 0.00012   32.5   1.9   24   39-63    150-173 (294)
154 cd05602 STKc_SGK1 Catalytic do  61.1     4.5 9.6E-05   33.7   1.3   25   39-64    120-144 (325)
155 KOG0594|consensus               61.0     6.1 0.00013   34.7   2.1   50   17-67    120-171 (323)
156 cd05571 STKc_PKB Catalytic dom  60.9     5.1 0.00011   33.4   1.6   25   39-64    119-143 (323)
157 cd05575 STKc_SGK Catalytic dom  60.7     4.8  0.0001   33.4   1.4   25   39-64    120-144 (323)
158 PLN02421 phosphotransferase, a  60.6     7.6 0.00016   33.3   2.7   35   34-68    182-216 (330)
159 cd05609 STKc_MAST Catalytic do  60.6     5.9 0.00013   32.4   1.9   25   38-63    124-148 (305)
160 cd05591 STKc_nPKC_epsilon Cata  60.6       5 0.00011   33.3   1.5   25   39-64    120-144 (321)
161 PRK09188 serine/threonine prot  60.5     7.3 0.00016   34.5   2.6   25   39-64    135-160 (365)
162 cd06638 STKc_myosinIIIA Cataly  60.5      19 0.00041   28.8   4.8   26   39-65    148-173 (286)
163 cd00180 PKc Catalytic domain o  60.3      16 0.00034   26.6   4.0   33   36-68    113-145 (215)
164 cd08217 STKc_Nek2 Catalytic do  60.1      14  0.0003   28.7   3.9   28   38-66    133-160 (265)
165 cd05152 MPH2' Macrolide 2'-Pho  59.9     7.8 0.00017   32.6   2.5   28   36-64    187-215 (276)
166 cd05041 PTKc_Fes_like Catalyti  59.9      23  0.0005   27.6   5.1   28   38-66    116-143 (251)
167 cd05570 STKc_PKC Catalytic dom  59.8      16 0.00034   30.3   4.4   25   39-64    120-144 (318)
168 cd06642 STKc_STK25-YSK1 Cataly  59.8      15 0.00032   29.3   4.1   25   39-64    125-149 (277)
169 cd06632 STKc_MEKK1_plant Catal  59.7      26 0.00056   27.2   5.4   27   39-66    126-152 (258)
170 cd05608 STKc_GRK1 Catalytic do  59.6      19 0.00042   29.0   4.8   26   39-65    121-146 (280)
171 cd05612 STKc_PRKX_like Catalyt  59.4     5.6 0.00012   32.4   1.6   26   39-65    125-150 (291)
172 cd05631 STKc_GRK4 Catalytic do  59.4      22 0.00048   28.7   5.1   25   39-64    126-150 (285)
173 cd05630 STKc_GRK6 Catalytic do  59.3      18 0.00039   29.3   4.6   26   39-65    126-151 (285)
174 cd05085 PTKc_Fer Catalytic dom  59.2     6.5 0.00014   30.7   1.9   26   39-65    117-142 (250)
175 cd07834 STKc_MAPK Catalytic do  59.2      17 0.00037   29.9   4.4   29   39-68    127-155 (330)
176 cd07848 STKc_CDKL5 Catalytic d  59.1      19 0.00042   28.8   4.7   27   39-66    124-150 (287)
177 cd06607 STKc_TAO Catalytic dom  58.8      29 0.00063   28.3   5.8   26   39-65    139-164 (307)
178 cd07872 STKc_PCTAIRE2 Catalyti  58.6     5.2 0.00011   32.8   1.3   26   39-65    128-153 (309)
179 cd05592 STKc_nPKC_theta_delta   58.3     5.3 0.00012   33.2   1.3   25   39-64    120-144 (316)
180 KOG0667|consensus               58.1      21 0.00046   33.8   5.3   65    1-66    274-341 (586)
181 PTZ00263 protein kinase A cata  57.9     5.9 0.00013   33.1   1.5   27   38-65    141-167 (329)
182 cd05109 PTKc_HER2 Catalytic do  57.3      26 0.00057   27.9   5.2   25   39-64    133-157 (279)
183 cd05098 PTKc_FGFR1 Catalytic d  57.2      21 0.00045   29.2   4.7   25   39-64    164-188 (307)
184 cd08223 STKc_Nek4 Catalytic do  57.2       9 0.00019   30.0   2.4   25   39-64    126-150 (257)
185 PLN00009 cyclin-dependent kina  57.2      33 0.00071   27.6   5.7   26   39-64    126-151 (294)
186 TIGR02906 spore_CotS spore coa  57.1     9.6 0.00021   31.4   2.6   28   34-63    187-214 (313)
187 cd07839 STKc_CDK5 Catalytic do  57.1      20 0.00043   28.6   4.4   26   39-65    123-148 (284)
188 cd05040 PTKc_Ack_like Catalyti  57.0      22 0.00049   27.8   4.6   26   38-64    120-145 (257)
189 TIGR02721 ycfN_thiK thiamine k  57.0     9.1  0.0002   31.0   2.4   32   35-68    147-178 (256)
190 cd05577 STKc_GRK Catalytic dom  57.0      21 0.00046   28.5   4.6   26   39-65    119-144 (277)
191 cd05623 STKc_MRCK_alpha Cataly  56.8      21 0.00046   29.7   4.7   26   39-65    126-151 (332)
192 cd07841 STKc_CDK7 Catalytic do  56.7      17 0.00037   29.3   4.0   28   39-67    126-153 (298)
193 cd06615 PKc_MEK Catalytic doma  56.6      27 0.00058   28.7   5.2   25   39-64    124-148 (308)
194 PLN02236 choline kinase         56.5      10 0.00022   32.8   2.8   34   33-66    199-232 (344)
195 cd06652 STKc_MEKK2 Catalytic d  56.2      25 0.00054   27.8   4.8   25   39-64    130-154 (265)
196 cd05632 STKc_GRK5 Catalytic do  56.2      23 0.00051   28.6   4.7   26   39-65    126-151 (285)
197 cd05033 PTKc_EphR Catalytic do  56.1     8.4 0.00018   30.5   2.1   27   39-66    130-156 (266)
198 PHA03209 serine/threonine kina  56.0      21 0.00046   30.3   4.6   25   39-64    181-205 (357)
199 cd07860 STKc_CDK2_3 Catalytic   56.0      26 0.00056   27.9   4.9   25   39-64    124-148 (284)
200 cd07857 STKc_MPK1 Catalytic do  55.9      21 0.00045   29.7   4.5   26   39-65    129-154 (332)
201 cd08530 STKc_CNK2-like Catalyt  55.9      22 0.00048   27.5   4.4   48   38-86    126-173 (256)
202 cd06610 STKc_OSR1_SPAK Catalyt  55.8      24 0.00051   27.6   4.6   26   38-64    125-150 (267)
203 cd05620 STKc_nPKC_delta Cataly  55.7       6 0.00013   32.9   1.2   25   39-64    120-144 (316)
204 KOG2345|consensus               55.5     9.9 0.00021   32.9   2.4   26   39-65    153-178 (302)
205 PLN00034 mitogen-activated pro  55.1     6.3 0.00014   33.2   1.2   25   39-64    192-216 (353)
206 cd06614 STKc_PAK Catalytic dom  55.0      27 0.00058   28.0   4.9   26   39-65    140-165 (286)
207 cd05102 PTKc_VEGFR3 Catalytic   55.0     9.9 0.00021   31.6   2.4   25   39-64    198-222 (338)
208 cd05580 STKc_PKA Catalytic dom  54.9     7.4 0.00016   31.5   1.6   28   38-66    124-151 (290)
209 cd08529 STKc_FA2-like Catalyti  54.9      11 0.00023   29.4   2.5   26   39-65    125-150 (256)
210 cd05087 PTKc_Aatyk1_Aatyk3 Cat  54.9      31 0.00067   27.4   5.2   25   39-64    124-148 (269)
211 cd07874 STKc_JNK3 Catalytic do  54.7     7.7 0.00017   32.6   1.7   27   39-66    143-169 (355)
212 cd05595 STKc_PKB_beta Catalyti  54.7       6 0.00013   33.0   1.0   25   39-64    119-143 (323)
213 cd07869 STKc_PFTAIRE1 Catalyti  54.6     6.5 0.00014   32.1   1.2   26   39-65    127-152 (303)
214 cd06639 STKc_myosinIIIB Cataly  54.4      27 0.00059   28.1   4.8   26   39-65    152-177 (291)
215 cd05113 PTKc_Btk_Bmx Catalytic  54.4      33 0.00071   27.1   5.2   25   39-64    124-148 (256)
216 cd05615 STKc_cPKC_alpha Cataly  54.4     7.1 0.00015   32.6   1.4   26   39-65    125-150 (323)
217 KOG0593|consensus               54.3     7.9 0.00017   34.5   1.7   63   18-81    102-166 (396)
218 cd05118 STKc_CMGC Catalytic do  54.3     7.4 0.00016   30.9   1.4   29   39-68    122-150 (283)
219 cd05596 STKc_ROCK Catalytic do  54.2     7.7 0.00017   33.3   1.6   27   39-66    166-192 (370)
220 KOG0605|consensus               54.2     7.7 0.00017   36.4   1.7   26   40-66    266-291 (550)
221 KOG0610|consensus               54.1      10 0.00022   34.8   2.4   36   30-66    190-229 (459)
222 cd07876 STKc_JNK2 Catalytic do  54.0     7.3 0.00016   32.9   1.5   25   39-64    147-171 (359)
223 cd05584 STKc_p70S6K Catalytic   53.8     7.6 0.00016   32.3   1.5   24   39-63    124-147 (323)
224 PTZ00267 NIMA-related protein   53.8     8.6 0.00019   34.4   1.9   26   39-65    193-218 (478)
225 cd05093 PTKc_TrkB Catalytic do  53.7      33 0.00072   27.6   5.3   25   39-64    144-168 (288)
226 cd07873 STKc_PCTAIRE1 Catalyti  53.6     6.9 0.00015   31.9   1.2   26   39-65    128-153 (301)
227 cd08219 STKc_Nek3 Catalytic do  53.6      11 0.00023   29.7   2.2   26   39-65    124-149 (255)
228 cd05084 PTKc_Fes Catalytic dom  53.6     9.5  0.0002   29.9   2.0   26   39-65    118-143 (252)
229 smart00219 TyrKc Tyrosine kina  53.6     9.8 0.00021   29.5   2.0   30   38-68    126-155 (258)
230 PHA03211 serine/threonine kina  53.6      22 0.00048   32.1   4.5   24   39-63    284-307 (461)
231 PF07804 HipA_C:  HipA-like C-t  53.1      21 0.00045   24.2   3.4   35   20-54     37-71  (79)
232 cd06636 STKc_MAP4K4_6 Catalyti  52.9      29 0.00062   27.7   4.7   26   39-65    145-170 (282)
233 cd06654 STKc_PAK1 Catalytic do  52.6      21 0.00045   29.1   3.9   26   39-65    140-165 (296)
234 cd06612 STKc_MST1_2 Catalytic   52.4      43 0.00093   26.0   5.5   29   38-67    122-150 (256)
235 cd05624 STKc_MRCK_beta Catalyt  52.2     8.8 0.00019   32.1   1.6   26   39-65    126-151 (331)
236 cd07875 STKc_JNK1 Catalytic do  52.2     8.5 0.00018   32.5   1.6   27   39-66    150-176 (364)
237 KOG0662|consensus               52.1      31 0.00067   28.9   4.7   60    1-63     87-148 (292)
238 cd05576 STKc_RPK118_like Catal  52.0      28 0.00061   27.3   4.5   24   39-63    109-132 (237)
239 cd07878 STKc_p38beta_MAPK11 Ca  51.8      15 0.00033   30.6   3.0   27   39-66    142-168 (343)
240 cd05148 PTKc_Srm_Brk Catalytic  51.7      46 0.00099   26.0   5.6   28   38-66    127-154 (261)
241 KOG0984|consensus               51.7      11 0.00024   32.0   2.1   46   39-85    173-224 (282)
242 cd05629 STKc_NDR_like_fungal C  51.6       9 0.00019   32.6   1.6   24   39-63    125-148 (377)
243 cd05599 STKc_NDR_like Catalyti  51.6     8.2 0.00018   32.5   1.4   25   39-64    125-149 (364)
244 KOG0592|consensus               51.2      10 0.00022   35.9   1.9   34   29-63    184-221 (604)
245 cd05112 PTKc_Itk Catalytic dom  51.1      11 0.00024   29.5   2.0   26   39-65    124-149 (256)
246 cd06641 STKc_MST3 Catalytic do  51.1      21 0.00045   28.6   3.6   25   38-63    124-148 (277)
247 cd07838 STKc_CDK4_6_like Catal  51.1      11 0.00025   29.9   2.1   28   38-66    130-157 (287)
248 cd06649 PKc_MEK2 Catalytic dom  51.0      24 0.00051   29.5   4.1   25   39-64    128-152 (331)
249 cd05066 PTKc_EphR_A Catalytic   51.0     9.5 0.00021   30.3   1.6   27   38-65    129-155 (267)
250 cd05622 STKc_ROCK1 Catalytic d  50.8     9.9 0.00022   32.6   1.8   26   39-65    166-191 (371)
251 cd06648 STKc_PAK_II Catalytic   50.5      26 0.00056   28.4   4.1   25   39-64    139-163 (285)
252 cd05099 PTKc_FGFR4 Catalytic d  50.5      39 0.00085   27.7   5.3   26   39-65    158-183 (314)
253 cd06618 PKc_MKK7 Catalytic dom  50.4      32 0.00069   27.8   4.7   25   39-64    139-163 (296)
254 cd07845 STKc_CDK10 Catalytic d  50.2      29 0.00062   28.3   4.4   27   39-66    132-158 (309)
255 cd06658 STKc_PAK5 Catalytic do  50.1      22 0.00047   29.0   3.7   25   39-64    142-166 (292)
256 cd08215 STKc_Nek Catalytic dom  49.6      10 0.00023   29.2   1.6   30   38-68    126-155 (258)
257 cd07830 STKc_MAK_like Catalyti  49.6      44 0.00095   26.5   5.3   29   36-65    120-148 (283)
258 cd05146 RIO3_euk RIO kinase fa  49.5      11 0.00023   30.6   1.7   26   39-66    149-174 (197)
259 cd05619 STKc_nPKC_theta Cataly  49.5     9.1  0.0002   31.9   1.3   25   39-64    120-144 (316)
260 cd07852 STKc_MAPK15 Catalytic   49.4      36 0.00078   28.2   4.9   26   39-65    131-156 (337)
261 cd06650 PKc_MEK1 Catalytic dom  49.0      23 0.00049   29.7   3.7   25   39-64    128-152 (333)
262 cd05079 PTKc_Jak1_rpt2 Catalyt  48.9      12 0.00025   30.2   1.8   26   39-65    133-158 (284)
263 cd06606 STKc_MAPKKK Catalytic   48.8      19 0.00041   27.6   2.9   32   36-68    122-153 (260)
264 PF01386 Ribosomal_L25p:  Ribos  48.8      16 0.00034   25.7   2.2   15   46-60     74-88  (88)
265 cd05123 STKc_AGC Catalytic dom  48.7      16 0.00034   28.4   2.5   30   36-66    114-143 (250)
266 cd06635 STKc_TAO1 Catalytic do  48.6      50  0.0011   27.2   5.6   26   39-65    149-174 (317)
267 cd00192 PTKc Catalytic domain   48.5      48   0.001   25.5   5.2   30   38-68    128-157 (262)
268 cd08224 STKc_Nek6_Nek7 Catalyt  48.4      12 0.00026   29.4   1.8   25   39-64    130-154 (267)
269 cd07877 STKc_p38alpha_MAPK14 C  48.4      39 0.00084   28.4   5.0   28   39-67    144-171 (345)
270 cd07849 STKc_ERK1_2_like Catal  48.3      29 0.00062   28.9   4.2   27   39-66    130-156 (336)
271 KOG0983|consensus               48.3      13 0.00029   32.8   2.1   58   25-84    197-266 (391)
272 PLN03224 probable serine/threo  48.3      39 0.00085   31.2   5.3   26   39-65    333-358 (507)
273 cd05073 PTKc_Hck Catalytic dom  48.3      42 0.00092   26.4   5.0   27   38-65    125-151 (260)
274 KOG0658|consensus               48.3      13 0.00028   33.2   2.1   25   39-63    149-173 (364)
275 PRK15123 lipopolysaccharide co  48.1      15 0.00032   31.0   2.4   46   18-63    139-192 (268)
276 cd06623 PKc_MAPKK_plant_like C  47.9      10 0.00022   29.6   1.3   28   38-66    123-150 (264)
277 cd08228 STKc_Nek6 Catalytic do  47.8      11 0.00025   29.6   1.6   26   39-65    130-155 (267)
278 cd05100 PTKc_FGFR3 Catalytic d  47.8      47   0.001   27.6   5.4   25   39-64    158-182 (334)
279 cd05063 PTKc_EphR_A2 Catalytic  47.6      12 0.00027   29.5   1.8   28   37-65    129-156 (268)
280 cd05097 PTKc_DDR_like Catalyti  47.6      12 0.00027   30.2   1.8   26   38-64    152-177 (295)
281 cd06605 PKc_MAPKK Catalytic do  47.5      11 0.00024   29.6   1.4   26   39-65    125-150 (265)
282 cd07832 STKc_CCRK Catalytic do  47.4      11 0.00024   30.0   1.4   28   39-67    123-150 (286)
283 cd05111 PTK_HER3 Pseudokinase   47.3      14 0.00031   29.7   2.1   25   39-64    133-157 (279)
284 cd05062 PTKc_IGF-1R Catalytic   47.0      13 0.00029   29.6   1.9   25   39-64    143-167 (277)
285 cd05579 STKc_MAST_like Catalyt  47.0      12 0.00026   29.1   1.5   27   39-66    117-143 (265)
286 COG0478 RIO-like serine/threon  46.9      17 0.00036   31.8   2.5   43   39-89    226-269 (304)
287 cd06619 PKc_MKK5 Catalytic dom  46.9      12 0.00026   30.1   1.6   26   39-65    119-144 (279)
288 cd05095 PTKc_DDR2 Catalytic do  46.9      49  0.0011   26.7   5.2   25   39-64    154-178 (296)
289 cd06643 STKc_SLK Catalytic dom  46.5      16 0.00035   29.2   2.3   25   39-64    127-151 (282)
290 cd07837 STKc_CdkB_plant Cataly  46.4      15 0.00032   29.5   2.1   26   39-64    134-159 (295)
291 cd06622 PKc_MAPKK_PBS2_like Ca  46.4      21 0.00046   28.5   3.0   26   39-65    127-152 (286)
292 COG0510 ycfN Thiamine kinase a  46.3      17 0.00037   30.6   2.5   34   34-68    153-186 (269)
293 cd05633 STKc_GRK3 Catalytic do  46.3      23  0.0005   28.6   3.2   27   38-65    120-146 (279)
294 cd05578 STKc_Yank1 Catalytic d  46.3      61  0.0013   25.3   5.6   30   38-68    123-152 (258)
295 cd06611 STKc_SLK_like Catalyti  46.2      46 0.00099   26.5   4.9   25   39-64    127-151 (280)
296 cd05044 PTKc_c-ros Catalytic d  46.1      16 0.00034   28.9   2.1   25   39-64    130-159 (269)
297 KOG0198|consensus               45.8      25 0.00055   30.6   3.5   47   39-85    141-187 (313)
298 smart00587 CHK ZnF_C4 abd HLH   45.7      18 0.00039   28.5   2.4   33   35-67    121-157 (196)
299 cd05583 STKc_MSK_N N-terminal   45.5      13 0.00028   29.9   1.6   25   39-64    129-153 (288)
300 PHA03390 pk1 serine/threonine-  45.5      51  0.0011   26.4   5.1   27   39-65    133-159 (267)
301 cd06609 STKc_MST3_like Catalyt  45.5      31 0.00067   27.4   3.8   26   39-65    122-147 (274)
302 cd05104 PTKc_Kit Catalytic dom  45.5      55  0.0012   28.0   5.6   25   39-64    238-262 (375)
303 cd05047 PTKc_Tie Catalytic dom  45.2      19 0.00042   28.7   2.5   26   39-65    136-161 (270)
304 cd05090 PTKc_Ror1 Catalytic do  44.8      15 0.00032   29.4   1.9   26   39-65    148-173 (283)
305 cd05035 PTKc_Axl_like Catalyti  44.8      15 0.00032   28.9   1.8   25   39-64    137-161 (273)
306 cd05061 PTKc_InsR Catalytic do  44.7      16 0.00034   29.5   2.0   25   39-64    143-167 (288)
307 cd07870 STKc_PFTAIRE2 Catalyti  44.7      15 0.00031   29.7   1.8   26   38-64    126-151 (291)
308 cd05050 PTKc_Musk Catalytic do  44.6      13 0.00027   30.0   1.4   25   39-64    154-178 (288)
309 cd05089 PTKc_Tie1 Catalytic do  44.6      22 0.00049   28.8   2.9   26   39-65    143-168 (297)
310 cd06659 STKc_PAK6 Catalytic do  44.3      31 0.00067   28.2   3.7   25   39-64    141-165 (297)
311 KOG3087|consensus               44.2      21 0.00045   29.8   2.6   30   39-68    137-168 (229)
312 cd05038 PTKc_Jak_rpt2 Catalyti  44.0      15 0.00033   29.0   1.8   27   39-66    133-159 (284)
313 cd07840 STKc_CDK9_like Catalyt  44.0      12 0.00026   29.6   1.2   30   38-68    123-152 (287)
314 cd06626 STKc_MEKK4 Catalytic d  43.5      46 0.00099   26.0   4.4   28   39-67    123-150 (264)
315 cd05037 PTK_Jak_rpt1 Pseudokin  43.5      65  0.0014   25.0   5.3   27   39-66    125-158 (259)
316 cd06629 STKc_MAPKKK_Bck1_like   43.4      17 0.00037   28.8   2.0   26   39-65    132-157 (272)
317 KOG0986|consensus               43.2      19 0.00041   33.7   2.4   38   30-68    292-339 (591)
318 KOG1006|consensus               43.2      17 0.00037   31.9   2.0   47   39-86    192-244 (361)
319 cd05103 PTKc_VEGFR2 Catalytic   43.0      70  0.0015   26.8   5.7   25   39-64    203-227 (343)
320 KOG0599|consensus               42.9      15 0.00033   32.5   1.7   29   39-68    147-175 (411)
321 cd08216 PK_STRAD Pseudokinase   42.8      77  0.0017   25.7   5.9   25   39-64    125-149 (314)
322 cd05092 PTKc_TrkA Catalytic do  42.8      15 0.00033   29.5   1.6   26   38-64    145-170 (280)
323 cd07851 STKc_p38 Catalytic dom  42.4      33 0.00072   28.7   3.7   28   39-67    142-169 (343)
324 cd05080 PTKc_Tyk2_rpt2 Catalyt  42.3      19 0.00042   28.8   2.1   25   39-64    131-155 (283)
325 smart00220 S_TKc Serine/Threon  42.2      41 0.00088   25.3   3.9   30   38-68    110-139 (244)
326 cd05115 PTKc_Zap-70 Catalytic   42.0      18 0.00039   28.7   1.9   25   39-64    119-143 (257)
327 cd08225 STKc_Nek5 Catalytic do  41.9      56  0.0012   25.3   4.7   26   39-64    125-150 (257)
328 cd07850 STKc_JNK Catalytic dom  41.8      14  0.0003   31.1   1.3   27   39-66    142-168 (353)
329 cd05094 PTKc_TrkC Catalytic do  41.7      19 0.00042   29.1   2.1   26   39-65    147-172 (291)
330 cd06616 PKc_MKK4 Catalytic dom  41.5      15 0.00033   29.4   1.4   25   39-64    132-156 (288)
331 PLN03225 Serine/threonine-prot  41.2      17 0.00037   33.8   1.9   26   39-64    279-304 (566)
332 cd07833 STKc_CDKL Catalytic do  41.1      56  0.0012   25.9   4.7   26   39-65    124-149 (288)
333 cd07879 STKc_p38delta_MAPK13 C  41.0      16 0.00036   30.5   1.6   26   39-65    141-166 (342)
334 cd05110 PTKc_HER4 Catalytic do  40.8      19 0.00041   29.4   1.9   26   39-65    133-158 (303)
335 cd06917 STKc_NAK1_like Catalyt  40.8      17 0.00036   28.9   1.5   26   39-65    125-150 (277)
336 cd05060 PTKc_Syk_like Catalyti  40.7      57  0.0012   25.5   4.6   27   38-65    118-144 (257)
337 cd06627 STKc_Cdc7_like Catalyt  40.6      18  0.0004   27.9   1.7   30   38-68    122-151 (254)
338 PRK10593 hypothetical protein;  40.6      23  0.0005   29.9   2.5   31   38-68    197-229 (297)
339 PTZ00283 serine/threonine prot  40.5      18 0.00039   32.7   1.9   24   39-63    167-190 (496)
340 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  40.3      18 0.00039   28.9   1.7   25   39-64    132-156 (284)
341 cd08229 STKc_Nek7 Catalytic do  40.0      17 0.00036   28.7   1.4   27   38-65    129-155 (267)
342 cd05056 PTKc_FAK Catalytic dom  39.8      22 0.00047   28.2   2.1   26   38-64    130-155 (270)
343 cd07856 STKc_Sty1_Hog1 Catalyt  39.8      44 0.00096   27.8   4.0   27   39-66    132-158 (328)
344 TIGR01767 MTRK 5-methylthiorib  39.8      20 0.00042   32.1   1.9   29   35-65    193-221 (370)
345 PRK11768 serine/threonine prot  39.8      16 0.00035   31.2   1.4   30   32-64    194-223 (325)
346 cd05045 PTKc_RET Catalytic dom  39.6      18 0.00039   29.1   1.6   25   39-64    151-175 (290)
347 cd06651 STKc_MEKK3 Catalytic d  39.4      55  0.0012   25.9   4.4   25   39-64    130-154 (266)
348 cd06646 STKc_MAP4K5 Catalytic   39.3      18  0.0004   28.5   1.6   26   39-65    130-155 (267)
349 cd06628 STKc_MAPKKK_Byr2_like   39.1      16 0.00035   28.7   1.2   26   39-65    130-155 (267)
350 cd05572 STKc_cGK_PKG Catalytic  39.0      19 0.00042   28.3   1.6   30   36-66    114-143 (262)
351 PRK05943 50S ribosomal protein  38.7      20 0.00043   25.5   1.5   18   44-61     70-92  (94)
352 PTZ00036 glycogen synthase kin  38.5      19 0.00041   31.9   1.6   26   39-64    194-219 (440)
353 cd08528 STKc_Nek10 Catalytic d  38.1      19 0.00042   28.4   1.5   29   38-67    137-165 (269)
354 cd07867 STKc_CDC2L6 Catalytic   38.1      18 0.00039   29.4   1.4   26   39-64    132-160 (317)
355 cd07836 STKc_Pho85 Catalytic d  38.0      18  0.0004   28.7   1.4   28   37-65    122-149 (284)
356 cd07866 STKc_BUR1 Catalytic do  38.0      17 0.00037   29.3   1.2   28   38-66    138-165 (311)
357 cd04792 LanM-like LanM-like pr  37.9      46   0.001   32.0   4.3   50   17-68    171-220 (825)
358 cd07865 STKc_CDK9 Catalytic do  37.8      17 0.00038   29.2   1.2   26   39-65    143-168 (310)
359 PHA02988 hypothetical protein;  37.8      71  0.0015   25.9   4.9   25   39-64    147-171 (283)
360 cd07846 STKc_CDKL2_3 Catalytic  37.8      21 0.00046   28.4   1.7   26   39-65    124-149 (286)
361 cd06617 PKc_MKK3_6 Catalytic d  37.6      21 0.00045   28.4   1.6   25   39-64    128-152 (283)
362 cd08227 PK_STRAD_alpha Pseudok  37.5      87  0.0019   25.8   5.5   26   39-65    125-150 (327)
363 PHA03210 serine/threonine kina  37.5      19 0.00042   32.5   1.6   25   39-64    291-315 (501)
364 cd07829 STKc_CDK_like Catalyti  37.5      71  0.0015   25.1   4.7   28   38-66    121-148 (282)
365 cd05613 STKc_MSK1_N N-terminal  37.3      20 0.00043   28.8   1.5   27   38-65    128-154 (290)
366 cd00495 Ribosomal_L25_TL5_CTC   37.3      18 0.00039   25.4   1.1   12   49-60     78-89  (91)
367 cd05065 PTKc_EphR_B Catalytic   36.8      24 0.00053   27.9   1.9   25   39-64    130-154 (269)
368 cd06621 PKc_MAPKK_Pek1_like Ca  36.8      48   0.001   26.6   3.7   26   38-64    128-153 (287)
369 cd06645 STKc_MAP4K3 Catalytic   36.7      19  0.0004   28.5   1.2   27   38-65    129-155 (267)
370 cd05064 PTKc_EphR_A10 Catalyti  36.4      75  0.0016   25.2   4.7   26   39-65    131-156 (266)
371 cd05611 STKc_Rim15_like Cataly  36.2      21 0.00045   28.1   1.4   27   38-65    120-146 (260)
372 cd07831 STKc_MOK Catalytic dom  36.2      80  0.0017   24.9   4.9   25   39-65    124-148 (282)
373 PRK09550 mtnK methylthioribose  36.2      28 0.00061   31.3   2.4   28   35-64    224-251 (401)
374 cd05108 PTKc_EGFR Catalytic do  36.0      25 0.00054   28.9   1.9   26   39-65    133-158 (316)
375 cd05055 PTKc_PDGFR Catalytic d  36.0      23  0.0005   29.0   1.7   25   39-64    165-189 (302)
376 COG2334 Putative homoserine ki  35.9      29 0.00064   30.3   2.4   26   39-64    202-227 (331)
377 cd05114 PTKc_Tec_Rlk Catalytic  35.9      28 0.00061   27.3   2.1   28   37-65    122-149 (256)
378 cd05106 PTKc_CSF-1R Catalytic   35.9      29 0.00062   29.8   2.3   25   39-64    236-260 (374)
379 cd07855 STKc_ERK5 Catalytic do  35.8      19 0.00042   29.9   1.2   26   39-65    131-156 (334)
380 cd05610 STKc_MASTL Catalytic d  35.8      22 0.00048   33.5   1.7   25   39-64    128-152 (669)
381 cd07842 STKc_CDK8_like Catalyt  35.6      18  0.0004   29.2   1.0   26   39-65    132-161 (316)
382 smart00221 STYKc Protein kinas  35.0      23 0.00051   26.6   1.5   29   38-67    121-149 (225)
383 cd05058 PTKc_Met_Ron Catalytic  34.9      29 0.00063   27.2   2.1   25   39-64    122-146 (262)
384 cd06630 STKc_MEKK1 Catalytic d  34.8      76  0.0016   24.8   4.5   28   39-66    127-154 (268)
385 cd05105 PTKc_PDGFR_alpha Catal  34.5      94   0.002   27.2   5.4   25   39-64    261-285 (400)
386 cd05057 PTKc_EGFR_like Catalyt  34.4      29 0.00064   27.7   2.0   25   39-64    133-157 (279)
387 cd06653 STKc_MEKK3_like_1 Cata  34.4      20 0.00044   28.4   1.1   25   39-64    130-154 (264)
388 KOG3010|consensus               34.1      32  0.0007   29.4   2.3   97   11-114     8-129 (261)
389 cd06647 STKc_PAK_I Catalytic d  33.8      62  0.0013   26.3   3.9   26   39-65    139-164 (293)
390 cd05091 PTKc_Ror2 Catalytic do  33.5      27 0.00058   27.9   1.7   25   39-64    148-172 (283)
391 cd07854 STKc_MAPK4_6 Catalytic  33.5      73  0.0016   26.6   4.4   26   39-64    138-163 (342)
392 cd07864 STKc_CDK12 Catalytic d  33.4      76  0.0016   25.4   4.3   26   39-65    140-165 (302)
393 cd05606 STKc_beta_ARK Catalyti  33.2      23  0.0005   28.5   1.2   26   38-64    120-145 (278)
394 KOG0694|consensus               33.1      31 0.00068   33.3   2.2   24   39-63    492-515 (694)
395 cd05053 PTKc_FGFR Catalytic do  33.0      30 0.00065   27.8   1.9   26   39-65    156-181 (293)
396 cd07843 STKc_CDC2L1 Catalytic   32.5      26 0.00056   28.2   1.4   28   38-66    129-156 (293)
397 PRK10345 hypothetical protein;  32.4      32  0.0007   27.8   2.0   23   38-60    128-153 (210)
398 cd07844 STKc_PCTAIRE_like Cata  32.4      24 0.00051   28.3   1.2   26   39-65    127-152 (291)
399 cd08220 STKc_Nek8 Catalytic do  32.2      72  0.0016   24.7   3.9   28   38-65    124-151 (256)
400 cd07880 STKc_p38gamma_MAPK12 C  31.9      28 0.00061   29.2   1.6   26   39-65    142-167 (343)
401 cd05049 PTKc_Trk Catalytic dom  31.9      34 0.00074   27.1   2.0   25   39-64    146-170 (280)
402 TIGR02904 spore_ysxE spore coa  31.6      31 0.00067   28.9   1.8   28   36-64    198-225 (309)
403 cd07858 STKc_TEY_MAPK_plant Ca  31.2      26 0.00056   29.2   1.3   27   39-66    132-158 (337)
404 KOG0696|consensus               31.0      34 0.00074   31.9   2.1   27   39-66    474-500 (683)
405 cd05046 PTK_CCK4 Pseudokinase   30.9 1.4E+02  0.0029   23.6   5.4   26   39-65    141-166 (275)
406 PTZ00024 cyclin-dependent prot  30.8      25 0.00054   29.1   1.1   25   39-64    143-167 (335)
407 cd06633 STKc_TAO3 Catalytic do  30.5      39 0.00083   27.8   2.2   27   39-66    145-171 (313)
408 KOG0690|consensus               30.3      26 0.00057   31.7   1.2   49   14-64    264-316 (516)
409 PRK12396 5-methylribose kinase  30.3      34 0.00074   31.1   1.9   27   36-64    229-255 (409)
410 cd06634 STKc_TAO2 Catalytic do  29.6      33 0.00071   28.1   1.6   27   39-66    139-165 (308)
411 PRK13184 pknD serine/threonine  29.0      41  0.0009   33.7   2.4   26   39-65    137-162 (932)
412 cd08218 STKc_Nek1 Catalytic do  28.9      37  0.0008   26.5   1.7   26   39-65    125-150 (256)
413 PRK06148 hypothetical protein;  28.9      45 0.00097   33.4   2.6   27   39-66    208-237 (1013)
414 cd07868 STKc_CDK8 Catalytic do  27.9      53  0.0011   26.8   2.5   26   39-64    132-160 (317)
415 cd08221 STKc_Nek9 Catalytic do  27.9      42 0.00091   26.1   1.9   27   38-65    124-150 (256)
416 cd05074 PTKc_Tyro3 Catalytic d  27.6      42  0.0009   26.5   1.8   25   39-64    137-161 (273)
417 cd05051 PTKc_DDR Catalytic dom  27.6      41 0.00089   26.9   1.8   25   39-64    154-178 (296)
418 COG3173 Predicted aminoglycosi  27.2      57  0.0012   28.5   2.7   47   15-63    179-226 (321)
419 KOG2464|consensus               26.9      49  0.0011   27.3   2.2   19   34-53    157-175 (246)
420 cd05077 PTK_Jak1_rpt1 Pseudoki  26.7      52  0.0011   26.2   2.3   26   39-65    129-161 (262)
421 PF02958 EcKinase:  Ecdysteroid  26.6 1.1E+02  0.0023   25.1   4.2   29   35-63    216-248 (294)
422 COG4499 Predicted membrane pro  25.6      82  0.0018   28.7   3.4   34   27-61     91-129 (434)
423 cd05036 PTKc_ALK_LTK Catalytic  25.5      50  0.0011   26.3   2.0   26   39-65    140-168 (277)
424 PF14531 Kinase-like:  Kinase-l  25.3      50  0.0011   28.5   2.0   31   38-69    168-198 (288)
425 KOG0595|consensus               25.1 2.1E+02  0.0045   26.3   5.9   70   18-87    110-187 (429)
426 cd06620 PKc_MAPKK_Byr1_like Ca  24.7 1.7E+02  0.0038   23.2   5.0   26   39-65    128-153 (284)
427 KOG0670|consensus               24.5      48   0.001   31.8   1.8   39   39-82    560-598 (752)
428 PTZ00284 protein kinase; Provi  24.4      72  0.0016   28.2   2.9   26   39-65    256-297 (467)
429 COG4248 Uncharacterized protei  23.9      82  0.0018   29.7   3.2   66   20-88    124-190 (637)
430 PF07714 Pkinase_Tyr:  Protein   23.7 2.1E+02  0.0045   22.6   5.3   27   39-66    127-153 (259)
431 COG5072 ALK1 Serine/threonine   22.8      62  0.0013   29.8   2.2   42   20-63    324-368 (488)
432 COG1465 Predicted alternative   22.7      52  0.0011   29.1   1.6   47   36-88    210-266 (376)
433 KOG0614|consensus               22.6      48   0.001   31.7   1.4   57    7-64    500-568 (732)
434 KOG1167|consensus               22.6      47   0.001   30.3   1.3   29   36-64    151-181 (418)
435 KOG0659|consensus               21.9      95  0.0021   27.2   3.0   38   28-67    115-152 (318)
436 PF15232 DUF4585:  Domain of un  21.5      86  0.0019   21.9   2.2   19   42-60      6-24  (75)
437 cd05076 PTK_Tyk2_rpt1 Pseudoki  21.5 3.5E+02  0.0077   21.5   6.3   25   39-64    141-172 (274)
438 PLN02756 S-methyl-5-thioribose  21.3      66  0.0014   29.3   2.0   27   36-64    232-258 (418)
439 cd05078 PTK_Jak2_Jak3_rpt1 Pse  21.2 3.7E+02  0.0081   20.9   6.3   28   39-67    124-159 (258)
440 cd08226 PK_STRAD_beta Pseudoki  20.9 1.8E+02  0.0039   24.0   4.5   26   39-65    125-150 (328)
441 PRK05618 50S ribosomal protein  20.9      64  0.0014   26.0   1.7   31   48-82     81-111 (197)
442 cd05043 PTK_Ryk Pseudokinase d  20.4      61  0.0013   25.7   1.5   25   39-64    141-165 (280)
443 KOG1165|consensus               20.3      79  0.0017   28.7   2.3   28   38-65    147-178 (449)

No 1  
>cd00894 PI3Kc_IB_gamma Phosphoinositide 3-kinase (PI3K), class IB, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and 
Probab=100.00  E-value=1.6e-43  Score=308.77  Aligned_cols=151  Identities=25%  Similarity=0.264  Sum_probs=136.8

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCC-CCCCCc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPF   79 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~-~E~vPF   79 (165)
                      |++||.+.++++++|..+++||++|||+|||+||||||||||++||||+ ++|+++|||||++||+.++++++ ||+|||
T Consensus       179 l~~~l~~~~~~~~~~~~a~~nFi~S~AgYsV~tYiLGIgDRHndNImi~-~~G~lfHIDFG~ilg~~~~~~gi~~E~~PF  257 (365)
T cd00894         179 LSHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMIT-ETGNLFHIDFGHILGNYKSFLGINKERVPF  257 (365)
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHHHHhHHHHHHHHhccccCccccceeEc-CCCCEEEEeeHHhhCCCCccCCCCCCCCCe
Confidence            4689999999999999999999999999999999999999999999999 79999999999999999877776 999999


Q ss_pred             ccCHHHHHhhCCC---CchhHHHHHHHHHHHHHHhhh---------hhccccCCCchhhh---hhhhcceeeccchhhhh
Q psy18027         80 RLTPHILAVNEPY---GSQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQKIL---EQKQYLWFIQINVTAMS  144 (165)
Q Consensus        80 RLT~~~~~~mg~~---g~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k~~---~~~~~~~~~~~~~~~~~  144 (165)
                      |||++|+++||+.   +++.|..|++.|+.+++++|+         ++|+++|+||.+..   +.++.+|.++.++++|.
T Consensus       258 kLT~e~v~vmg~~gg~~s~~f~~F~~~c~~a~~~LRk~~~lil~L~~lM~~sgip~l~~~~~i~~l~~~~~l~~se~eA~  337 (365)
T cd00894         258 VLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAK  337 (365)
T ss_pred             eecHHHHHHhCccCCcCChhHHHHHHHHHHHHHHHHhhHHHHHHHHHHHhcCCCcccCcchHHHHHHHHhCCCCCHHHHH
Confidence            9999999999955   456789999999999999997         37899999999754   44568999999999999


Q ss_pred             hCCCCCcc
Q psy18027        145 HQPKMKEP  152 (165)
Q Consensus       145 ~yp~~~~~  152 (165)
                      .|..+.+.
T Consensus       338 ~~f~~~I~  345 (365)
T cd00894         338 KHFLDQIE  345 (365)
T ss_pred             HHHHHHHH
Confidence            88877665


No 2  
>cd05165 PI3Kc_I Phosphoinositide 3-kinase (PI3K), class I, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. In vitro, they can also phosphorylate the substrates P
Probab=100.00  E-value=7.3e-43  Score=304.86  Aligned_cols=151  Identities=25%  Similarity=0.247  Sum_probs=136.9

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCC-CCCCCc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPF   79 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~-~E~vPF   79 (165)
                      |.+||.+.++++++|.++++||++|||+|||+||||||||||++||||+ ++|+++|||||++||+.++.+++ ||+|||
T Consensus       179 l~~wl~~~~~~~~~~~~a~~nF~~S~AgysvvtYiLGigDRH~~NILi~-~~G~l~HIDFG~ilg~~~~~~~i~~E~~PF  257 (366)
T cd05165         179 LLHWLKEKNPTEEKLDAAIEEFTLSCAGYCVATFVLGIGDRHNDNIMVK-ETGQLFHIDFGHILGNYKSKFGINRERVPF  257 (366)
T ss_pred             HHHHHHhhCCCHHHHHHHHHHHHHHHHHHHHHHHHhhccccCCcceEEc-CCCCEEEEehHHhhccCCccCCCCCCCCCe
Confidence            4689999999899999999999999999999999999999999999999 69999999999999999988886 999999


Q ss_pred             ccCHHHHHhhCCC----CchhHHHHHHHHHHHHHHhhh---------hhccccCCCchhh---hhhhhcceeeccchhhh
Q psy18027         80 RLTPHILAVNEPY----GSQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQKI---LEQKQYLWFIQINVTAM  143 (165)
Q Consensus        80 RLT~~~~~~mg~~----g~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k~---~~~~~~~~~~~~~~~~~  143 (165)
                      |||++|+++||+.    ++++|..|++.|+.++.++|+         ++|+++++||++.   ++.++.+|.++.++++|
T Consensus       258 kLT~emv~~mg~~~~~~~s~~f~~F~~~c~~a~~~LR~~~~~il~l~~lM~~s~ip~~~~~~~i~~lr~rf~l~~se~eA  337 (366)
T cd05165         258 VLTPDFVHVIGRGKKDNTSEHFQRFQDLCEKAYLALRRHGNLLIILFSMMLMSGLPELTSKEDIEYLRDTLALGKSEEEA  337 (366)
T ss_pred             eecHHHHHHhcccCCcCCChhhhHHHHHHHHHHHHHHhCHHHHHHHHHHHhcCCCcccCchhHHHHHHHHhCCCCCHHHH
Confidence            9999999999974    467888999999999999997         3789999999974   44456899999999999


Q ss_pred             hhCCCCCcc
Q psy18027        144 SHQPKMKEP  152 (165)
Q Consensus       144 ~~yp~~~~~  152 (165)
                      ..|.++.+.
T Consensus       338 ~~~f~~~I~  346 (366)
T cd05165         338 LKYFLDKFN  346 (366)
T ss_pred             HHHHHHHHH
Confidence            988877665


No 3  
>cd05177 PI3Kc_C2_gamma Phosphoinositide 3-kinase (PI3K), class II, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do n
Probab=100.00  E-value=1.1e-42  Score=302.69  Aligned_cols=151  Identities=21%  Similarity=0.216  Sum_probs=136.7

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCC-CCCCCc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPF   79 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~-~E~vPF   79 (165)
                      |++||...++++++|.++++||++|||+|||+||||||||||++||||+ ++|+++|||||++||++++..++ +|++||
T Consensus       170 l~~~~~~~~~~~~~~~~a~~nF~~S~AgysvvtYiLGigDRHn~NILi~-~~G~~~HIDFG~ilg~~~~~~~~~~E~~PF  248 (354)
T cd05177         170 IEKWFHMHNKLKEDYDKAVRNFFHSCAGWCVVTFILGVCDRHNDNIMLT-HSGHMFHIDFGKFLGHAQTFGSIKRDRAPF  248 (354)
T ss_pred             HHHHHHHhCCChHHHHHHHHHHHHHHHHHHHHHHHhcccCcCCCceeEc-CCCCEEEEehHHhcCCCccccCCCcCCCCe
Confidence            4689999999999999999999999999999999999999999999999 89999999999999999866555 999999


Q ss_pred             ccCHHHHHhh--CCCCchhHHHHHHHHHHHHHHhhh---------hhccccCCCchhhhhh---hhcceeeccchhhhhh
Q psy18027         80 RLTPHILAVN--EPYGSQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQKILEQ---KQYLWFIQINVTAMSH  145 (165)
Q Consensus        80 RLT~~~~~~m--g~~g~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k~~~~---~~~~~~~~~~~~~~~~  145 (165)
                      |||++|++++  |+.++++|..|++.|+.++.++|+         ++|+++++||++..++   ++.+|.++.++++|..
T Consensus       249 ~LT~emv~~~~~GG~~s~~f~~F~~~c~~a~~~lR~~~~~il~l~~lm~~s~iP~~~~~~~i~~l~~~~~l~~sd~eA~~  328 (354)
T cd05177         249 IFTSEMEYFITEGGKKPQRFQRFVELCCRAYNIVRKHSQLLLNLLEMMLHAGLPELKDIQDLKYVYNNLRPQDTDLEATS  328 (354)
T ss_pred             eccHHHHHHhcCCCCCchhHHHHHHHHHHHHHHHHhhHHHHHHHHHHHhcCCCcccCcchHHHHHHHHhCCCCCHHHHHH
Confidence            9999999866  666688999999999999999997         3789999999976544   4579999999999999


Q ss_pred             CCCCCcc
Q psy18027        146 QPKMKEP  152 (165)
Q Consensus       146 yp~~~~~  152 (165)
                      |..+.+.
T Consensus       329 ~f~~lI~  335 (354)
T cd05177         329 YFTKKIK  335 (354)
T ss_pred             HHHHHHH
Confidence            9888776


No 4  
>cd00891 PI3Kc Phosphoinositide 3-kinase (PI3K), catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms c
Probab=100.00  E-value=1.1e-42  Score=302.77  Aligned_cols=151  Identities=27%  Similarity=0.323  Sum_probs=138.4

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCC-CCCCCc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPF   79 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~-~E~vPF   79 (165)
                      |++|+.+.++++++|.++|+||++|||+|||+||||||||||++||||+ ++|+++|||||++||+.++.+++ ||+|||
T Consensus       170 l~~~~~~~~~~~~~~~~a~~nF~~S~A~ysv~~YiLgigDRH~~NILi~-~~G~~~HIDFG~ilg~~~~~~~~~~E~~PF  248 (352)
T cd00891         170 LMNWLKKKNKGEEDYEKAVENFTYSCAGYCVATYVLGIGDRHNDNIMLT-KTGHLFHIDFGHFLGNFKKKFGIKRERAPF  248 (352)
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHhhhHHHHHHHHHHccccccCCCceEEC-CCCCEEEEehHHhhccCCccCCCCCCCCCe
Confidence            4689999999999999999999999999999999999999999999999 79999999999999998877775 999999


Q ss_pred             ccCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhh---------hhccccCCCchhhhhh---hhcceeeccchhhhhhCC
Q psy18027         80 RLTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQKILEQ---KQYLWFIQINVTAMSHQP  147 (165)
Q Consensus        80 RLT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k~~~~---~~~~~~~~~~~~~~~~yp  147 (165)
                      |||++|+++||+.|++.+..|++.|+.++.++|+         +.|+++++||++..++   ++.+|.++.++++|..|.
T Consensus       249 rLT~~mv~~mGg~~s~~~~~F~~~c~~~~~~LR~~~~~il~l~~lm~~~~lp~~~~~~~i~~l~~r~~l~~s~~~a~~~~  328 (352)
T cd00891         249 VLTPDMAYVMGGGDSEKFQRFEDLCCKAYNILRKHGNLFINLFSLMLSAGIPELQSIEDIEYLRDALALDKSDEEATEYF  328 (352)
T ss_pred             eecHHHHHHhCCCCCcccchHHHHHHHHHHHHhcCHHHHHHHHHhhccCCCCccCcHHHHHHHHHHhCCCCCHHHHHHHH
Confidence            9999999999999999888999999999999997         3788999999975444   557999999999999988


Q ss_pred             CCCcc
Q psy18027        148 KMKEP  152 (165)
Q Consensus       148 ~~~~~  152 (165)
                      .+.+.
T Consensus       329 ~~lI~  333 (352)
T cd00891         329 RKLIH  333 (352)
T ss_pred             HHHHH
Confidence            77665


No 5  
>cd00895 PI3Kc_C2_beta Phosphoinositide 3-kinase (PI3K), class II, beta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do not
Probab=100.00  E-value=3.5e-42  Score=299.16  Aligned_cols=152  Identities=25%  Similarity=0.239  Sum_probs=136.0

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCC-CCCCCc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPF   79 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~-~E~vPF   79 (165)
                      |.+||.+.+|++++|.++++||++|||+|||+||||||||||++||||+ ++||++|||||++||+.+++.++ +|++||
T Consensus       170 l~~~l~~~~~~~~~~~~a~~nFi~S~AgYsV~tYiLgIgDRHndNImi~-~~GhlfHIDFG~iLg~~~~~g~~~re~~PF  248 (354)
T cd00895         170 LADWLQKHNPTEDEYEKAVENFIYSCAGCCVATYVLGICDRHNDNIMLK-TTGHMFHIDFGRFLGHAQMFGNIKRDRAPF  248 (354)
T ss_pred             HHHHHHHhCCChHHHHHHHHHHHHHHHHHHHHHHHccccccCCCceeEc-CCCCEEEEeeHHhcCCCcccCCCCcCCCCc
Confidence            4689999999999999999999999999999999999999999999999 89999999999999999855444 899999


Q ss_pred             ccCHHHHHhhCCC--CchhHHHHHHHHHHHHHHhhh---------hhccccCCCchhhhhh---hhcceeeccchhhhhh
Q psy18027         80 RLTPHILAVNEPY--GSQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQKILEQ---KQYLWFIQINVTAMSH  145 (165)
Q Consensus        80 RLT~~~~~~mg~~--g~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k~~~~---~~~~~~~~~~~~~~~~  145 (165)
                      +||++|+++||+.  .+++|..|++.|+.++.++|+         ++|+++|+||.+..++   ++.+|.++.++++|..
T Consensus       249 ~Lt~emv~vm~gg~~~S~~f~~F~~lc~~ay~~lRk~~~~il~L~~lM~~sgiP~l~~~~~i~~l~~rf~l~~se~eA~~  328 (354)
T cd00895         249 VFTSDMAYVINGGDKPSSRFHDFVDLCCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEADATT  328 (354)
T ss_pred             cccHHHHHHhcCCCCCChhHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHcCCCcccCcchHHHHHHHHhCCCCCHHHHHH
Confidence            9999999999753  368899999999999999997         3789999999976554   4579999999999999


Q ss_pred             CCCCCccc
Q psy18027        146 QPKMKEPI  153 (165)
Q Consensus       146 yp~~~~~~  153 (165)
                      |..+.+..
T Consensus       329 ~f~~lI~~  336 (354)
T cd00895         329 YFTRLIES  336 (354)
T ss_pred             HHHHHHHH
Confidence            88777663


No 6  
>cd00893 PI4Kc_III Phosphoinositide 4-kinase (PI4K), Type III, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. There are two types of PI4Ks, types II and III. Type II PI4Ks lack the characteristic catalytic kinase domain present in PI3Ks and type III PI4Ks, and are excluded from this family. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes.
Probab=100.00  E-value=5.5e-42  Score=291.52  Aligned_cols=151  Identities=18%  Similarity=0.163  Sum_probs=135.4

Q ss_pred             ChHHHhccCC--CchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCC
Q psy18027          1 MREGLLSVAK--SPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMP   78 (165)
Q Consensus         1 L~~~f~~~~~--~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vP   78 (165)
                      |++||.+.++  ++++|.++|++|++|||+|||+||||||||||++||||+ ++|+++|||||++||++|+..-.+|+||
T Consensus       104 l~~~~~~~~~~~~~~~~~~a~~nF~~SlA~ySvv~YiLgigDRH~~NILid-~~G~liHIDFG~ilg~~p~~~~~~E~~P  182 (289)
T cd00893         104 LYDYFLELYGSYTTEAFLQARYNFIESMAGYSLLCYLLQIKDRHNGNILLD-SDGHIIHIDFGFILDSSPGNNLGFEPAA  182 (289)
T ss_pred             HHHHHHHHcCCCCcHHHHHHHHHHHHHHHHHHHHHHHhhccccCCCceEEC-CCCCEEEEehHHhhCcCCcCCCCCCCCC
Confidence            4678888886  578899999999999999999999999999999999999 6999999999999999987633479999


Q ss_pred             cccCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhh---------hhccccCCCchh--hhhhhhcceeeccchhhhhhCC
Q psy18027         79 FRLTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQK--ILEQKQYLWFIQINVTAMSHQP  147 (165)
Q Consensus        79 FRLT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k--~~~~~~~~~~~~~~~~~~~~yp  147 (165)
                      ||||++|+++||+.++++|..|++.|+.++.++|+         +.|+.+++||++  .+..++.++.++.++++|..|.
T Consensus       183 FrLT~emv~~mGg~~s~~f~~F~~~c~~~~~~lR~~~~~il~ll~~m~~~~lp~~~~~~i~~l~~r~~l~~s~~~a~~~~  262 (289)
T cd00893         183 FKFTKEMVDFMGGKKSDDFKKFRYLCLRGFIAVRKHMDLVISLVYLLIFSGLPCFRGSTIKKLKERLCLNMSEKEAINTV  262 (289)
T ss_pred             eeecHHHHHHhCCCCChhHHHHHHHHHHHHHHHhhCHHHHHHHHHHHccCCCcccCHHHHHHHHHHcCCCCCHHHHHHHH
Confidence            99999999999999999999999999999999997         378999999996  3344568999999999999988


Q ss_pred             CCCcc
Q psy18027        148 KMKEP  152 (165)
Q Consensus       148 ~~~~~  152 (165)
                      .+.+.
T Consensus       263 ~~lI~  267 (289)
T cd00893         263 MKKID  267 (289)
T ss_pred             HHHHH
Confidence            77665


No 7  
>cd05176 PI3Kc_C2_alpha Phosphoinositide 3-kinase (PI3K), class II, alpha isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do n
Probab=100.00  E-value=3.9e-42  Score=298.82  Aligned_cols=151  Identities=24%  Similarity=0.241  Sum_probs=135.3

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCC-CCCCCc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPF   79 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~-~E~vPF   79 (165)
                      |.+|+...+|++++|.++|+||++|||+|||+||||||||||++||||+ ++|+++|||||++||++++..++ +|++||
T Consensus       169 l~~~l~~~~~~~~~~~~a~~nFi~S~AgYsv~tYiLGIgDRHn~NILi~-~~Ghl~HIDFG~ilg~~~~~g~~~~e~~PF  247 (353)
T cd05176         169 LAEWLRKYNPAEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLR-STGHMFHIDFGKFLGHAQMFGSFKRDRAPF  247 (353)
T ss_pred             HHHHHHHhCCChHHHHHHHHHHHHHHHHHHHHhhhccccCcCCcceEEc-CCCCEEEEeeHHhcCCCccccCCCCCCCCe
Confidence            3579999899999999999999999999999999999999999999999 89999999999999999855544 999999


Q ss_pred             ccCHHHHHhhCCCC--chhHHHHHHHHHHHHHHhhh---------hhccccCCCchhhhhh---hhcceeeccchhhhhh
Q psy18027         80 RLTPHILAVNEPYG--SQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQKILEQ---KQYLWFIQINVTAMSH  145 (165)
Q Consensus        80 RLT~~~~~~mg~~g--~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k~~~~---~~~~~~~~~~~~~~~~  145 (165)
                      |||++|+++||+.+  +++|..|++.|+.+++++|+         ++|+++++||.+..++   ++.+|.++.++++|..
T Consensus       248 kLT~emv~~mgG~~~~s~~f~~F~~lc~~af~~LRk~~~~il~L~~lM~~s~iP~~~~~~~i~~l~~r~~l~~sd~ea~~  327 (353)
T cd05176         248 VLTSDMAYVINGGEKPTIRFQLFVDLCCQAYNLIRKHSNLFLNLLSLMTQSGLPELTGVQDLKYVYDALQPQTTDAEATI  327 (353)
T ss_pred             eecHHHHHHhcCCCCcchhHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhCCCCcccCCchHHHHHHHHhCCCCCHHHHHH
Confidence            99999999998644  35799999999999999997         3789999999976444   5679999999999999


Q ss_pred             CCCCCcc
Q psy18027        146 QPKMKEP  152 (165)
Q Consensus       146 yp~~~~~  152 (165)
                      |.++.+.
T Consensus       328 ~f~~lI~  334 (353)
T cd05176         328 FFTRLIE  334 (353)
T ss_pred             HHHHHHH
Confidence            9887765


No 8  
>cd05166 PI3Kc_II Phosphoinositide 3-kinase (PI3K), class II, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class II PI3Ks preferentially use PtdIns as a substrate to produce PtdIns(3)P, but can also phosphorylate PtdIns(4)P. They function as monomers and do not associate with any
Probab=100.00  E-value=7.3e-42  Score=297.60  Aligned_cols=151  Identities=23%  Similarity=0.263  Sum_probs=135.9

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCC-CCCCCc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPF   79 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~-~E~vPF   79 (165)
                      |++||...++++.+|.++|+||++|||+|||+||||||||||++||||+ ++|+++|||||++||++++..++ ||+|||
T Consensus       169 l~~~l~~~~~~~~~~~~a~~nF~~S~A~ysvv~YiLgigDRH~~NILl~-~~G~l~HIDFG~~lg~~~~~~~~~~E~~PF  247 (353)
T cd05166         169 IAKWLMKHNPSELEYEKAVENFIYSCAGCCVATYVLGICDRHNDNIMLT-KSGHMFHIDFGKFLGHAQMFGGFKRDRAPF  247 (353)
T ss_pred             HHHHHHHhCCChHHHHHHHHHHHhHHHHHHHHHHHhhccccCCCceEEC-CCCCEEEEeeHHhcccccccccCCCCCCCc
Confidence            4689999999999999999999999999999999999999999999999 79999999999999999866665 899999


Q ss_pred             ccCHHHHHhhCCC--CchhHHHHHHHHHHHHHHhhh---------hhccccCCCchhh---hhhhhcceeeccchhhhhh
Q psy18027         80 RLTPHILAVNEPY--GSQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQKI---LEQKQYLWFIQINVTAMSH  145 (165)
Q Consensus        80 RLT~~~~~~mg~~--g~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k~---~~~~~~~~~~~~~~~~~~~  145 (165)
                      |||++|+++||+.  +++.|..|++.|+.++.++|+         ++|+++++||++.   ++.++.+|.++.++++|..
T Consensus       248 rLT~emv~~~ggg~~~s~~~~~F~~~c~~~~~~lRk~~~~il~ll~~ml~s~lp~~~~~~~i~~l~~r~~l~~s~~ea~~  327 (353)
T cd05166         248 VFTSDMAYVINGGDKPTQRFQDFVDLCCRAYNIIRKHANLLLNLLRMMACSGLPELSKIQDLKYVRDALRPQLTDAEATI  327 (353)
T ss_pred             cccHHHHHHhcCCCCCcchHhHHHHHHHHHHHHHHcChHHHHHHHHHHhcCCCcccCchhHHHHHHHHhCCCCCHHHHHH
Confidence            9999999999865  357788999999999999997         3789999999974   4445689999999999999


Q ss_pred             CCCCCcc
Q psy18027        146 QPKMKEP  152 (165)
Q Consensus       146 yp~~~~~  152 (165)
                      |..+.+.
T Consensus       328 ~~~~~I~  334 (353)
T cd05166         328 QFTKMIQ  334 (353)
T ss_pred             HHHHHHH
Confidence            8877766


No 9  
>cd05168 PI4Kc_III_beta Phosphoinositide 4-kinase (PI4K), Type III, beta isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes. PI4KIIIbeta (also called Pik1p in yeast) is a 110 kDa protein that is localized to the Golgi and the nucleus. It is required for maintaining the structural integrity of the Golgi complex (GC), and is a key regulator of protein transport from the GC to the plasma membrane. PI4KII
Probab=100.00  E-value=9.9e-42  Score=290.46  Aligned_cols=150  Identities=20%  Similarity=0.191  Sum_probs=134.2

Q ss_pred             ChHHHhccCCCc-hHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCc
Q psy18027          1 MREGLLSVAKSP-MNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPF   79 (165)
Q Consensus         1 L~~~f~~~~~~~-~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPF   79 (165)
                      |++||.+.++++ ++|.++|+||++|||+|||+||||||||||++||||+ ++|+++|||||++||++++. ..+|+|||
T Consensus       107 l~~~f~~~~~~~~~~~~~a~~nF~~S~A~ySvv~YvLGigDRH~~NILi~-~~G~liHIDFG~~fg~~~~~-~~~E~vPF  184 (293)
T cd05168         107 LLDFFKKTFGDPSERFREAQKNFIESLAGYSLICYLLQIKDRHNGNILID-NDGHIIHIDFGFMLSNSPGN-VGFETAPF  184 (293)
T ss_pred             HHHHHHHHcCCCcHHHHHHHHHHHHHHHHHHHHHHHhhccccCCCceEEc-CCCCEEEEehHHhhcccccC-CCCCCCCE
Confidence            468999999874 6899999999999999999999999999999999999 59999999999999999966 44799999


Q ss_pred             ccCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh---------hcccc-CCCchh----hhhhhhcceeeccchhhhhh
Q psy18027         80 RLTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS---------FLLSV-GVYNQK----ILEQKQYLWFIQINVTAMSH  145 (165)
Q Consensus        80 RLT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~---------~~l~~-~~~~~k----~~~~~~~~~~~~~~~~~~~~  145 (165)
                      |||++|+++||+.+++.+..|++.|+.++.++|+.         .|+.. ++|+.+    ..+.+..++.++.++++|..
T Consensus       185 rLT~~mv~~mGg~~s~~~~~F~~~c~~~~~~LR~~~~~il~ll~~m~~~~~lp~f~~~~~~i~~l~~r~~l~~se~~a~~  264 (293)
T cd05168         185 KLTQEYIEVMGGVNSDLFNYFKKLFLKGFMALRKHVDRIILLVEIMQSDSKLPCFKAGEFTIQQLRDRFMLNLTEEQLEV  264 (293)
T ss_pred             EecHHHHHHhCCCCCchhHHHHHHHHHHHHHHHhchHHHHHHHHHHccCCCCccccCchHHHHHHHHHhCCCCCHHHHHH
Confidence            99999999999999999999999999999999973         56666 999987    45666789999999999988


Q ss_pred             CCCCCcc
Q psy18027        146 QPKMKEP  152 (165)
Q Consensus       146 yp~~~~~  152 (165)
                      |..+.+.
T Consensus       265 ~~~~lI~  271 (293)
T cd05168         265 FVDELIN  271 (293)
T ss_pred             HHHHHHH
Confidence            8776655


No 10 
>cd05174 PI3Kc_IA_delta Phosphoinositide 3-kinase (PI3K), class IA, delta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and 
Probab=100.00  E-value=9.2e-42  Score=297.31  Aligned_cols=153  Identities=22%  Similarity=0.268  Sum_probs=134.0

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCC-CCCCCc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPF   79 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~-~E~vPF   79 (165)
                      |.+||.+.+|+ +.|.+++++|++|||+|||+||||||||||++||||+ ++|+++|||||++||+.++.+++ ||+|||
T Consensus       176 l~~~l~~~~~~-~~~~~A~~nF~~S~AgysVvtYiLGIGDRHn~NILi~-~~G~l~HIDFG~ilg~~~~~~~~~~E~vPF  253 (361)
T cd05174         176 LLNWLKSKNPG-DALDQAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIR-ESGQLFHIDFGHFLGNFKTKFGINRERVPF  253 (361)
T ss_pred             HHHHHHhcCCc-HHHHHHHHHHHHHHHHHHHHHHHhcccCcCccceeEc-CCCCEEEEehHHhhcCCcccCCCCCCCCCe
Confidence            35789888876 5788899999999999999999999999999999999 79999999999999998877765 999999


Q ss_pred             ccCHHHHHhhCC---CCchhHHHHHHHHHHHHHHhhh---------hhccccCCCchhh---hhhhhcceeeccchhhhh
Q psy18027         80 RLTPHILAVNEP---YGSQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQKI---LEQKQYLWFIQINVTAMS  144 (165)
Q Consensus        80 RLT~~~~~~mg~---~g~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k~---~~~~~~~~~~~~~~~~~~  144 (165)
                      |||++|+++||+   .+++.|..|++.|+.++.++|+         ++|+++|+||.+.   ++.+..+|.++.++++|.
T Consensus       254 kLT~e~v~vmg~G~~~~s~~f~~F~~~c~~a~~~LRk~~~~il~l~~lM~~sgip~~~~~~~i~~l~~~~~l~~se~ea~  333 (361)
T cd05174         254 ILTYDFVHVIQQGKTNNSEKFERFRGYCEQAYKILRRHGTLFLHLFALMKAAGLPELNCSKDIQYLKDSLALGKTEEEAL  333 (361)
T ss_pred             eccHHHHHHHccCCCCCCchhhHHHHHHHHHHHHHHhhHHHHHHHHHHHhcCCCCccCchhHHHHHHHHhCCCCCHHHHH
Confidence            999999999974   3467788999999999999997         3789999999865   444568999999999999


Q ss_pred             hCCCCCcccch
Q psy18027        145 HQPKMKEPIIL  155 (165)
Q Consensus       145 ~yp~~~~~~~~  155 (165)
                      .+.++++...+
T Consensus       334 ~~f~~~i~~s~  344 (361)
T cd05174         334 KHFRVKFNEAL  344 (361)
T ss_pred             HHHHHHHHHHH
Confidence            88888776444


No 11 
>cd05175 PI3Kc_IA_alpha Phosphoinositide 3-kinase (PI3K), class IA, alpha isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and 
Probab=100.00  E-value=1e-41  Score=297.08  Aligned_cols=150  Identities=21%  Similarity=0.230  Sum_probs=132.8

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCC-CCCCCc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPF   79 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~-~E~vPF   79 (165)
                      |.+|+...++ .+.|.++|+||++|||+|||+||||||||||++||||+ ++|+++|||||++||++++.+++ ||++||
T Consensus       179 l~~~l~~~~~-~~~~~~a~~nF~~S~AgYsV~tYiLGIgDRHndNImi~-~~G~l~HIDFG~iLg~~p~~~~~~~E~~PF  256 (366)
T cd05175         179 LHQWLKDKNK-GEMYDAAIDLFTRSCAGYCVATFILGIGDRHNSNIMVK-DDGQLFHIDFGHFLDHKKKKFGYKRERVPF  256 (366)
T ss_pred             HHHHHhhcCC-cHHHHHHHHHHHHHHHHHHHHHHHhcccccCccceeEc-CCCCEEEEehHHhhcCCCccCCCCCCCCCe
Confidence            3578887765 46799999999999999999999999999999999999 79999999999999999987765 999999


Q ss_pred             ccCHHHHHhhCCC-----CchhHHHHHHHHHHHHHHhhh---------hhccccCCCchhhhhh---hhcceeeccchhh
Q psy18027         80 RLTPHILAVNEPY-----GSQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQKILEQ---KQYLWFIQINVTA  142 (165)
Q Consensus        80 RLT~~~~~~mg~~-----g~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k~~~~---~~~~~~~~~~~~~  142 (165)
                      |||++|+.+||+.     +++.|..|+.+|+.++.++|+         ++|+++|+||.+..++   ++.+|.++.++++
T Consensus       257 kLT~emv~v~~gg~~~~~~s~~f~~F~~lc~~ay~~lRk~~~~ii~L~~lM~~sgiP~l~~~~~i~~lr~rf~l~~sd~e  336 (366)
T cd05175         257 VLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQE  336 (366)
T ss_pred             EecHHHHHHhccCCccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCcccCCccHHHHHHHhcCCCCCHHH
Confidence            9999999999753     468899999999999999997         3789999999976554   5579999999999


Q ss_pred             hhhCCCCCcc
Q psy18027        143 MSHQPKMKEP  152 (165)
Q Consensus       143 ~~~yp~~~~~  152 (165)
                      |..|..+.+-
T Consensus       337 A~~~f~~~I~  346 (366)
T cd05175         337 ALEYFMKQMN  346 (366)
T ss_pred             HHHHHHHHHH
Confidence            9988877654


No 12 
>cd05167 PI4Kc_III_alpha Phosphoinositide 4-kinase (PI4K), Type III, alpha isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes. PI4KIIIalpha is a 220 kDa protein found in the plasma membrane and the endoplasmic reticulum (ER). The role of PI4KIIIalpha in the ER remains unclear. In the plasma membrane, it provides PtdIns(4)P, which is then converted by PI5Ks to PtdIns(4,5)P2, an important signaling mole
Probab=100.00  E-value=1.8e-41  Score=290.79  Aligned_cols=151  Identities=19%  Similarity=0.221  Sum_probs=133.9

Q ss_pred             ChHHHhccCCC--chHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCC
Q psy18027          1 MREGLLSVAKS--PMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMP   78 (165)
Q Consensus         1 L~~~f~~~~~~--~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vP   78 (165)
                      |.+||.+.+++  +.+|..+|+||++|||+|||+||||||||||++||||+ .+|+++|||||++||++|+..-.+|+||
T Consensus       125 l~~~f~~~~~~~~~~~~~~a~~nF~~S~Agysv~tYiLgigDRHn~NILid-~~G~l~HIDFG~il~~~p~~~~~~E~~P  203 (311)
T cd05167         125 LYEYFTSKYGDESSLAFQKARENFIRSMAAYSLISYLLQIKDRHNGNIMID-DDGHIIHIDFGFIFEISPGGNLKFESAP  203 (311)
T ss_pred             HHHHHHHHcCCCCcHHHHHHHHHHHHHHHHHHHHHHHhhccccCccceEEc-CCCCEEEEeeHHhhccCCCCCCCcCCCC
Confidence            46899998864  57999999999999999999999999999999999999 6999999999999999986533479999


Q ss_pred             cccCHHHHHhhCCCC-chhHHHHHHHHHHHHHHhhh---------hhccccCCCchh--hhhhhhcceeeccchhhhhhC
Q psy18027         79 FRLTPHILAVNEPYG-SQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQK--ILEQKQYLWFIQINVTAMSHQ  146 (165)
Q Consensus        79 FRLT~~~~~~mg~~g-~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k--~~~~~~~~~~~~~~~~~~~~y  146 (165)
                      ||||++|+++||+.+ ++.|..|++.|+.++.++|+         ++|+++++||++  .++.++.+|.++.++++|..|
T Consensus       204 FkLT~emv~~mGg~~~s~~f~~F~~~~~~~~~~lR~~~~~il~l~~lm~~s~lp~~~~~~i~~l~~rf~l~~se~~a~~~  283 (311)
T cd05167         204 FKLTKEMVQIMGGSMEATPFKWFVELCVRAFLAVRPYMDEIVSLVELMLDSGLPCFRGDTIKNLRQRFAPEKSEREAAEF  283 (311)
T ss_pred             EeecHHHHHHhCCCCcchhHHHHHHHHHHHHHHHHcCHHHHHHHHHHHHcCCchhhhHHHHHHHHHHhCCCCCHHHHHHH
Confidence            999999999999999 77899999999999999997         378999999986  234456899999999999988


Q ss_pred             CCCCcc
Q psy18027        147 PKMKEP  152 (165)
Q Consensus       147 p~~~~~  152 (165)
                      ..+.+.
T Consensus       284 ~~~lI~  289 (311)
T cd05167         284 MLSLIA  289 (311)
T ss_pred             HHHHHH
Confidence            776654


No 13 
>cd05173 PI3Kc_IA_beta Phosphoinositide 3-kinase (PI3K), class IA, beta isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and de
Probab=100.00  E-value=4.6e-41  Score=293.17  Aligned_cols=150  Identities=25%  Similarity=0.298  Sum_probs=130.8

Q ss_pred             hHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCC-CCCCCcc
Q psy18027          2 REGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPFR   80 (165)
Q Consensus         2 ~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~-~E~vPFR   80 (165)
                      .+||.+.++ +++|..+++||++|||+|||+||||||||||++||||+ ++|+++|||||++||+.++.+++ ||+||||
T Consensus       177 ~~~l~~~~~-~~~~~~a~~nF~~S~AgYsvvtYILGIGDRHn~NILi~-~~G~l~HIDFG~ilg~~~~~~~~~~E~vPFk  254 (362)
T cd05173         177 LNWLKEYNS-GDDLERAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVR-KNGQLFHIDFGHILGNFKSKFGIKRERVPFI  254 (362)
T ss_pred             HHHHHhcCC-cHHHHHHHHHHHHHHHHHHHHHHHhhccccCCCceEEC-CCCCEEEEehHHhhccCCcccCCCCCCCCee
Confidence            578877544 46788899999999999999999999999999999999 79999999999999998777765 9999999


Q ss_pred             cCHHHHHhhCC--CC-chhHHHHHHHHHHHHHHhhh---------hhccccCCCchhhhh---hhhcceeeccchhhhhh
Q psy18027         81 LTPHILAVNEP--YG-SQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQKILE---QKQYLWFIQINVTAMSH  145 (165)
Q Consensus        81 LT~~~~~~mg~--~g-~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k~~~---~~~~~~~~~~~~~~~~~  145 (165)
                      ||++|+++||.  .| ++.|..|++.|+.++.++|+         ++|+++++||.+..+   .++.+|.++.++++|..
T Consensus       255 LT~emv~vm~~G~~g~s~~~~~F~~~c~~a~~~LRk~~~lil~l~~lM~~s~ip~~~~~~~i~~l~~r~~l~~se~eA~~  334 (362)
T cd05173         255 LTYDFIHVIQQGKTGNTEKFGRFRQYCEDAYLILRKNGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALK  334 (362)
T ss_pred             ecHHHHHHHhcCCCCCCcchhHHHHHHHHHHHHHHhhHHHHHHHHHHHhcCCCccccchhHHHHHHHhcCCCCCHHHHHH
Confidence            99999999962  23 46688899999999999997         378999999996644   45689999999999998


Q ss_pred             CCCCCccc
Q psy18027        146 QPKMKEPI  153 (165)
Q Consensus       146 yp~~~~~~  153 (165)
                      +.++.+-.
T Consensus       335 ~f~~~i~~  342 (362)
T cd05173         335 QFRQKFDE  342 (362)
T ss_pred             HHHHHHHH
Confidence            88877663


No 14 
>cd00896 PI3Kc_III Phosphoinositide 3-kinase (PI3K), class III, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the Ras pathway, vesicle trafficking and secretion, immune cell activation and apoptosis. They can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class III PI3Ks, also called Vps34 (vacuolar protein sorting 34), contain an N-terminal lipid binding C2 domain, a PI3K homology domain of unknown function, and a C-termin
Probab=100.00  E-value=1.7e-40  Score=288.68  Aligned_cols=147  Identities=23%  Similarity=0.353  Sum_probs=134.1

Q ss_pred             ChHHHhccCCCchH----HHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCC
Q psy18027          1 MREGLLSVAKSPMN----RVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPEL   76 (165)
Q Consensus         1 L~~~f~~~~~~~~~----~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~   76 (165)
                      +.+||.+.++++..    |.++|+||++|||+|||+||||||||||++||||+ ++|+++|||||++||++++    |+.
T Consensus       165 l~~~l~~~~~~~~~~~~~~~~a~~nF~~S~A~ysvv~YiLGigDRH~~NILi~-~~G~~~HIDFG~ilg~~p~----~~~  239 (350)
T cd00896         165 ILNYLRKLNPDDGGPLGISPEVMDTFVKSCAGYCVITYILGVGDRHLDNLLLT-KDGKLFHIDFGYILGRDPK----PFP  239 (350)
T ss_pred             HHHHHHHHCCCccccccchHHHHHHHHHHHHHHHHHHHHhcccccCCCcEEEc-CCCCEEEEEhHHhhCCCCC----CCC
Confidence            46899999998877    57999999999999999999999999999999999 7999999999999999985    567


Q ss_pred             CCcccCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhh---------hhccccCCCchh-----hhhhhhcceeeccchhh
Q psy18027         77 MPFRLTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQK-----ILEQKQYLWFIQINVTA  142 (165)
Q Consensus        77 vPFRLT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k-----~~~~~~~~~~~~~~~~~  142 (165)
                      ||||||++|+++||+.|++||..|++.|+.++.++|+         +.|+++++||++     .++.++.+|.++.++++
T Consensus       240 ~PFrLT~~mv~~mGg~~s~~~~~F~~~c~~~~~~lR~~~~~il~l~~lm~~~~ip~~~~~~~~~i~~l~~rf~l~~s~~e  319 (350)
T cd00896         240 PPMKLCKEMVEAMGGAQSEGYQEFKSYCCEAYNILRKSANLILNLFSLMVDANIPDIALDPDKAILKVQEKFRLDLSDEE  319 (350)
T ss_pred             CCeeccHHHHHHhCCCCCcchHHHHHHHHHHHHHHHhCHHHHHHHHHHHcCCCCcccccCHHHHHHHHHHHhCCCCCHHH
Confidence            9999999999999999999999999999999999997         378999999975     56667789999999999


Q ss_pred             hhhCCCCCcc
Q psy18027        143 MSHQPKMKEP  152 (165)
Q Consensus       143 ~~~yp~~~~~  152 (165)
                      |..|..+.+.
T Consensus       320 a~~~~~~lI~  329 (350)
T cd00896         320 AIKHFQNLIN  329 (350)
T ss_pred             HHHHHHHHHH
Confidence            9988877665


No 15 
>cd05172 PIKKc_DNA-PK DNA-dependent protein kinase (DNA-PK), catalytic domain; The DNA-PK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. DNA-PK is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). DNA-PK is comprised of a regulatory subunit, containing the Ku70/80 subunit, and a catalytic subunit, which contains a NUC194 domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. It is part of a multi-component system involved in non-homologous end joining (NHEJ), a process of repairing double st
Probab=100.00  E-value=2.3e-40  Score=274.09  Aligned_cols=122  Identities=44%  Similarity=0.724  Sum_probs=114.0

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      |++||++.++++++|+.+|++|++|+|+||++|||||||||||+||||+++||+++|||||++|+++++.+++||.||||
T Consensus       103 l~~~~~~~~~~~~~~~~~r~~F~~S~A~~S~~~YilglgDRH~~NIli~~~tG~v~HIDfg~~f~~~~~~~~~pE~vPFR  182 (235)
T cd05172         103 LRRALVEMSASPEAFLSLRDHFAKSLAAMCVSHWILGIGDRHLSNFLVDLETGGLVGIDFGHAFGTATQFLPIPELMPFR  182 (235)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHhheeeccCCCcccEEEECCCCcEEEEeeHhhhccCCccCCCCCCCCee
Confidence            47899999999999999999999999999999999999999999999999999999999999999999889999999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh-----hccccCCCch
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS-----FLLSVGVYNQ  124 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~-----~~l~~~~~~~  124 (165)
                      |||||+++||+.|++|.  |+..|+.+...+|++     .++++.+.|+
T Consensus       183 LT~~~~~~~g~~g~~G~--f~~~~~~~~~~Lr~~~~~l~~~l~~f~~dp  229 (235)
T cd05172         183 LTPQFVNLMEPMKADGL--LRSCMVHTLRALRNERHLLLSTMDVFVKEP  229 (235)
T ss_pred             eCHHHHHHhCCCCCCCh--HHHHHHHHHHHHHcCHHHHHHHHHHHhhCc
Confidence            99999999999999997  899999999999963     4566666665


No 16 
>cd05169 PIKKc_TOR TOR (Target of rapamycin), catalytic domain; The TOR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TOR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). TOR contains a rapamycin binding domain, a catalytic domain, and a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. It is also called FRAP (FK506 binding protein 12-rapamycin associated protein). TOR is a central component of the eukaryotic growth regulatory network. It controls the expression of many genes transcribed by all three RNA polymerases. It associates with 
Probab=100.00  E-value=4.1e-40  Score=277.56  Aligned_cols=122  Identities=32%  Similarity=0.485  Sum_probs=112.6

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      |++||+..++++++|+.+|++|++|+|+||++|||||||||||+||||++.||+++|||||++|+++++.+++||.||||
T Consensus       148 l~~~~~~~~~~~~~w~~~r~~F~~S~A~~Sv~~YilglgDRH~~NIll~~~tG~v~HIDfg~~f~~~~~~~~~pE~VPFR  227 (280)
T cd05169         148 LRKILWLKSPSSEAWLERRTNFTRSLAVMSMVGYILGLGDRHPSNIMIDRLTGKVIHIDFGDCFEVAMHREKFPEKVPFR  227 (280)
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHHHHHHHHHHHHhheeccCCCcceEEEEcCCCCEEEEecHHHHhhccccCCCCCcCCcc
Confidence            47899999999999999999999999999999999999999999999998899999999999999998767889999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh-----hccccCCCch
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS-----FLLSVGVYNQ  124 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~-----~~l~~~~~~~  124 (165)
                      |||||+++||+.|++|.  |+..|+.++.++|++     .++++.+.|+
T Consensus       228 LT~~~~~~lG~~g~~G~--F~~~~~~~~~~Lr~~~~~l~~~l~~f~~dp  274 (280)
T cd05169         228 LTRMLVNALGVSGIEGT--FRTTCEDVMNVLRENKESLMAVLEAFVHDP  274 (280)
T ss_pred             cCHHHHHHhCCCCCCCc--hHHHHHHHHHHHhcChHHHHHHHHHHHhCc
Confidence            99999999999999996  899999999999963     4556666655


No 17 
>cd05171 PIKKc_ATM Ataxia telangiectasia mutated (ATM), catalytic domain; The ATM catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATM is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATM contains a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. ATM is critical in the response to DNA double strand breaks (DSBs) caused by radiation. It is activated at the site of a DSB and phosphorylates key substrates that trigger pathways that regulate DNA repair and cell cycle checkpoints at the G1/S, S phase, and G2/M transi
Probab=100.00  E-value=7.7e-39  Score=270.46  Aligned_cols=121  Identities=34%  Similarity=0.500  Sum_probs=111.7

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      |++||+..++++++|+.+|++|++|+|++|++|||||||||||+||||++.||+++|||||++|+++++ +++||.||||
T Consensus       148 l~~~f~~~~~~~~~~~~~r~~F~~S~A~~s~~~yilglgDRh~~NIll~~~tG~v~hiDf~~~f~~~~~-l~~pe~vPFR  226 (279)
T cd05171         148 FRYFFLEKFLDPQDWFERRLAYTRSVATSSIVGYILGLGDRHANNILIDEKTAEVVHIDLGIAFEQGKI-LPVPETVPFR  226 (279)
T ss_pred             HHHHHHHHCcCHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCcccEEEEcCcCcEEEEechhhhccCcC-CCCCCcCChh
Confidence            478999999999999999999999999999999999999999999999999999999999999999985 8999999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh-----hccccCCCch
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS-----FLLSVGVYNQ  124 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~-----~~l~~~~~~~  124 (165)
                      |||||+++||+.|++|.  |+..|+.++.++|++     ..|++.+.|+
T Consensus       227 LT~~~~~~lg~~g~~g~--f~~~~~~~~~~Lr~~~~~l~~~l~~fv~dp  273 (279)
T cd05171         227 LTRDIVDGMGITGVEGV--FRRCCEKTLEVLRDNKDAILTILEVLLYDP  273 (279)
T ss_pred             hhHHHHHHhCCCCCcch--HHHHHHHHHHHHHcChHHHHHHHHHHHhCc
Confidence            99999999999999997  789999999999863     3455555554


No 18 
>cd00892 PIKKc_ATR ATR (Ataxia telangiectasia and Rad3-related), catalytic domain; The ATR catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. ATR is also referred to as Mei-41 (Drosophila), Esr1/Mec1p (Saccharomyces cerevisiae), Rad3 (Schizosaccharomyces pombe), and FRAP-related protein (human). ATR is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). ATR contains a UME domain of unknown function, a FAT (FRAP, ATM and TRRAP) domain, a catalytic domain, and a FATC domain at the C-terminus. Together with its downstream effector kinase, Chk1, ATR plays a central 
Probab=100.00  E-value=1.7e-38  Score=263.18  Aligned_cols=121  Identities=31%  Similarity=0.484  Sum_probs=111.2

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      |++||.++++++++|+.+|++|+.|+|+||++|||||||||||+|||+++.||+++|||||++|++++ .+++||.||||
T Consensus       106 l~~~~~~~~~~~~~~~~~~~~F~~SlA~~s~~~YilgigDRh~~NIli~~~tG~~~HIDfg~~~~~~~-~~~~pe~vPFR  184 (237)
T cd00892         106 FHEWFLENFPDPSAWLKARNAYTRSTAVMSMVGYILGLGDRHGENILFDSNTGDVVHVDFNCLFDKGE-TLEVPERVPFR  184 (237)
T ss_pred             HHHHHHHHCcCHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCcccEEEEcCCCcEEEEehHhhhcccc-cCCCCCCCCcc
Confidence            46899999999999999999999999999999999999999999999998899999999999999987 77899999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh-----hccccCCCch
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS-----FLLSVGVYNQ  124 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~-----~~l~~~~~~~  124 (165)
                      |||||+++||+.|++|.  |+..|+.++.++|++     .+++..+.|+
T Consensus       185 LT~~~~~~lg~~g~~g~--F~~~~~~~~~~Lr~~~~~l~~~l~~fi~dp  231 (237)
T cd00892         185 LTQNMVDAMGVLGVEGL--FRKSCEVTLRLLRSNKETLMSVLETFIHDP  231 (237)
T ss_pred             cCHHHHHHhCCCCCCCc--hHHHHHHHHHHHHhCHHHHHHHHHHHhhcc
Confidence            99999999999999996  899999999999964     3455555554


No 19 
>cd05164 PIKKc Phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily, catalytic domain; The PIKK catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members include ATM (Ataxia telangiectasia mutated), ATR (Ataxia telangiectasia and Rad3-related), TOR (Target of rapamycin), SMG-1 (Suppressor of morphogenetic effect on genitalia-1), and DNA-PK (DNA-dependent protein kinase). PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). They show strong preference for phosphorylating serine/threonine residues followed by a glutamine and are also referred to as (S/T)-Q-directed kinases. They all contain a FATC (FRAP, ATM and TRRAP, C-terminal) d
Probab=100.00  E-value=3.8e-38  Score=258.68  Aligned_cols=111  Identities=36%  Similarity=0.581  Sum_probs=106.2

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      |++||+..++++++|+.+|++|+.|+|++|+++||||+|||||+|||+++.||+++|||||++|++++ .+++||.||||
T Consensus        98 l~~~~~~~~~~~~~~~~~r~~F~~SlA~~s~~~YvlglgDRh~~NIli~~~tG~v~hIDf~~~~~~~~-~~~~~e~vPFR  176 (222)
T cd05164          98 LKKWFWLQFPDPEQWFAARKNYTRSTAVMSIVGYILGLGDRHLDNILIDRETGEVVHIDFGCIFEKGK-TLPVPELVPFR  176 (222)
T ss_pred             HHHHHHHHCcCHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCceEEEECCCCcEEEEccHHhhccCC-CCCCCCCCCEE
Confidence            57999999999999999999999999999999999999999999999998899999999999999997 67789999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS  114 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~  114 (165)
                      |||||+++||+.|++|.  |+..|+.++..+|++
T Consensus       177 LT~~~~~~lg~~g~~G~--f~~~~~~~~~~Lr~~  208 (222)
T cd05164         177 LTRNIINGMGITGVEGL--FRKICEQTLEVFRKH  208 (222)
T ss_pred             eCHHHHHHhCCCCcCCh--HHHHHHHHHHHHHhC
Confidence            99999999999999997  899999999999864


No 20 
>cd05170 PIKKc_SMG1 Suppressor of morphogenetic effect on genitalia-1 (SMG-1), catalytic domain; The SMG-1 catalytic domain subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. SMG-1 is a member of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily. PIKKs have intrinsic serine/threonine kinase activity and are distinguished from other PKs by their unique catalytic domain, similar to that of lipid PI3K, and their large molecular weight (240-470 kDa). In addition to its catalytic domain, SMG-1 contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain at the C-terminus. SMG-1 plays a critical role in the mRNA surveillance mechanism known as non-sense mediated mRNA decay (NMD). NMD protects the cells from the accumulation of aberrant mRNAs with premature termination codons (PTCs) generated by geno
Probab=100.00  E-value=7.5e-38  Score=267.75  Aligned_cols=121  Identities=30%  Similarity=0.496  Sum_probs=111.7

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      |+++++..++++++|+.+|++|++|+|++|+++||||||||||+||||++.||+++|||||++|++++ .+++||.||||
T Consensus       176 l~~~~~~~~~~~~~w~~~r~~f~~s~A~~s~~~yilglgDRh~~NIli~~~tG~v~hiDf~~~f~~~~-~l~~pE~VPFR  254 (307)
T cd05170         176 LARELWCSSTTSSEWWSVTQRYARSTAVMSMIGYVIGLGDRHLDNVLIDLKTGEVVHIDYNVCFEKGK-SLRIPEKVPFR  254 (307)
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHHHHHHHHHHHHHHccCCCCCCccEEEEcCCCcEEEEeeHhhhcccC-CCCCCCCCCee
Confidence            35678888999999999999999999999999999999999999999999999999999999999987 78899999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh-----hccccCCCch
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS-----FLLSVGVYNQ  124 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~-----~~l~~~~~~~  124 (165)
                      |||||+++||+.|++|.  |+..|+.++.++|++     ..+++++.|+
T Consensus       255 LT~~~~~~lg~~g~~G~--f~~~~~~~~~~Lr~~~~~l~~~l~~fv~DP  301 (307)
T cd05170         255 MTQNIETALGLTGVEGV--FRLSCEQVLHIMRRGRETLLTLLEAFVYDP  301 (307)
T ss_pred             eCHHHHHHhCCCCCchh--HHHHHHHHHHHHHcCHHHHHHHHHHHhhCc
Confidence            99999999999999997  899999999999963     4566666665


No 21 
>smart00146 PI3Kc Phosphoinositide 3-kinase, catalytic domain. Phosphoinositide 3-kinase isoforms participate in a variety of processes,  including cell motility, the Ras pathway, vesicle trafficking and  secretion, and apoptosis. These homologues may be either lipid kinases and/or protein kinases: the former phosphorylate the 3-position in the inositol ring of inositol phospholipids. The ataxia telangiectesia-mutated gene produced, the targets of rapamycin (TOR) and the DNA-dependent kinase have not been found to possess lipid kinase activity. Some of this family possess PI-4 kinase activities.
Probab=100.00  E-value=1.4e-37  Score=251.24  Aligned_cols=111  Identities=33%  Similarity=0.531  Sum_probs=104.6

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      |++||.+.++++.+|+.+|++|++|+|+||+++||+|+|||||+||||+ +||+++|||||++|+++++....+|.||||
T Consensus        68 l~~~~~~~~~~~~~~~~~~~~F~~SlA~~s~~~YilglgDRh~~NIli~-~~G~v~hIDfg~~~~~~~~~~~~~e~vPFR  146 (202)
T smart00146       68 LYDWFKKKFPDPEDYFEARKNFTRSCAGYSVITYILGLGDRHNDNIMLD-KTGHLFHIDFGFILGNGPKLFGFPERVPFR  146 (202)
T ss_pred             HHHHHHHHCcCHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCcEEEe-CCCCEEEEechhhhCccccCCCCCCCCCee
Confidence            5799999999999999999999999999999999999999999999999 899999999999999999766667999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS  114 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~  114 (165)
                      |||||+++||+.|.+|.  |+..|+.++..+|++
T Consensus       147 LT~~~~~~lg~~~~~g~--F~~~~~~~~~~Lr~~  178 (202)
T smart00146      147 LTPEMVDVMGDSGYFGL--FRSLCERALRALRKN  178 (202)
T ss_pred             cCHHHHHHhCCCcccch--HHHHHHHHHHHHHcC
Confidence            99999999999999997  789999988888863


No 22 
>cd05163 TRRAP TRansformation/tRanscription domain-Associated Protein (TRRAP), pseudokinase domain; The TRRAP catalytic domain is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TRRAP shows some similarity to members of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily in that it contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain and has a large molecular weight. Unlike PIKK proteins, however, it contains an inactive PI3K-like pseudokinase domain, which lacks the conserved residues necessary for ATP binding and catalytic activity. TRRAP also contains many motifs that may be critical for protein-protein interactions. TRRAP is a common component of many histone acetyltransferase (HAT) complexes, and is responsible for the recruitment of these complexes to chromatin during transcription, replicat
Probab=100.00  E-value=1e-37  Score=260.74  Aligned_cols=122  Identities=23%  Similarity=0.333  Sum_probs=112.7

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      |++||+++++++++||.+|++|++|+|++|+++||+|+|||||+|||+++.||+++|||||+.|++++..+++||.||||
T Consensus       121 l~~~~~~~~~~~~~~~~~r~~ft~s~A~~s~~gYilglgdRh~~nili~~~tG~v~hiDf~~~f~~~~~~~~~pE~VPFR  200 (253)
T cd05163         121 LKNYILSTFPTYQDYWLFRKQFTYQLALLSFMTYILSINNRNPDKIFISRDTGNVYQSDLLPSINNNKPLFHNNEPVPFR  200 (253)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCchhEEEEcCCCcEEEEeeeeeecCCCcCCCCCCcCCcc
Confidence            57999999999999999999999999999999999999999999999999999999999999999999677899999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh-----hccccCCCch
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS-----FLLSVGVYNQ  124 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~-----~~l~~~~~~~  124 (165)
                      |||||+++||+.|++|.  |+..|+.+...+++.     ..+++++.|+
T Consensus       201 LT~ni~~~~g~~g~eG~--f~~~~~~~~~~Lr~~~~~l~~~L~~fi~Dp  247 (253)
T cd05163         201 LTPNIQHLIGPIGLEGI--LTSSMMAIARCLTEPEFDLENALQLFIRDE  247 (253)
T ss_pred             cCHHHHHHhCCcCcCCc--HHHHHHHHHHHHhcCHHHHHHHHHHHHcCh
Confidence            99999999999999998  789999999999853     3456666555


No 23 
>cd00142 PI3Kc_like Phosphoinositide 3-kinase (PI3K)-like family, catalytic domain; The PI3K-like catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. Members of the family include PI3K, phosphoinositide 4-kinase (PI4K), PI3K-related protein kinases (PIKKs), and TRansformation/tRanscription domain-Associated Protein (TRRAP). PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives, while PI4K catalyze the phosphorylation of the 4-hydroxyl of PtdIns. PIKKs are protein kinases that catalyze the phosphorylation of serine/threonine residues, especially those that are followed by a glutamine. PI3Ks play an important role in a variety of fundamental cellular processes, including cell motility, the 
Probab=100.00  E-value=3.3e-37  Score=251.94  Aligned_cols=111  Identities=32%  Similarity=0.495  Sum_probs=105.1

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      |++|++..++++++|+++|++|+.|+|+||+++|+||+|||||+|||+++.||+++|||||++|+++++... ||+||||
T Consensus        95 l~~~~~~~~~~~~~~~~~~~~F~~SlA~~s~~~YilglgDRh~~NIli~~~~G~~~hIDfg~~~~~~~~~~~-~e~vPFR  173 (219)
T cd00142          95 LSKWLKRKSPDEDEWQEARENFISSLAGYSVAGYILGIGDRHPDNIMIDLDTGKLFHIDFGFIFGKRKKFLG-RERVPFR  173 (219)
T ss_pred             HHHHHHHHCcCHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCccEEEECCCCeEEEEeeHHhhCcCcCCCC-CCCCCEe
Confidence            579999999999999999999999999999999999999999999999988999999999999999996555 9999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS  114 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~  114 (165)
                      |||||+++||+.|.+|.  |+..|+.++..+|++
T Consensus       174 LT~~~~~~~g~~~~~g~--F~~~~~~~~~~lr~~  205 (219)
T cd00142         174 LTPDLVNALGTGGVFGP--FRSLCVKAMLILRRH  205 (219)
T ss_pred             ccHHHHHHhCCcchhhh--HHHHHHHHHHHHHhC
Confidence            99999999999999986  899999999999864


No 24 
>KOG0904|consensus
Probab=100.00  E-value=4e-36  Score=279.81  Aligned_cols=150  Identities=25%  Similarity=0.253  Sum_probs=137.0

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCC-CCCCCc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPF   79 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~-~E~vPF   79 (165)
                      |.+|+.+++|..+.+-++.+.|+.|||||||+||||||||||+|||||. +||++|||||||++|+.+.++++ +|+|||
T Consensus       890 L~~WLKekNp~e~kld~AIe~Ft~SCAGYcVATyVLGIgDRHsDNIMvk-e~GqlFHIDFGHiLGh~KsKlGi~RERvPF  968 (1076)
T KOG0904|consen  890 LLNWLKEKNPGEDKLDAAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVK-ETGQLFHIDFGHILGHFKSKLGINRERVPF  968 (1076)
T ss_pred             HHHHHhhcCchHHHHHHHHHHHHHhhccceeeeeeecccccccCceEEe-ccCcEEEEEhhhhhccchhhcCcccccCce
Confidence            4689999999999999999999999999999999999999999999999 89999999999999999999998 999999


Q ss_pred             ccCHHHHHhhCCCCc---hh-HHHHHHHHHHHHHHhhh---------hhccccCCCchhhhhhhh---cceeeccchhhh
Q psy18027         80 RLTPHILAVNEPYGS---QG-KRLWVRHLNEIDTLLSK---------SFLLSVGVYNQKILEQKQ---YLWFIQINVTAM  143 (165)
Q Consensus        80 RLT~~~~~~mg~~g~---~g-~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~k~~~~~~---~~~~~~~~~~~~  143 (165)
                      .||++|+.+|+..+.   +. |..|+.+|+.||.++|+         ++|+.+|+|++.+.+|++   ...+++.++++|
T Consensus       969 vLT~dFl~VI~~G~~~~~~~eF~kFq~~C~~AYl~lr~H~nLfi~LFsmMl~~glPELss~~Di~ylrdtL~l~ktEEeA 1048 (1076)
T KOG0904|consen  969 VLTYDFLHVIQKGKTKNSEKEFQKFQELCEKAYLALRRHGNLFISLFSMMLGTGLPELSSKKDIDYLRDTLALGKTEEEA 1048 (1076)
T ss_pred             EeecceeeeecccCCCCchhHHHHHHHHHHHHHHHHHHccccHHHHHHHHHhcCCCccccHHHHHHHHHHHhcCCcHHHH
Confidence            999999999987653   33 88899999999999997         389999999999999987   477888889999


Q ss_pred             hhCCCCCc
Q psy18027        144 SHQPKMKE  151 (165)
Q Consensus       144 ~~yp~~~~  151 (165)
                      --|..++.
T Consensus      1049 ~k~F~~k~ 1056 (1076)
T KOG0904|consen 1049 LKYFRDKF 1056 (1076)
T ss_pred             HHHHHHHH
Confidence            88877654


No 25 
>KOG0890|consensus
Probab=100.00  E-value=7.7e-35  Score=289.35  Aligned_cols=121  Identities=36%  Similarity=0.589  Sum_probs=115.3

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      +.+||+++||+|.+|+.+|++|++|.|+|||+|||||+||||.+|||+|-.||+++|+||.++|+++. .+++||.||||
T Consensus      2186 FheWFl~~FPeP~sW~~SR~~Y~rTtAVMSmVGyIlGLGDRHgENILFDs~TGdcVHVDFnCLFnKGe-tlevPEiVPFR 2264 (2382)
T KOG0890|consen 2186 FHEWFLESFPEPGSWFASRNNYARTTAVMSMVGYILGLGDRHGENILFDSTTGDCVHVDFNCLFNKGE-TLEVPELVPFR 2264 (2382)
T ss_pred             HHHHHHHhCCCchHHHHHHHHHHHHHHHHHHHHHHhcCccccccceeeecCCCcEEEEeecccccCCc-ccCCCCcccee
Confidence            46899999999999999999999999999999999999999999999999999999999999999999 99999999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh-----hccccCCCch
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS-----FLLSVGVYNQ  124 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~-----~~l~~~~~~~  124 (165)
                      ||+||+++||+.|.||.  ||+.||..++++|++     +.+.++++||
T Consensus      2265 LT~NMidamGp~G~EG~--Frk~cEiTLrLlR~n~e~LMSiL~tF~~DP 2311 (2382)
T KOG0890|consen 2265 LTQNMIDAMGPLGLEGS--FRKVCEITLRLLRKNRETLMSILETFVYDP 2311 (2382)
T ss_pred             cchhHHhhcCCcccchh--HHHHHHHHHHHHHhcchhHHHHHHHHHhCc
Confidence            99999999999999998  899999999999953     4578888886


No 26 
>KOG0905|consensus
Probab=100.00  E-value=7e-35  Score=276.89  Aligned_cols=159  Identities=23%  Similarity=0.281  Sum_probs=139.8

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCC-CCCCCc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPF   79 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~-~E~vPF   79 (165)
                      |++||.+.+|++.+|.++.+||++|||||||+||||||+|||+||||+. +|||+||||||-++|+++.+-++ ++++||
T Consensus      1163 la~WL~KhNp~e~eYekA~eNFiySCAG~cVaTYVLGIcDRHNDNIMl~-~sGHmFHIDFGKFLGhaQMfg~fKRDRaPF 1241 (1639)
T KOG0905|consen 1163 LAKWLMKHNPSEFEYEKAVENFIYSCAGWCVATYVLGICDRHNDNIMLT-KSGHMFHIDFGKFLGHAQMFGGFKRDRAPF 1241 (1639)
T ss_pred             HHHHHHhcCCCHHHHHHHHHHHHHhcccceeeeEeeecccccCCceEEe-ccCcEEEEehhhhcchHHHhcccccccCCe
Confidence            5899999999999999999999999999999999999999999999999 89999999999999999943345 999999


Q ss_pred             ccCHHHHHhhCCCC--chhHHHHHHHHHHHHHHhhhh---------hccccCCCchhhhhhhhc---ceeeccchhhhhh
Q psy18027         80 RLTPHILAVNEPYG--SQGKRLWVRHLNEIDTLLSKS---------FLLSVGVYNQKILEQKQY---LWFIQINVTAMSH  145 (165)
Q Consensus        80 RLT~~~~~~mg~~g--~~g~~~~~~~~~~~~~~l~~~---------~~l~~~~~~~k~~~~~~~---~~~~~~~~~~~~~  145 (165)
                      .+|.+|.+++.+.+  +.-+..|+++||.++|++||+         .|+.+|+|+...+++++|   ...+..++.+|.-
T Consensus      1242 VfTSdMayvINgG~kpt~~fq~FVDlCCrAyNiiRK~t~lllnlL~lM~~agiPeln~i~dLkYV~~aL~pq~td~eAT~ 1321 (1639)
T KOG0905|consen 1242 VFTSDMAYVINGGDKPTQRFQDFVDLCCRAYNIIRKNTNLLLNLLRLMACAGIPELNSIQDLKYVYNALRPQDTDAEATV 1321 (1639)
T ss_pred             EEeccchhhhcCCCCCchHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHhcCCCCccchhhHHHHHhhcCcccCChhHHH
Confidence            99999999997665  567889999999999999984         799999999999888873   5667777777777


Q ss_pred             CCCCCcccchhhHhh
Q psy18027        146 QPKMKEPIILQEILT  160 (165)
Q Consensus       146 yp~~~~~~~~~~~~~  160 (165)
                      +.-+.|+.-++-+.|
T Consensus      1322 ~FTkmIqsSLgs~~t 1336 (1639)
T KOG0905|consen 1322 QFTKMIQSSLGSAFT 1336 (1639)
T ss_pred             HHHHHHHHHhhhHHH
Confidence            777777665555554


No 27 
>PF00454 PI3_PI4_kinase:  Phosphatidylinositol 3- and 4-kinase;  InterPro: IPR000403 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Phosphatidylinositol 3-kinase (PI3-kinase) (2.7.1.137 from EC) [] is an enzyme that phosphorylates phosphoinositides on the 3-hydroxyl group of the inositol ring. The three products of PI3-kinase - PI-3-P, PI-3,4-P(2) and PI-3,4,5-P(3) function as secondary messengers in cell signalling. Phosphatidylinositol 4-kinase (PI4-kinase) (2.7.1.67 from EC) [] is an enzyme that acts on phosphatidylinositol (PI) in the first committed step in the production of the secondary messenger inositol-1'4'5'-trisphosphate. This domain is also present in a wide range of protein kinases, involved in diverse cellular functions, such as control of cell growth, regulation of cell cycle progression, a DNA damage checkpoint, recombination, and maintenance of telomere length. Despite significant homology to lipid kinases, no lipid kinase activity has been demonstrated for any of the PIK-related kinases []. The PI3- and PI4-kinases share a well conserved domain at their C-terminal section; this domain seems to be distantly related to the catalytic domain of protein kinases [, ]. The catalytic domain of PI3K has the typical bilobal structure that is seen in other ATP-dependent kinases, with a small N-terminal lobe and a large C-terminal lobe. The core of this domain is the most conserved region of the PI3Ks. The ATP cofactor binds in the crevice formed by the N-and C-terminal lobes, a loop between two strands provides a hydrophobic pocket for binding of the adenine moiety, and a lysine residue interacts with the alpha-phosphate. In contrast to protein kinases, the PI3K loop which interacts with the phosphates of the ATP and is known as the glycine-rich or P-loop, contains no glycine residues. Instead, contact with the ATP -phosphate is maintained through the side chain of a conserved serine residue.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 2WXL_A 4AJW_B 2WXQ_A 2WXP_A 2WXM_A 2WXH_A 2WXK_A 2WXG_A 2X38_A 2WXF_A ....
Probab=100.00  E-value=9.9e-34  Score=230.67  Aligned_cols=109  Identities=39%  Similarity=0.643  Sum_probs=93.5

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      +++||+..++++++|+.+|++|++|+|++|+++||+|+|||||+|||++.+||+++|||||++|+ ++ .+..+|.||||
T Consensus       101 ~~~~f~~~~~~~~~~~~~r~~f~~sla~~si~~yilg~gDRh~~Nili~~~~g~~~hIDfg~~f~-~~-~~~~~e~vPFr  178 (235)
T PF00454_consen  101 LRQYFLKSFPSAEEWFEARKNFTRSLAAYSILDYILGLGDRHPGNILIDKKTGELIHIDFGFIFG-GK-HLPVPETVPFR  178 (235)
T ss_dssp             HHHHHHHHSCTTHHHHHHHHHHHHHHHHHHHHHHHHT-CS--TTTEEE-ETTSEEEE--HSSCTT-HH-HGSSSS--SST
T ss_pred             HHHHHHhcCCChhhhHhhhHhhHHHHHHHhhceEEEeecCCCchhheeccccceeeeEEeHHhhh-cc-ccCCCCCCCeE
Confidence            36899999999999999999999999999999999999999999999988999999999999999 44 66789999999


Q ss_pred             cCHHHHHhh----CCCCchhHHHHHHHHHHHHHHhhh
Q psy18027         81 LTPHILAVN----EPYGSQGKRLWVRHLNEIDTLLSK  113 (165)
Q Consensus        81 LT~~~~~~m----g~~g~~g~~~~~~~~~~~~~~l~~  113 (165)
                      ||++|+++|    |+.|.+|.  |+..|+.++..+|+
T Consensus       179 LT~~~~~~~~~~l~~~~~~g~--f~~~~~~~~~~lr~  213 (235)
T PF00454_consen  179 LTRNMVNAMGGYLGPSGVEGL--FRSSCEAILRALRR  213 (235)
T ss_dssp             THHHHHHHTTTSSSTSHHHHH--HHHHHHHHHHHHHH
T ss_pred             eCHHHHHHHhccCCCchhHhH--HHHHHHHHHHHHhc
Confidence            999999999    88888887  78899888888886


No 28 
>COG5032 TEL1 Phosphatidylinositol kinase and protein kinases of the PI-3 kinase family [Signal transduction mechanisms / Cell division and chromosome partitioning / Chromatin structure and dynamics / DNA replication, recombination, and repair / Intracellular trafficking and secretion]
Probab=100.00  E-value=1.2e-33  Score=286.29  Aligned_cols=155  Identities=23%  Similarity=0.337  Sum_probs=132.1

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      |++||+..|+++++|+.+|+||++|+|+|||+||+||+|||||+|||+|+.||+++|||||++++..++.+++||.||||
T Consensus      1909 l~~~f~~~f~~~~~w~~aR~Ny~~SlA~ySvigYiLglgDRH~~NIliD~~sG~viHiDFg~il~~~p~~~~~pE~vPFr 1988 (2105)
T COG5032        1909 LYDWFSESFPNPEDWLTARTNFARSLAVYSVIGYILGLGDRHPGNILIDRSSGHVIHIDFGFILFNAPGRFPFPEKVPFR 1988 (2105)
T ss_pred             HHHHHHHhcCChhhHHHHHHHHHHHHHHHHHHHHHccCCCcCCceEEEEcCCCcEEEehHHHHHhcCCCCCCCcccCcHh
Confidence            58999999999999999999999999999999999999999999999997799999999999999999999999999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh---------hcccc------CCCchh---hhh--hhhcceeeccch
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS---------FLLSV------GVYNQK---ILE--QKQYLWFIQINV  140 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~---------~~l~~------~~~~~k---~~~--~~~~~~~~~~~~  140 (165)
                      ||++|+++||+.|.||.  |+..|+.++..+|++         .|+..      +.||.+   ..+  ....+|...+.+
T Consensus      1989 LT~~iv~~mg~~g~EG~--Fr~~c~~~~~~LRk~~~~L~~~le~f~~d~l~~W~~~p~~~~~~~~~~~~v~~rf~~kl~~ 2066 (2105)
T COG5032        1989 LTRNIVEAMGVSGVEGS--FRELCETAFRALRKNADSLMNVLELFVRDPLIEWRRLPCFREIQNNEIVNVLERFRLKLSE 2066 (2105)
T ss_pred             hhHHHHHhcCccchhhH--HHHHHHHHHHHHhccHHHHHHHHHHHhcCcchhhhcCccccchHHHHHHHHHHHHHHHhhh
Confidence            99999999999999998  899999999999973         44555      566665   111  122677777777


Q ss_pred             hhhhhCCCCCcccchhh
Q psy18027        141 TAMSHQPKMKEPIILQE  157 (165)
Q Consensus       141 ~~~~~yp~~~~~~~~~~  157 (165)
                      .++.-+-.-.++--+++
T Consensus      2067 ~~~~~~~~l~I~~sv~~ 2083 (2105)
T COG5032        2067 KDAEKFVDLLINKSVES 2083 (2105)
T ss_pred             hhhhhhcCCcHHHHHHH
Confidence            77777755555533333


No 29 
>KOG0892|consensus
Probab=99.98  E-value=2.1e-33  Score=280.77  Aligned_cols=110  Identities=32%  Similarity=0.486  Sum_probs=107.3

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      ++.+|+++|++|-+|+++|.+||+|.|+.||+|||||+||||..||+||..||+++|||+|.+|++++ .++.||.||||
T Consensus      2592 fryFflEkF~dP~~WFekrlaYTrsvA~sS~VGyILGLGDRH~qNILid~~taEviHIDlGiAFEQGk-ilptPE~VPFR 2670 (2806)
T KOG0892|consen 2592 FRYFFLEKFPDPADWFEKRLAYTRSVAASSMVGYILGLGDRHGQNILIDQQTAEVIHIDLGIAFEQGK-ILPTPETVPFR 2670 (2806)
T ss_pred             HHHHHHHhcCCHHHHHHHHHHHHHhHHHHHHHHHHhcccchhhhheeecccccceEEEeeeeehhcCC-cCCCCCcccce
Confidence            47899999999999999999999999999999999999999999999999999999999999999999 99999999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhh
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSK  113 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~  113 (165)
                      ||+++++.||..|+||+  |||+|+..+.++|+
T Consensus      2671 LTRDiVdgmGItGveGv--FrRccE~t~~vlR~ 2701 (2806)
T KOG0892|consen 2671 LTRDIVDGMGITGVEGV--FRRCCEFTLEVLRR 2701 (2806)
T ss_pred             eehhhccccCccCchHH--HHHHHHHHHHHHHh
Confidence            99999999999999998  89999999999996


No 30 
>KOG0906|consensus
Probab=99.97  E-value=4.9e-31  Score=240.59  Aligned_cols=145  Identities=23%  Similarity=0.311  Sum_probs=128.0

Q ss_pred             HHHhccCCCc----hHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCC
Q psy18027          3 EGLLSVAKSP----MNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMP   78 (165)
Q Consensus         3 ~~f~~~~~~~----~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vP   78 (165)
                      .|+.+..|+.    ..=...+++|++|||||||+||||||||||+||+|+. ++|++||||||++||.+|+.++    .|
T Consensus       659 ~ylke~~p~e~ap~gi~~~v~dnfVkScaGYsVitYILGvGDRhldNLllT-~dGk~FHiDFgyIlGRDPKP~p----p~  733 (843)
T KOG0906|consen  659 MYLKEDRPDENAPFGISPEVMDNFVKSCAGYSVITYILGVGDRHLDNLLLT-KDGKLFHIDFGYILGRDPKPFP----PP  733 (843)
T ss_pred             HHHHhhCCCcCCCCCCChhHHHHHHHhhccceeeeeeecccCCCcCceEEc-cCCcEEEEeeeeeccCCCCCCC----Cc
Confidence            5666666654    2234589999999999999999999999999999999 8999999999999999998665    59


Q ss_pred             cccCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh---------hccccCCCch-----hhhhhhhcceeeccchhhhh
Q psy18027         79 FRLTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS---------FLLSVGVYNQ-----KILEQKQYLWFIQINVTAMS  144 (165)
Q Consensus        79 FRLT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~---------~~l~~~~~~~-----k~~~~~~~~~~~~~~~~~~~  144 (165)
                      .+|+++|+++||+..++-|..|+.+|+.++.++|++         .|.+++|||.     |.+-..|.+|.++.++++|-
T Consensus       734 MkL~kemve~mgg~es~~Yq~F~s~c~~Af~~LRRssnlIlnLf~LM~~~~IPDia~dp~k~I~kvqeRfrLdmSde~A~  813 (843)
T KOG0906|consen  734 MKLAKEMVEGMGGAESKQYQEFRSYCYEAFLILRRSSNLILNLFSLMADANIPDIAFDPNKAILKVQERFRLDMSDEAAT  813 (843)
T ss_pred             cccCHHHHHHhcccchHHHHHHHHHHHHHHHHHHHhccHHHHHHHHHhcCCCCceeeCcchhhHHHHHHHcccccHHHHH
Confidence            999999999999999999999999999999999973         7899999987     55666789999999999999


Q ss_pred             hCCCCCcc
Q psy18027        145 HQPKMKEP  152 (165)
Q Consensus       145 ~yp~~~~~  152 (165)
                      .|.++.|-
T Consensus       814 ~~fq~lI~  821 (843)
T KOG0906|consen  814 KHFQKLIN  821 (843)
T ss_pred             HHHHHHHH
Confidence            98877654


No 31 
>KOG0902|consensus
Probab=99.96  E-value=3.9e-30  Score=247.92  Aligned_cols=149  Identities=20%  Similarity=0.175  Sum_probs=128.8

Q ss_pred             ChHHHhccCC--CchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCC-CCCCCCC
Q psy18027          1 MREGLLSVAK--SPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQL-LPIPELM   77 (165)
Q Consensus         1 L~~~f~~~~~--~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~-l~~~E~v   77 (165)
                      |++||..+|+  +++.|+.+|.||++|+|||||++|+|+++||||+|||+| +.||++|||||++|+.+|+. ++ .|. 
T Consensus      1617 lyeyF~~~~G~~~s~~fq~Ar~NF~~S~A~Ysv~s~lLq~KDRHNGNim~D-d~G~~iHIDFGf~~e~sPGgnl~-fE~- 1693 (1803)
T KOG0902|consen 1617 LYEYFTRKYGDESSEAFQTARYNFVRSMAGYSVLSYLLQIKDRHNGNIMID-DQGHIIHIDFGFMFESSPGGNLG-FEP- 1693 (1803)
T ss_pred             HHHHHHHhcCccchHHHHHHHHHHHHHHHHHHHHHHHcccccccCCceeEc-cCCCEEEEeeeeEEecCCCCccC-cCC-
Confidence            6799999997  568999999999999999999999999999999999999 89999999999999999987 55 576 


Q ss_pred             CcccCHHHHHhhCCCC-chhHHHHHHHHHHHHHHhhh---------hhccccCCCch--hhhhhhhcceeeccchhhhhh
Q psy18027         78 PFRLTPHILAVNEPYG-SQGKRLWVRHLNEIDTLLSK---------SFLLSVGVYNQ--KILEQKQYLWFIQINVTAMSH  145 (165)
Q Consensus        78 PFRLT~~~~~~mg~~g-~~g~~~~~~~~~~~~~~l~~---------~~~l~~~~~~~--k~~~~~~~~~~~~~~~~~~~~  145 (165)
                      ||+||.+|+.+||+.. ..+|++|...|-..+-..|.         .+||++|+||+  +.++.+..||.++.++++|+.
T Consensus      1694 ~fKLt~Em~~~mgG~~~~~~f~~f~elcVk~yLA~R~~~~~iv~~V~~mldsgLPCfrg~~i~nl~~RF~pemsereAa~ 1773 (1803)
T KOG0902|consen 1694 PFKLTKEMVMLMGGKMEAKPFKWFQELCVKGYLAARPYMDAIVSLVQSMLDSGLPCFRGQTIGNLRARFAPEMSEREAAL 1773 (1803)
T ss_pred             CccchHHHHHHhCCCCCCCcHHHHHHHHHHHHHhhchhHHHHHHHHHHHHhcCCCccCcchHHHHHHhhCcccchHHHHH
Confidence            9999999999999765 67788887777655544442         48999999999  445556689999999999999


Q ss_pred             CCCCCcc
Q psy18027        146 QPKMKEP  152 (165)
Q Consensus       146 yp~~~~~  152 (165)
                      |...-+.
T Consensus      1774 fm~~vi~ 1780 (1803)
T KOG0902|consen 1774 FMLSVIT 1780 (1803)
T ss_pred             HHHHHHH
Confidence            8765443


No 32 
>KOG0903|consensus
Probab=99.96  E-value=9.3e-29  Score=228.28  Aligned_cols=139  Identities=22%  Similarity=0.312  Sum_probs=114.2

Q ss_pred             hHHHhccC-CCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          2 REGLLSVA-KSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         2 ~~~f~~~~-~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      ++||...+ ++++.|..+.+||+.||||||++||+|+|+||||+||||| ..|||+||||||++++.|+.++ .|.+||+
T Consensus       662 ~~F~~~~g~~NS~~yk~AQrNFvqSlagYSLvcYlLQvKDRHNGNILiD-~EGHIIHIDFGFmLsnsPgnvg-FEsAPFK  739 (847)
T KOG0903|consen  662 RHFFAAFGKPNSEKYKSAQRNFVQSLAGYSLVCYLLQVKDRHNGNILID-EEGHIIHIDFGFMLSNSPGNVG-FESAPFK  739 (847)
T ss_pred             HHHHHHhCCCCcHHHHHHHHHHHHHHHHHHHHHHhhhcccccCCceEec-CCCCEEEEeeeeEecCCCCCcc-cccCchh
Confidence            44454444 5889999999999999999999999999999999999999 8999999999999999998887 5999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHH-----------HHHHHHHHHhhhhhccc-cCCCchhh----hhhhhcceeeccchhhhh
Q psy18027         81 LTPHILAVNEPYGSQGKRLWV-----------RHLNEIDTLLSKSFLLS-VGVYNQKI----LEQKQYLWFIQINVTAMS  144 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~-----------~~~~~~~~~l~~~~~l~-~~~~~~k~----~~~~~~~~~~~~~~~~~~  144 (165)
                      ||.+++++||+...+-|..|+           +|+..|+.++  +.|-+ .++||++.    ...+.+||.+++.+++.-
T Consensus       740 LT~EylEvmgG~~~d~FdyfK~L~l~gf~a~RKhadrIv~lv--EiMq~~S~~pCF~aG~~Ti~nL~~RFhLslTEeq~~  817 (847)
T KOG0903|consen  740 LTTEYLEVMGGLDSDMFDYFKSLMLQGFMALRKHADRIVLLV--EIMQDGSGMPCFRAGERTIQNLRQRFHLSLTEEQCQ  817 (847)
T ss_pred             hHHHHHHHhcCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHhhccCCCcccccChHHHHHHHHHhcccccHHHHH
Confidence            999999999977666555554           4445555555  35555 89999965    344568999999777653


No 33 
>KOG0891|consensus
Probab=99.82  E-value=3.4e-21  Score=195.48  Aligned_cols=122  Identities=32%  Similarity=0.478  Sum_probs=111.2

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      +++-++..+++++.|...|.+|++|.|++|+++|++|+|||||+|.|+++.||.+.|||||.+|+.+.....+||.+|||
T Consensus      2105 l~~~lwlkS~ssEaw~~rrt~yt~S~A~msmvgyilGlGdrhpsNlmldr~tgkvihidfgdcfevA~~rek~pe~~pfR 2184 (2341)
T KOG0891|consen 2105 LYKVLWLKSPSSEAWLDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLTGKVIHIDFGDCFEVAMLREKFPEKVPFR 2184 (2341)
T ss_pred             HHHHHHHhCCChhHHHHHhhhhHHHHHHHHHHHHHhhccccchhhhhhhhcccceEEechHHHHHHHHhhccccccccHH
Confidence            35667888999999999999999999999999999999999999999999999999999999999999777789999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhhhh-----hccccCCCch
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLSKS-----FLLSVGVYNQ  124 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~~~-----~~l~~~~~~~  124 (165)
                      +|++++++|.+.|.+|.  ++..|.....++|.+     .-++++.+|+
T Consensus      2185 lTrmli~amev~gl~g~--~~~t~e~v~~~lr~~~~sl~a~leafvydp 2231 (2341)
T KOG0891|consen 2185 LTRMLINAMEVTGIEGT--YRITCEHVMRVLRTNKESLMAVLEAFVYDP 2231 (2341)
T ss_pred             HHHHHHHhHHHHhhhhH--HHHHHHHHHHhhcCChHHHHHHHHhhhccc
Confidence            99999999999999998  688999999998842     2367777776


No 34 
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=99.77  E-value=3.4e-19  Score=166.00  Aligned_cols=71  Identities=30%  Similarity=0.417  Sum_probs=63.3

Q ss_pred             HHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcccCHHHHHhhC
Q psy18027         18 LRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHILAVNE   90 (165)
Q Consensus        18 ~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFRLT~~~~~~mg   90 (165)
                      .+.||++|+|+||+++|||||||||++||||+ .+|+++||||||+|++.+ +..-+-+.|.|+...|...++
T Consensus      1129 ~~~NFi~S~AGYsViTYILgIgDRHngNILId-~dGhLfHIDFGFILg~rt-fkeKl~~s~vR~D~~l~eav~ 1199 (1374)
T PTZ00303       1129 SCINFLASAKLFLLLNYIFSIGDRHKGNVLIG-TNGALLHIDFRFIFSEKT-FVEKLARSTVRIDDAFLAAVE 1199 (1374)
T ss_pred             HHHHHHHHHHHHHHHHHHhccCcccCCceeEc-CCCCEEEEecceeecCch-hhhccCCCceehhHHHHHHHH
Confidence            36799999999999999999999999999999 899999999999999877 444456779999999987664


No 35 
>KOG0889|consensus
Probab=99.39  E-value=4.8e-13  Score=138.33  Aligned_cols=111  Identities=20%  Similarity=0.307  Sum_probs=99.5

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFR   80 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFR   80 (165)
                      +++||.++|+++.+||.+|++|+.++|..++++|++.++.|.|+.+++++.||.++.-||-+....+++.+...|.||||
T Consensus      3350 l~dy~~~tf~~~~d~w~frk~f~~qla~~~~~~~~lni~~~~p~k~~~~~dsG~v~~~~~~~~~~~~~~~~~~~~~VpFR 3429 (3550)
T KOG0889|consen 3350 LKDYFYKTFTNYSDFWTFRKQFTDQLAVFSFMEYMLNINGRGPAKLTFAKDSGKVFNTDFLPSYISSKPIFHNNEPVPFR 3429 (3550)
T ss_pred             HHHHHHHhcCChhhhhhhHhHHHHHHHHHHHHHHHHhcCCCCccceeeeeccccccchhhccCcccCccccccCCcCCee
Confidence            57999999999999999999999999999999999999999999999999999999999999998888788889999999


Q ss_pred             cCHHHHHhhCCCCchhHHHHHHHHHHHHHHhh
Q psy18027         81 LTPHILAVNEPYGSQGKRLWVRHLNEIDTLLS  112 (165)
Q Consensus        81 LT~~~~~~mg~~g~~g~~~~~~~~~~~~~~l~  112 (165)
                      ||||++.++|..|+||... -..+..+..+++
T Consensus      3430 lTpni~~~i~~~~veg~l~-~s~~a~ar~l~~ 3460 (3550)
T KOG0889|consen 3430 LTPNIQEFIGDFGVEGLLA-GSMMAIARCLIE 3460 (3550)
T ss_pred             ecCCchhhhcchhhhhhhH-HHHHHHHHHHhC
Confidence            9999999999999999852 233334444443


No 36 
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32. Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine.
Probab=89.47  E-value=1.1  Score=34.53  Aligned_cols=41  Identities=27%  Similarity=0.361  Sum_probs=29.9

Q ss_pred             HHHHHHHHHHHHHHHhcc--cCCCCCceeEecCCCcEEeeecccc
Q psy18027         21 NFVRSYACMCIAQYTLGI--GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        21 ~F~~SlA~~sv~~YiLgi--gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      ..+..+|.....-+-.|+  ||-||+||+++  .|++.-||||..
T Consensus        94 ~~~~~i~~~l~~lH~~gi~H~Dl~~~Nil~~--~~~~~liDfg~a  136 (199)
T TIGR03724        94 ELLREIGRLVGKLHKAGIVHGDLTTSNIIVR--DDKLYLIDFGLG  136 (199)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCcceEEEE--CCcEEEEECCCC
Confidence            455555544444444555  79999999998  799999999864


No 37 
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. In addition, RIO3 is present in multicellular eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle pro
Probab=89.27  E-value=0.29  Score=38.32  Aligned_cols=25  Identities=28%  Similarity=0.224  Sum_probs=22.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=+|+|||++  +|++.-||||.+-.
T Consensus       142 rDlkP~NIll~--~~~~~liDFG~a~~  166 (190)
T cd05145         142 GDLSEYNILYH--DGKPYIIDVSQAVE  166 (190)
T ss_pred             CCCChhhEEEE--CCCEEEEEccccee
Confidence            79999999998  79999999997643


No 38 
>COG0661 AarF Predicted unusual protein kinase [General function prediction only]
Probab=89.25  E-value=0.27  Score=45.52  Aligned_cols=25  Identities=44%  Similarity=0.522  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=||+||+++ ..|+++-+|||.+=
T Consensus       289 aDpHpGNi~v~-~~g~i~~lDfGi~g  313 (517)
T COG0661         289 ADPHPGNILVR-SDGRIVLLDFGIVG  313 (517)
T ss_pred             cCCCccceEEe-cCCcEEEEcCccee
Confidence            79999999999 78999999999763


No 39 
>KOG0616|consensus
Probab=88.90  E-value=0.28  Score=43.09  Aligned_cols=44  Identities=25%  Similarity=0.325  Sum_probs=32.5

Q ss_pred             HHHHHHHH------HHHHHHHhcc----cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         21 NFVRSYAC------MCIAQYTLGI----GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        21 ~F~~SlA~------~sv~~YiLgi----gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|..+.|-      .+.+-|+=+.    .|--|+|||+| ++|++=-+||||+=-
T Consensus       140 rF~e~~arFYAAeivlAleylH~~~iiYRDLKPENiLlD-~~G~iKitDFGFAK~  193 (355)
T KOG0616|consen  140 RFSEPHARFYAAEIVLALEYLHSLDIIYRDLKPENLLLD-QNGHIKITDFGFAKR  193 (355)
T ss_pred             CCCchhHHHHHHHHHHHHHHHHhcCeeeccCChHHeeec-cCCcEEEEeccceEE
Confidence            66665554      3445555443    48889999999 899999999998753


No 40 
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. This subfamily is composed of RIO1 proteins from eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle progression and c
Probab=88.78  E-value=0.27  Score=38.90  Aligned_cols=35  Identities=23%  Similarity=0.124  Sum_probs=27.0

Q ss_pred             HHHHHHh---cc--cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         30 CIAQYTL---GI--GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        30 sv~~YiL---gi--gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      ..+.|++   |+  +|=+|+|||++  +|++.-||||.+-..
T Consensus       128 ~~L~~l~H~~giiHrDlkP~NIli~--~~~v~LiDFG~a~~~  167 (190)
T cd05147         128 QIMRILYQDCRLVHADLSEYNLLYH--DGKLYIIDVSQSVEH  167 (190)
T ss_pred             HHHHHHHHhCCcccCCCCHHHEEEE--CCcEEEEEccccccC
Confidence            4445553   55  89999999998  589999999976543


No 41 
>PRK14879 serine/threonine protein kinase; Provisional
Probab=88.73  E-value=1.3  Score=34.36  Aligned_cols=24  Identities=33%  Similarity=0.510  Sum_probs=21.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-+|+|||++  .|.+.-||||..-
T Consensus       119 ~Dl~p~Nil~~--~~~~~liDf~~a~  142 (211)
T PRK14879        119 GDLTTSNMILS--GGKIYLIDFGLAE  142 (211)
T ss_pred             CCCCcccEEEE--CCCEEEEECCccc
Confidence            79999999998  7999999998654


No 42 
>TIGR03843 conserved hypothetical protein. This model represents a protein family largely restricted to the Actinobacteria (high-GC Gram-positives), although it is also found in the Chloroflexi. Distant similarity to the phosphatidylinositol 3- and 4-kinase is suggested by the matching of some members to pfam00454.
Probab=88.39  E-value=0.42  Score=40.50  Aligned_cols=45  Identities=24%  Similarity=0.303  Sum_probs=40.7

Q ss_pred             HHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         23 VRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        23 ~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      -..+.-++|+=+++.=.|||.+||+.. ++|+++-||=|.+|...+
T Consensus       132 ~~~l~riaVfDi~inNaDRk~GhiL~~-~dg~l~~IDHGl~f~~~~  176 (253)
T TIGR03843       132 HPQLRRMAVFDALVNNADRKGGHVLPG-PDGRVWGVDHGVCFHVEP  176 (253)
T ss_pred             cHHHhhhhhheeeeecCCCCCCcEeEc-CCCcEEEecCceecCCCC
Confidence            445778899999999999999999999 699999999999999875


No 43 
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase. This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol - 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species.
Probab=88.11  E-value=0.99  Score=40.59  Aligned_cols=24  Identities=38%  Similarity=0.659  Sum_probs=22.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +|=||+||+++ .+|++.-+|||.+
T Consensus       281 ~D~hPgNilv~-~~g~i~liDfG~~  304 (437)
T TIGR01982       281 ADLHPGNIFVL-KDGKIIALDFGIV  304 (437)
T ss_pred             CCCCcccEEEC-CCCcEEEEeCCCe
Confidence            59999999998 7899999999976


No 44 
>cd05151 ChoK Choline Kinase (ChoK). The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major ph
Probab=87.88  E-value=0.5  Score=35.21  Aligned_cols=26  Identities=31%  Similarity=0.186  Sum_probs=22.2

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      =||=||+|||++  .|++.-|||+.+--
T Consensus       111 HgD~~~~Nil~~--~~~~~liDf~~a~~  136 (170)
T cd05151         111 HNDLLPGNFLLD--DGRLWLIDWEYAGM  136 (170)
T ss_pred             cCCCCcCcEEEE--CCeEEEEecccccC
Confidence            399999999998  67899999987543


No 45 
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed
Probab=86.98  E-value=0.39  Score=44.65  Aligned_cols=26  Identities=31%  Similarity=0.434  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCC----cEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTG----RCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG----~v~hIDFg~~f~   65 (165)
                      +|=||+||+++ .+|    +++-+|||.+=.
T Consensus       284 aDpHPGNIlv~-~~g~~~~~i~llDFGivg~  313 (537)
T PRK04750        284 ADMHPGNIFVS-YDPPENPRYIALDFGIVGS  313 (537)
T ss_pred             CCCChHHeEEe-cCCCCCCeEEEEecceEEE
Confidence            79999999998 566    999999998743


No 46 
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=86.41  E-value=0.49  Score=39.44  Aligned_cols=23  Identities=39%  Similarity=0.449  Sum_probs=20.6

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      ||=||+||+++ ..| +.-||||..
T Consensus       159 ~Dikp~Nili~-~~g-i~liDfg~~  181 (232)
T PRK10359        159 GDPHKGNFIVS-KNG-LRIIDLSGK  181 (232)
T ss_pred             CCCChHHEEEe-CCC-EEEEECCCc
Confidence            89999999998 678 999999865


No 47 
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=86.16  E-value=0.72  Score=36.02  Aligned_cols=29  Identities=24%  Similarity=0.149  Sum_probs=24.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      ||=+|+||+++ ++|++.=+|||.+.....
T Consensus       149 ~Dl~p~Nill~-~~~~~~liDfg~~~~~~~  177 (198)
T cd05144         149 GDLSEFNILVD-DDEKIYIIDWPQMVSTDH  177 (198)
T ss_pred             CCCCcccEEEc-CCCcEEEEECCccccCCC
Confidence            48899999999 699999999998865544


No 48 
>KOG0608|consensus
Probab=85.24  E-value=0.88  Score=43.98  Aligned_cols=26  Identities=31%  Similarity=0.441  Sum_probs=23.5

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      .|--||||||| .+|||=-.|||.|-|
T Consensus       753 RDiKPDNILID-rdGHIKLTDFGLCTG  778 (1034)
T KOG0608|consen  753 RDIKPDNILID-RDGHIKLTDFGLCTG  778 (1034)
T ss_pred             cccCccceEEc-cCCceeeeecccccc
Confidence            47789999999 799999999999876


No 49 
>PF01636 APH:  Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily.;  InterPro: IPR002575 This entry consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include:- aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation []. The proteins are found in a range of taxonomic groups.; PDB: 2PPQ_A 2Q83_B 3TDV_B 3TDW_A 3I0O_A 3I0Q_A 3I1A_B 3Q2M_A 3HAV_C 2PUI_B ....
Probab=84.18  E-value=0.75  Score=35.41  Aligned_cols=33  Identities=36%  Similarity=0.232  Sum_probs=22.4

Q ss_pred             HHHHhcccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         32 AQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        32 ~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ....+-=||=|++|||++..+|++.-|||+.+-
T Consensus       164 ~~~~~~HgD~~~~Nil~~~~~~~i~iID~e~a~  196 (239)
T PF01636_consen  164 LPPVLIHGDLHPGNILVDPSDGRIGIIDFEDAG  196 (239)
T ss_dssp             SCEEEE-SS-SGGGEEEESSTTEEEE--GTT-E
T ss_pred             CCcEEEEeccccccceeeeccceeEEEecccce
Confidence            345667799999999999667878789997764


No 50 
>cd05119 RIO RIO kinase family, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases present in archaea, bacteria and eukaryotes. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. RIO kinases contain a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. Most organisms contain at least two RIO kinases, RIO1 and RIO2. A third protein, RIO3, is present in multicellular eukaryotes. In yeast, RIO1 and RIO2 are essential for survival. They funct
Probab=83.82  E-value=0.89  Score=34.63  Aligned_cols=28  Identities=29%  Similarity=0.252  Sum_probs=23.4

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVA   67 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~   67 (165)
                      =+|=||+||+++  +|.+.-||||..-...
T Consensus       138 H~Dl~p~Nili~--~~~~~liDfg~a~~~~  165 (187)
T cd05119         138 HGDLSEYNILVD--DGKVYIIDVPQAVEID  165 (187)
T ss_pred             cCCCChhhEEEE--CCcEEEEECccccccc
Confidence            468899999999  8999999998875443


No 51 
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=82.83  E-value=3.6  Score=32.64  Aligned_cols=25  Identities=32%  Similarity=0.332  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-+|+||+++ ++|.+.=+|||..-
T Consensus       126 ~dl~~~Nill~-~~~~~~l~dfg~~~  150 (260)
T cd05069         126 RDLRAANILVG-DNLVCKIADFGLAR  150 (260)
T ss_pred             cccCcceEEEc-CCCeEEECCCccce
Confidence            79999999999 79999999999874


No 52 
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed
Probab=81.46  E-value=1.3  Score=36.43  Aligned_cols=25  Identities=28%  Similarity=0.276  Sum_probs=21.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=+|+|||++ .+|++.-||||.+-
T Consensus       166 rDlkp~NILv~-~~~~v~LIDfg~~~  190 (239)
T PRK01723        166 ADLNAHNILLD-PDGKFWLIDFDRGE  190 (239)
T ss_pred             CCCCchhEEEc-CCCCEEEEECCCcc
Confidence            59999999999 67899999997543


No 53 
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves 
Probab=79.40  E-value=2  Score=30.22  Aligned_cols=25  Identities=36%  Similarity=0.284  Sum_probs=22.2

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||=+|+|||++ ++|.+.-+||+.+-
T Consensus       113 ~Dl~~~Nil~~-~~~~~~l~Df~~~~  137 (155)
T cd05120         113 GDLHPGNILVD-DGKILGIIDWEYAG  137 (155)
T ss_pred             cCCCcceEEEE-CCcEEEEEeccccc
Confidence            89999999999 58999999998664


No 54 
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core 
Probab=79.20  E-value=17  Score=27.72  Aligned_cols=51  Identities=22%  Similarity=0.285  Sum_probs=35.2

Q ss_pred             hcccCCCCCceeEecCCCcEEeeecccccccccCC-CCCCCCCCcccCHHHHH
Q psy18027         36 LGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQL-LPIPELMPFRLTPHILA   87 (165)
Q Consensus        36 LgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~-l~~~E~vPFRLT~~~~~   87 (165)
                      +--||-+|+||+++ .+|++.=+|||......... .......+.-+.|+...
T Consensus       119 i~h~dl~p~ni~i~-~~~~~~l~d~~~~~~~~~~~~~~~~~~~~~~~~PE~~~  170 (253)
T cd05122         119 IIHRDIKAANILLT-SDGEVKLIDFGLSAQLSDTKARNTMVGTPYWMAPEVIN  170 (253)
T ss_pred             EecCCCCHHHEEEc-cCCeEEEeeccccccccccccccceecCCcccCHHHHc
Confidence            45689999999999 79999999999876554422 11222334456777654


No 55 
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172. This model describes a paralogous family of five proteins, likely to be enzymes, in the rumen bacterium Fibrobacter succinogenes S85. Members show homology to proteins described by PFAM model pfam01636, a phosphotransferase enzyme family associated with resistance to aminoglycoside antibiotics. However, members of this family score below the current trusted and noise cutoffs for pfam01636.
Probab=78.10  E-value=1.7  Score=35.41  Aligned_cols=25  Identities=28%  Similarity=0.292  Sum_probs=21.1

Q ss_pred             cccCCCCCceeEecCCCcEEeeecccc
Q psy18027         37 GIGDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        37 gigDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      -=||=||+||+++ .+| +.-|||+.+
T Consensus       156 ~HgD~~~~Nii~~-~~~-~~iIDwe~a  180 (226)
T TIGR02172       156 LHGDFQIGNLITS-GKG-TYWIDLGDF  180 (226)
T ss_pred             EecCCCCCcEEEc-CCC-cEEEechhc
Confidence            3588899999998 667 889999865


No 56 
>PRK12274 serine/threonine protein kinase; Provisional
Probab=77.65  E-value=2  Score=35.65  Aligned_cols=29  Identities=31%  Similarity=0.360  Sum_probs=23.9

Q ss_pred             Hhcc--cCC-CCCceeEecCCCcEEeeeccccc
Q psy18027         35 TLGI--GDR-HLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        35 iLgi--gDR-H~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      -.||  +|= .|+|||++ .+|++.-||||.+-
T Consensus       109 ~~GIvHrDL~kp~NILv~-~~g~i~LIDFG~A~  140 (218)
T PRK12274        109 RCGVAHNDLAKEANWLVQ-EDGSPAVIDFQLAV  140 (218)
T ss_pred             HCcCccCCCCCcceEEEc-CCCCEEEEECCCce
Confidence            3455  777 58999999 78999999999875


No 57 
>smart00090 RIO RIO-like kinase.
Probab=77.34  E-value=1.9  Score=35.34  Aligned_cols=28  Identities=36%  Similarity=0.372  Sum_probs=23.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      +|=+|+||+++  +|++.-||||.+.....
T Consensus       173 ~Dikp~NIli~--~~~i~LiDFg~a~~~~~  200 (237)
T smart00090      173 GDLSEYNILVH--DGKVVIIDVSQSVELDH  200 (237)
T ss_pred             CCCChhhEEEE--CCCEEEEEChhhhccCC
Confidence            69999999998  79999999997664443


No 58 
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=77.25  E-value=7.3  Score=30.79  Aligned_cols=27  Identities=30%  Similarity=0.378  Sum_probs=23.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      ||-+|+||+++ .+|.+.-+|||..-..
T Consensus       127 ~dl~p~Nil~~-~~~~~~l~dfg~~~~~  153 (261)
T cd05068         127 RDLAARNVLVG-ENNICKVADFGLARVI  153 (261)
T ss_pred             ccCCcceEEEc-CCCCEEECCcceEEEc
Confidence            89999999999 7899999999976543


No 59 
>KOG0598|consensus
Probab=77.13  E-value=1.2  Score=39.49  Aligned_cols=43  Identities=28%  Similarity=0.351  Sum_probs=31.0

Q ss_pred             HHHHHHHHHHHHHHHhcc----------cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         21 NFVRSYACMCIAQYTLGI----------GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        21 ~F~~SlA~~sv~~YiLgi----------gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      .|..+.|-.-++--++.|          +|--|+|||+| ..||+.-.|||.+=
T Consensus       121 ~F~E~~arfYlaEi~lAL~~LH~~gIiyRDlKPENILLd-~~GHi~LtDFgL~k  173 (357)
T KOG0598|consen  121 RFSEDRARFYLAEIVLALGYLHSKGIIYRDLKPENILLD-EQGHIKLTDFGLCK  173 (357)
T ss_pred             CcchhHHHHHHHHHHHHHHHHHhCCeeeccCCHHHeeec-CCCcEEEeccccch
Confidence            455554444444444433          48889999999 89999999999875


No 60 
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=76.49  E-value=7.5  Score=30.59  Aligned_cols=27  Identities=30%  Similarity=0.223  Sum_probs=23.6

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -||-+|+||+++ .+|.+.-+|||....
T Consensus       126 h~di~p~nili~-~~~~~~l~d~g~~~~  152 (261)
T cd05034         126 HRDLAARNILVG-ENLVCKIADFGLARL  152 (261)
T ss_pred             cCCcchheEEEc-CCCCEEECcccccee
Confidence            489999999999 789999999997654


No 61 
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=76.27  E-value=7.3  Score=31.88  Aligned_cols=48  Identities=19%  Similarity=0.336  Sum_probs=32.4

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccccccCC--CCCCCCCCcccCHHHHH
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVATQL--LPIPELMPFRLTPHILA   87 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~--l~~~E~vPFRLT~~~~~   87 (165)
                      ||-+|+|||++ .+|.+.-+|||.........  .......|.-+.|+...
T Consensus       139 ~dL~p~Nili~-~~~~~~l~Dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~  188 (297)
T cd06656         139 RDIKSDNILLG-MDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVT  188 (297)
T ss_pred             CCCCHHHEEEC-CCCCEEECcCccceEccCCccCcCcccCCccccCHHHHc
Confidence            79999999999 79999999999876433211  11122335556677653


No 62 
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=75.90  E-value=5.8  Score=31.53  Aligned_cols=26  Identities=19%  Similarity=0.162  Sum_probs=23.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+.-+|||....
T Consensus       124 ~dlkp~Nill~-~~~~~kl~dfg~~~~  149 (269)
T cd05042         124 SDLALRNCQLT-ADLSVKIGDYGLALE  149 (269)
T ss_pred             ccccHhheEec-CCCcEEEeccccccc
Confidence            78899999999 799999999998754


No 63 
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=75.26  E-value=5.2  Score=33.97  Aligned_cols=26  Identities=35%  Similarity=0.336  Sum_probs=23.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+|||++ .+|++.-+|||..-.
T Consensus       155 rDLkp~NILl~-~~~~ikL~DFG~a~~  180 (340)
T PTZ00426        155 RDLKPENLLLD-KDGFIKMTDFGFAKV  180 (340)
T ss_pred             cCCCHHHEEEC-CCCCEEEecCCCCee
Confidence            78899999999 799999999998643


No 64 
>cd05153 HomoserineK_II Homoserine Kinase, type II. Homoserine kinase is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of unusual homoserine kinases, from a subset of bacteria, which have a PK fold. These proteins do not bear any similarity to the GHMP family homoserine kinases present in most bacteria and eukaryotes. Homoserine kinase catalyzes the transfer of the gamma-phosphoryl group from ATP to L-homoserine producing L-homoserine phosphate, an intermediate in the production of the amino acids threonine, methionine, and isoleucine.
Probab=75.04  E-value=2.4  Score=34.98  Aligned_cols=30  Identities=20%  Similarity=0.078  Sum_probs=23.2

Q ss_pred             HHhcccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         34 YTLGIGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        34 YiLgigDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +.+-=||-||+|++++ +++.+.-|||..+-
T Consensus       175 ~~l~HgD~~~~Nil~~-~~~~~~iIDfe~a~  204 (296)
T cd05153         175 RGVIHADLFRDNVLFD-GDELSGVIDFYFAC  204 (296)
T ss_pred             CcCCccCcCcccEEEe-CCceEEEeehhhhc
Confidence            4455699999999998 55556799997644


No 65 
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC) and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. Along with PCho, it is involved in malignant transformation through Ras oncogenes in various human cancer
Probab=74.85  E-value=3.5  Score=34.24  Aligned_cols=36  Identities=25%  Similarity=0.184  Sum_probs=28.6

Q ss_pred             HHHHhcccCCCCCceeEecC---CCcEEeeecccccccc
Q psy18027         32 AQYTLGIGDRHLENTLVCTK---TGRCVGIDFGYSFGVA   67 (165)
Q Consensus        32 ~~YiLgigDRH~~Nili~~~---tG~v~hIDFg~~f~~~   67 (165)
                      ...++-=||=|++|||++..   +|.+.-|||.++=-..
T Consensus       177 ~~~~lcH~Dl~~~Nil~~~~~~~~~~i~lIDwEya~~~~  215 (302)
T cd05156         177 SPVVFCHNDLQEGNILLLNPSSETKKLVLIDFEYASYNY  215 (302)
T ss_pred             CCceEEecCCCcCeEEecCCCCCCCcEEEEeeCCCCCCC
Confidence            56678889999999999943   5899999997664333


No 66 
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins. This subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of bacterial and eukaryotic proteins with similarity to the N-terminal domains of vertebrate ACAD10 and ACAD11. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis, among them. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and is highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 contain
Probab=74.66  E-value=2.7  Score=32.32  Aligned_cols=31  Identities=23%  Similarity=0.194  Sum_probs=23.3

Q ss_pred             HHhcccCCCCCceeEecC-CCcEEeeeccccc
Q psy18027         34 YTLGIGDRHLENTLVCTK-TGRCVGIDFGYSF   64 (165)
Q Consensus        34 YiLgigDRH~~Nili~~~-tG~v~hIDFg~~f   64 (165)
                      .++-=||=|++||+++.+ ++.+.-|||+.+-
T Consensus       174 ~~l~HgD~~~~Nil~~~~~~~~~~iID~e~~~  205 (223)
T cd05154         174 PGLVHGDYRLGNVLFHPDEPRVVAVLDWELAT  205 (223)
T ss_pred             cEEEECCCCcccEEEcCCCCcEEEEEeccccc
Confidence            455568999999999943 4667789997553


No 67 
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=74.59  E-value=5.6  Score=33.64  Aligned_cols=25  Identities=28%  Similarity=0.303  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ .+|++.-+|||.+-
T Consensus       125 rDLkp~NIli~-~~~~vkL~DfG~~~  149 (360)
T cd05627         125 RDIKPDNLLLD-AKGHVKLSDFGLCT  149 (360)
T ss_pred             cCCCHHHEEEC-CCCCEEEeeccCCc
Confidence            78899999999 79999999999864


No 68 
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=74.58  E-value=5.2  Score=31.94  Aligned_cols=25  Identities=28%  Similarity=0.290  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=+|+||+++ .+|.+.-+|||..-
T Consensus       125 ~dl~p~nil~~-~~~~~~l~dfg~~~  149 (285)
T cd07861         125 RDLKPQNLLID-NKGVIKLADFGLAR  149 (285)
T ss_pred             cCCCHHHEEEc-CCCcEEECccccee
Confidence            89999999999 79999999999764


No 69 
>PF06293 Kdo:  Lipopolysaccharide kinase (Kdo/WaaP) family;  InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents lipopolysaccharide kinases which are related to protein kinases IPR000719 from INTERPRO. This family includes waaP (rfaP) gene product is required for the addition of phosphate to O-4 of the first heptose residue of the lipopolysaccharide (LPS) inner core region. It has previously been shown that WaaP is necessary for resistance to hydrophobic and polycationic antimicrobials in E. coli and that it is required for virulence in invasive strains of Salmonella enterica [].; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0009103 lipopolysaccharide biosynthetic process, 0016020 membrane
Probab=74.48  E-value=8.5  Score=30.60  Aligned_cols=46  Identities=28%  Similarity=0.278  Sum_probs=35.3

Q ss_pred             HHHHHHHHHHHHHHHHHHhcc--cCCCCCceeEecCCC---cEEeeeccccc
Q psy18027         18 LRNNFVRSYACMCIAQYTLGI--GDRHLENTLVCTKTG---RCVGIDFGYSF   64 (165)
Q Consensus        18 ~r~~F~~SlA~~sv~~YiLgi--gDRH~~Nili~~~tG---~v~hIDFg~~f   64 (165)
                      .++.+.+.+|.+..--+--|+  ||=++.|||++ .++   +++-|||.-+-
T Consensus       119 ~~~~ll~~l~~~i~~lH~~gi~H~Dl~~~NILv~-~~~~~~~~~lIDld~~~  169 (206)
T PF06293_consen  119 QRRELLRALARLIAKLHDAGIYHGDLNPSNILVD-PDDGQYRFYLIDLDRMR  169 (206)
T ss_pred             hHHHHHHHHHHHHHHHHHCcCCCCCCCcccEEEe-CCCCceeEEEEcchhce
Confidence            366777777777766666666  89999999999 555   89999996543


No 70 
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=74.34  E-value=8.3  Score=32.05  Aligned_cols=25  Identities=36%  Similarity=0.417  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ .+|.+.=+|||.+-
T Consensus       120 rDikp~NIll~-~~~~~kL~Dfg~~~  144 (325)
T cd05594         120 RDLKLENLMLD-KDGHIKITDFGLCK  144 (325)
T ss_pred             cCCCCCeEEEC-CCCCEEEecCCCCe
Confidence            89999999999 89999999999753


No 71 
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=73.55  E-value=8.2  Score=30.43  Aligned_cols=27  Identities=30%  Similarity=0.363  Sum_probs=23.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|-.|+||+++ .+|.+.-+|||..-..
T Consensus       127 ~dl~p~nili~-~~~~~~l~dfg~~~~~  153 (261)
T cd05072         127 RDLRAANVLVS-ESLMCKIADFGLARVI  153 (261)
T ss_pred             cccchhhEEec-CCCcEEECCCccceec
Confidence            68889999999 7999999999987543


No 72 
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=73.17  E-value=6.7  Score=31.47  Aligned_cols=27  Identities=26%  Similarity=0.260  Sum_probs=23.8

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -+|-+|+||+++ ++|++.-+|||..-.
T Consensus       124 H~dl~p~Nil~~-~~~~~~l~dfg~~~~  150 (277)
T cd06640         124 HRDIKAANVLLS-EQGDVKLADFGVAGQ  150 (277)
T ss_pred             CcCCChhhEEEc-CCCCEEEccccccee
Confidence            389999999999 799999999998743


No 73 
>PRK10271 thiK thiamine kinase; Provisional
Probab=73.07  E-value=3.4  Score=33.42  Aligned_cols=52  Identities=15%  Similarity=0.027  Sum_probs=35.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         14 NRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        14 ~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      .|...-..|...... +-+..++.=||=||+|++++ .+| +.-|||++.=...+
T Consensus        58 ~wl~~~~~~~~~~~~-~~l~~~p~H~D~~~~N~~~~-~~~-~~lIDwe~a~~gDp  109 (188)
T PRK10271         58 FWLRMLKRLRKAGEP-RPLRLAPLHMDVHAGNLVHS-ASG-LRLIDWEYAGDGDI  109 (188)
T ss_pred             HHHHHHHHHHhcccC-CCCCeeeecCCCCCccEEEE-CCC-EEEEeCCcccCCCH
Confidence            454444444333222 33356788899999999997 566 88999998766655


No 74 
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=73.02  E-value=6.7  Score=33.31  Aligned_cols=24  Identities=29%  Similarity=0.416  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +|-.|+|||++ .+|++.-+|||.+
T Consensus       125 rDlkp~Nill~-~~~~ikL~DFG~a  148 (376)
T cd05598         125 RDIKPDNILID-RDGHIKLTDFGLC  148 (376)
T ss_pred             CCCCHHHEEEC-CCCCEEEEeCCCC
Confidence            78999999999 8999999999975


No 75 
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=72.60  E-value=6.9  Score=32.59  Aligned_cols=25  Identities=36%  Similarity=0.566  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+.-+|||.+-
T Consensus       120 ~dlkp~NIli~-~~~~~kL~DfG~~~  144 (320)
T cd05590         120 RDLKLDNVLLD-HEGHCKLADFGMCK  144 (320)
T ss_pred             CCCCHHHeEEC-CCCcEEEeeCCCCe
Confidence            78899999999 79999999999754


No 76 
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=72.32  E-value=6.5  Score=31.96  Aligned_cols=26  Identities=27%  Similarity=0.333  Sum_probs=23.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+|||++ .+|++.=+|||..-.
T Consensus       127 ~dlkp~Nil~~-~~~~~kl~DfG~~~~  152 (288)
T cd07871         127 RDLKPQNLLIN-EKGELKLADFGLARA  152 (288)
T ss_pred             CCCCHHHEEEC-CCCCEEECcCcceee
Confidence            68899999999 799999999998753


No 77 
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=72.11  E-value=10  Score=30.02  Aligned_cols=27  Identities=26%  Similarity=0.240  Sum_probs=23.7

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -||-+|+||+++ .+|.+.=+|||..-.
T Consensus       125 H~dl~p~nil~~-~~~~~~l~dfg~~~~  151 (265)
T cd06631         125 HRDIKGNNVMLM-PNGIIKLIDFGCARR  151 (265)
T ss_pred             cCCcCHHhEEEC-CCCeEEeccchhhHh
Confidence            489999999999 899999999997653


No 78 
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=71.55  E-value=8.4  Score=30.87  Aligned_cols=25  Identities=36%  Similarity=0.400  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.=+|||..-
T Consensus       132 ~dikp~Nili~-~~~~~kl~dfg~~~  156 (288)
T cd07863         132 RDLKPENILVT-SGGQVKLADFGLAR  156 (288)
T ss_pred             CCCCHHHEEEC-CCCCEEECccCccc
Confidence            78999999999 78999999999764


No 79 
>PF06176 WaaY:  Lipopolysaccharide core biosynthesis protein (WaaY);  InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY). The waaY, waaQ, and waaP genes are located in the central operon of the waa (formerly rfa) locus on the chromosome of Escherichia coli. This locus contains genes whose products are involved in the assembly of the core region of the lipopolysaccharide molecule. WaaY is the enzyme that phosphorylates HepII in this system [].; GO: 0009244 lipopolysaccharide core region biosynthetic process
Probab=71.53  E-value=3.8  Score=34.35  Aligned_cols=24  Identities=33%  Similarity=0.141  Sum_probs=19.8

Q ss_pred             cccCCCCCceeEecCCCcEEeeeccc
Q psy18027         37 GIGDRHLENTLVCTKTGRCVGIDFGY   62 (165)
Q Consensus        37 gigDRH~~Nili~~~tG~v~hIDFg~   62 (165)
                      -=||=||+|++++  .|.+.-|||+.
T Consensus       157 ~HGD~hpgNFlv~--~~~i~iID~~~  180 (229)
T PF06176_consen  157 YHGDPHPGNFLVS--NNGIRIIDTQG  180 (229)
T ss_pred             ccCCCCcCcEEEE--CCcEEEEECcc
Confidence            3499999999998  46699999943


No 80 
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=71.38  E-value=7.4  Score=33.31  Aligned_cols=24  Identities=29%  Similarity=0.350  Sum_probs=22.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +|-.|+||||+ .+|++.-+|||.+
T Consensus       125 rDlKp~Nili~-~~~~~kL~DFGl~  148 (381)
T cd05626         125 RDIKPDNILID-LDGHIKLTDFGLC  148 (381)
T ss_pred             cCCcHHHEEEC-CCCCEEEeeCcCC
Confidence            68899999999 7999999999975


No 81 
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=71.35  E-value=11  Score=30.90  Aligned_cols=28  Identities=29%  Similarity=0.279  Sum_probs=24.5

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      -||-+|+||+++ .+|.+.-+|||.....
T Consensus       126 H~dlkp~Nili~-~~~~~~l~dfg~~~~~  153 (316)
T cd05574         126 YRDLKPENILLH-ESGHIMLSDFDLSKQS  153 (316)
T ss_pred             ccCCChHHeEEc-CCCCEEEeecchhhcc
Confidence            489999999999 7899999999987644


No 82 
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members. The APH/ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates, such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides, and macrolides leads to their inactivation and to bacterial antibiotic resista
Probab=71.31  E-value=4.1  Score=32.73  Aligned_cols=29  Identities=38%  Similarity=0.319  Sum_probs=22.3

Q ss_pred             HHHhcccCCCCCceeEecCCCcE-Eeeecccc
Q psy18027         33 QYTLGIGDRHLENTLVCTKTGRC-VGIDFGYS   63 (165)
Q Consensus        33 ~YiLgigDRH~~Nili~~~tG~v-~hIDFg~~   63 (165)
                      .+.|-=||=|++|+|++  .|++ --|||+.+
T Consensus       163 ~~~l~HGD~~~~Nvlv~--~~~i~giIDw~~a  192 (235)
T cd05155         163 PPVWFHGDLAPGNLLVQ--DGRLSAVIDFGCL  192 (235)
T ss_pred             CceEEeCCCCCCcEEEE--CCCEEEEEeCccc
Confidence            34456699999999998  3565 48999975


No 83 
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=71.26  E-value=7.8  Score=32.22  Aligned_cols=25  Identities=36%  Similarity=0.401  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ .+|++.-+|||.+-
T Consensus       120 ~Dlkp~NIll~-~~~~~kL~DfG~~~  144 (325)
T cd05604         120 RDLKPENILLD-SQGHVVLTDFGLCK  144 (325)
T ss_pred             cCCCHHHeEEC-CCCCEEEeecCCcc
Confidence            68889999999 79999999999764


No 84 
>PHA00451 protein kinase
Probab=71.13  E-value=5.2  Score=34.93  Aligned_cols=76  Identities=18%  Similarity=0.159  Sum_probs=52.5

Q ss_pred             hHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCC-cc
Q psy18027          2 REGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMP-FR   80 (165)
Q Consensus         2 ~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vP-FR   80 (165)
                      +.+|.+-+.++.+|+.--..|+.+|-..-=.-|=+.-=|=|.+|||++ +.|..+-.|= ..|+..      .|+-| |-
T Consensus       156 a~~~~e~~~d~~~~~~~~~~FIETCk~IRkFF~GIASFDmHSGNiMf~-~~g~p~ITDP-VSFS~d------r~re~GF~  227 (362)
T PHA00451        156 AYIIIECCSDAAEEYPGSQEFIETCKMIRKFFYGIASFDMHSGNIMFD-QDGVPYITDP-VSFSHD------REREPGFP  227 (362)
T ss_pred             HHHHHhccCCHHhccCCchhHHHHHHHHHHHHhhhhcccccCCceeeC-CCCCeEecCC-ccccCc------cccCCCCC
Confidence            467788888888888888889998876444333333448999999999 7888776663 223322      34445 77


Q ss_pred             cCHHH
Q psy18027         81 LTPHI   85 (165)
Q Consensus        81 LT~~~   85 (165)
                      |.|+-
T Consensus       228 ldPd~  232 (362)
T PHA00451        228 LDPDE  232 (362)
T ss_pred             CCHHH
Confidence            87764


No 85 
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=70.93  E-value=12  Score=29.34  Aligned_cols=26  Identities=31%  Similarity=0.296  Sum_probs=23.3

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-+|+||+++ .+|.+.=+|||....
T Consensus       124 ~dl~p~nili~-~~~~~kl~Dfg~~~~  149 (254)
T cd05083         124 RDLAARNILVS-EDGVAKVSDFGLARV  149 (254)
T ss_pred             cccCcceEEEc-CCCcEEECCCcccee
Confidence            79999999999 789999999998754


No 86 
>PF13575 DUF4135:  Domain of unknown function (DUF4135)
Probab=70.91  E-value=9.7  Score=33.30  Aligned_cols=48  Identities=21%  Similarity=0.172  Sum_probs=42.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         17 RLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        17 ~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +..++|-+-++++..+.|+||..|=|.+||.-+  .+.-+=||+--+|..
T Consensus       131 ~ev~~yY~r~G~llal~y~L~~~DlH~ENIIa~--g~~PvlIDlETlf~~  178 (370)
T PF13575_consen  131 EEVERYYYRLGVLLALLYLLNGTDLHFENIIAS--GEYPVLIDLETLFHP  178 (370)
T ss_pred             HHHHHHHHHHHHHHHHHHHhCCCcccccceEEe--CCCcEEEehhhhCCc
Confidence            467888899999999999999999999999996  567788999888876


No 87 
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=70.87  E-value=8.1  Score=32.28  Aligned_cols=26  Identities=27%  Similarity=0.340  Sum_probs=23.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+|||++ .+|++.-+|||.+..
T Consensus       120 rDlkp~Nili~-~~~~~kl~Dfg~~~~  145 (327)
T cd05617         120 RDLKLDNVLLD-ADGHIKLTDYGMCKE  145 (327)
T ss_pred             cCCCHHHEEEe-CCCCEEEecccccee
Confidence            68889999999 799999999997753


No 88 
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=70.86  E-value=7.3  Score=32.57  Aligned_cols=25  Identities=28%  Similarity=0.363  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ .+|.+.=+|||.+-
T Consensus       120 ~dlkp~Nili~-~~~~~kL~Dfg~~~  144 (329)
T cd05588         120 RDLKLDNVLLD-AEGHIKLTDYGMCK  144 (329)
T ss_pred             cCCCHHHeEEC-CCCCEEECcCcccc
Confidence            78899999999 79999999999764


No 89 
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=70.82  E-value=11  Score=30.38  Aligned_cols=26  Identities=31%  Similarity=0.446  Sum_probs=23.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|.+.=+|||....
T Consensus       119 ~dikp~Nili~-~~~~~~l~Dfg~~~~  144 (277)
T cd05607         119 RDMKPENVLLD-DQGNCRLSDLGLAVE  144 (277)
T ss_pred             ccCChHhEEEc-CCCCEEEeeceeeee
Confidence            78899999999 799999999998654


No 90 
>PF00069 Pkinase:  Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain;  InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=70.57  E-value=4.7  Score=31.49  Aligned_cols=48  Identities=27%  Similarity=0.267  Sum_probs=32.5

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc--cccCCCCCCCCCCcccCHHHHH
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG--VATQLLPIPELMPFRLTPHILA   87 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~--~~~~~l~~~E~vPFRLT~~~~~   87 (165)
                      +|=.|+||+++ .+|++.-+|||....  .........-..+.=..|+...
T Consensus       122 ~dikp~NIl~~-~~~~~~l~Dfg~~~~~~~~~~~~~~~~~~~~y~aPE~~~  171 (260)
T PF00069_consen  122 RDIKPENILLD-ENGEVKLIDFGSSVKLSENNENFNPFVGTPEYMAPEVLQ  171 (260)
T ss_dssp             SSBSGGGEEES-TTSEEEESSGTTTEESTSTTSEBSSSSSSGGGSCHHHHT
T ss_pred             ccccccccccc-ccccccccccccccccccccccccccccccccccccccc
Confidence            68899999999 899999999999763  2221222222344456677754


No 91 
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=70.42  E-value=8  Score=32.17  Aligned_cols=26  Identities=27%  Similarity=0.286  Sum_probs=23.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|++.-+|||.+-.
T Consensus       125 ~Dlkp~NIll~-~~~~~kL~Dfg~~~~  150 (350)
T cd05573         125 RDIKPDNILID-ADGHIKLADFGLCKK  150 (350)
T ss_pred             cCCCHHHeEEC-CCCCEEeecCCCCcc
Confidence            68899999999 799999999998754


No 92 
>PRK05231 homoserine kinase; Provisional
Probab=70.09  E-value=4.1  Score=34.07  Aligned_cols=26  Identities=27%  Similarity=0.194  Sum_probs=20.8

Q ss_pred             hcccCCCCCceeEecCCCcE-Eeeecccc
Q psy18027         36 LGIGDRHLENTLVCTKTGRC-VGIDFGYS   63 (165)
Q Consensus        36 LgigDRH~~Nili~~~tG~v-~hIDFg~~   63 (165)
                      +-=||=|++||+++  .+++ .-|||+.+
T Consensus       189 liHgD~~~~Nil~~--~~~~~~iIDf~~~  215 (319)
T PRK05231        189 VIHADLFRDNVLFE--GDRLSGFIDFYFA  215 (319)
T ss_pred             cCCCCCCCCcEEEE--CCceEEEEecccc
Confidence            44589999999998  3455 69999876


No 93 
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=69.82  E-value=14  Score=29.31  Aligned_cols=25  Identities=32%  Similarity=0.357  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-+|+||+++ ..|.+.=+|||...
T Consensus       126 ~dl~p~Nill~-~~~~~~L~dfg~~~  150 (262)
T cd05071         126 RDLRAANILVG-ENLVCKVADFGLAR  150 (262)
T ss_pred             cccCcccEEEc-CCCcEEeccCCcee
Confidence            78899999999 78999999999874


No 94 
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=69.80  E-value=9.6  Score=30.24  Aligned_cols=26  Identities=38%  Similarity=0.302  Sum_probs=23.1

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++...|.+.-+|||..-
T Consensus       132 ~dl~p~nil~~~~~~~~~l~dfg~~~  157 (268)
T cd06624         132 RDIKGDNVLVNTYSGVVKISDFGTSK  157 (268)
T ss_pred             cCCCHHHEEEcCCCCeEEEecchhhe
Confidence            78999999998668999999999764


No 95 
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=69.61  E-value=8.4  Score=32.02  Aligned_cols=25  Identities=40%  Similarity=0.391  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ .+|++.=+|||..-
T Consensus       120 rDlkp~Nili~-~~~~~kl~Dfg~a~  144 (330)
T cd05586         120 RDLKPENILLD-ATGHIALCDFGLSK  144 (330)
T ss_pred             ccCCHHHeEEC-CCCCEEEecCCcCc
Confidence            78899999999 78999999999753


No 96 
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. ETNK is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate, and displays negligible activity towards N-methylated derivatives of Etn. The Drosophila ETNK is implicated in development and neuronal function. Mammals contain two ETNK proteins, ETNK1 and ETNK2. ETNK1 selectively increases Etn uptake and phosphorylation, as well as PtdEtn synthesis. ETNK2 is found primarily in the liver and reproductive tissues. It plays a critical role in regulating placental hemostasis to support late embryo
Probab=69.38  E-value=5.1  Score=31.78  Aligned_cols=35  Identities=14%  Similarity=0.011  Sum_probs=26.9

Q ss_pred             HHhcccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         34 YTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        34 YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      .++.=||=|++|||++..++.+.-|||-++--..+
T Consensus       170 ~~l~H~Dl~~~Nil~~~~~~~~~lIDwe~a~~~~~  204 (235)
T cd05157         170 IVFCHNDLLSGNIIYNEEKNSVKFIDYEYAGYNYR  204 (235)
T ss_pred             EEEEcCCCCcCcEEEeCCCCCEEEEEcccCCcCch
Confidence            45666999999999994368899999976554433


No 97 
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=69.33  E-value=8.6  Score=32.63  Aligned_cols=25  Identities=28%  Similarity=0.309  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ .+|++.-+|||.+-
T Consensus       125 rDlKp~NILi~-~~~~vkL~DFGla~  149 (363)
T cd05628         125 RDIKPDNLLLD-SKGHVKLSDFGLCT  149 (363)
T ss_pred             cCCCHHHeEEC-CCCCEEEeeccCcc
Confidence            68899999999 78999999999753


No 98 
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=68.35  E-value=12  Score=34.28  Aligned_cols=49  Identities=24%  Similarity=0.281  Sum_probs=32.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhc--ccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         14 NRVRLRNNFVRSYACMCIAQYTLG--IGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        14 ~~~~~r~~F~~SlA~~sv~~YiLg--igDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +++..+..+...+|..-.--+-.|  =||-+|+|||+  .+|++.-||||..-
T Consensus       425 ~~l~~~~~~~~~i~~~L~~lH~~giiHrDlkp~NILl--~~~~~~liDFGla~  475 (535)
T PRK09605        425 DVLEGNPELVRKVGEIVAKLHKAGIVHGDLTTSNFIV--RDDRLYLIDFGLGK  475 (535)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhCCCccCCCChHHEEE--ECCcEEEEeCcccc
Confidence            444445566666654333223234  37999999999  47899999998764


No 99 
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=68.30  E-value=21  Score=27.97  Aligned_cols=27  Identities=26%  Similarity=0.188  Sum_probs=23.8

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|-+|+||+++ .+|.+.=+|||.....
T Consensus       126 ~di~p~Nili~-~~~~~~l~d~g~~~~~  152 (256)
T cd05039         126 RDLAARNVLVS-EDLVAKVSDFGLAKEA  152 (256)
T ss_pred             hhcccceEEEe-CCCCEEEccccccccc
Confidence            78999999999 7999999999977654


No 100
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=68.30  E-value=10  Score=31.58  Aligned_cols=26  Identities=38%  Similarity=0.427  Sum_probs=23.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|++.-+|||..-.
T Consensus       125 ~dlkp~Nil~~-~~~~~kL~Dfg~a~~  150 (333)
T cd05600         125 RDLKPENFLID-ASGHIKLTDFGLSKG  150 (333)
T ss_pred             cCCCHHHEEEC-CCCCEEEEeCcCCcc
Confidence            78899999999 799999999997753


No 101
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=68.28  E-value=14  Score=31.19  Aligned_cols=25  Identities=24%  Similarity=0.242  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+|||++ .+|.+.=+|||..-
T Consensus       197 rDikp~Nill~-~~~~vkL~DfG~a~  221 (337)
T cd05054         197 RDLAARNILLS-ENNVVKICDFGLAR  221 (337)
T ss_pred             CCCCcceEEEe-CCCcEEEeccccch
Confidence            79999999999 78999999999764


No 102
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=67.96  E-value=14  Score=30.02  Aligned_cols=26  Identities=27%  Similarity=0.247  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+.=+|||..-.
T Consensus       161 ~dlkp~Nili~-~~~~~kl~D~g~~~~  186 (304)
T cd05101         161 RDLAARNVLVT-ENNVMKIADFGLARD  186 (304)
T ss_pred             cccccceEEEc-CCCcEEECCCcccee
Confidence            68899999999 789999999997653


No 103
>PHA03212 serine/threonine kinase US3; Provisional
Probab=67.66  E-value=12  Score=32.52  Aligned_cols=24  Identities=29%  Similarity=0.364  Sum_probs=22.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +|=.|+|||++ ..|.+.-+|||..
T Consensus       206 rDiKP~NIll~-~~~~vkL~DFG~a  229 (391)
T PHA03212        206 RDIKAENIFIN-HPGDVCLGDFGAA  229 (391)
T ss_pred             CCCChHhEEEc-CCCCEEEEeCCcc
Confidence            68889999999 7899999999976


No 104
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=67.44  E-value=12  Score=30.45  Aligned_cols=25  Identities=32%  Similarity=0.197  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.=+|||..-
T Consensus       162 ~dlkp~Nill~-~~~~~kl~DfG~~~  186 (304)
T cd05096         162 RDLATRNCLVG-ENLTIKIADFGMSR  186 (304)
T ss_pred             cCcchhheEEc-CCccEEECCCccce
Confidence            78999999999 78999999999764


No 105
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=67.31  E-value=3.2  Score=34.57  Aligned_cols=25  Identities=28%  Similarity=0.368  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ .+|.+.-+|||.+-
T Consensus       125 ~dlkp~Nill~-~~~~~kL~Dfg~~~  149 (324)
T cd05587         125 RDLKLDNVMLD-AEGHIKIADFGMCK  149 (324)
T ss_pred             cCCCHHHeEEc-CCCCEEEeecCcce
Confidence            78899999999 79999999999753


No 106
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=67.30  E-value=10  Score=29.73  Aligned_cols=27  Identities=30%  Similarity=0.255  Sum_probs=23.8

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -||-.|+||+++ .+|.+.-+|||....
T Consensus       124 h~dl~p~ni~i~-~~~~~~l~d~g~~~~  150 (262)
T cd06613         124 HRDIKGANILLT-EDGDVKLADFGVSAQ  150 (262)
T ss_pred             ecCCChhhEEEC-CCCCEEECccccchh
Confidence            379999999999 799999999997754


No 107
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=67.03  E-value=10  Score=31.78  Aligned_cols=25  Identities=36%  Similarity=0.417  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+|||++ .+|++.-+|||..-
T Consensus       119 rDikp~NIll~-~~~~~kL~DfG~~~  143 (328)
T cd05593         119 RDLKLENLMLD-KDGHIKITDFGLCK  143 (328)
T ss_pred             cccCHHHeEEC-CCCcEEEecCcCCc
Confidence            78899999999 79999999999754


No 108
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=67.02  E-value=11  Score=32.21  Aligned_cols=24  Identities=29%  Similarity=0.416  Sum_probs=22.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +|-.|+|||++ .+|++.-+|||.+
T Consensus       125 rDlKp~NILl~-~~g~~kL~DFGla  148 (382)
T cd05625         125 RDIKPDNILID-RDGHIKLTDFGLC  148 (382)
T ss_pred             CCCCHHHEEEC-CCCCEEEeECCCC
Confidence            78899999999 7999999999975


No 109
>TIGR00938 thrB_alt homoserine kinase, Neisseria type. Homoserine kinase is required in the biosynthesis of threonine from aspartate.The member of this family from Pseudomonas aeruginosa was shown by direct assay and complementation to act specifically as a homoserine kinase.
Probab=66.80  E-value=5.3  Score=33.44  Aligned_cols=29  Identities=21%  Similarity=0.071  Sum_probs=23.5

Q ss_pred             HHhcccCCCCCceeEecCCCcEEeeecccc
Q psy18027         34 YTLGIGDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        34 YiLgigDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +.+-=||=|++|++++ .+|...-|||+.+
T Consensus       187 ~~l~HgD~~~~Nvl~~-~~~~~~vIDfd~~  215 (307)
T TIGR00938       187 RGVIHADLFPDNVLFD-GDSVKGVIDFYFA  215 (307)
T ss_pred             CccCCCCCCcCcEEEE-CCceEEEeecccc
Confidence            4455689999999999 5666689999876


No 110
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=66.78  E-value=14  Score=29.05  Aligned_cols=25  Identities=32%  Similarity=0.155  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-+|+||+++ .+|++.=+|||..-
T Consensus       128 ~dl~p~nilv~-~~~~~~l~dfg~~~  152 (263)
T cd06625         128 RDIKGANILRD-SAGNVKLGDFGASK  152 (263)
T ss_pred             CCCCHHHEEEc-CCCCEEEeecccce
Confidence            79999999999 89999999999753


No 111
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage
Probab=66.78  E-value=15  Score=29.28  Aligned_cols=26  Identities=19%  Similarity=0.153  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+|||++ .+|++.=+|||....
T Consensus       123 ~dikp~nil~~-~~~~~~l~Dfg~~~~  148 (268)
T cd05086         123 SDLALRNCFLT-SDLTVKVGDYGIGPS  148 (268)
T ss_pred             cCCccceEEEc-CCccEEecccccccc
Confidence            68899999999 789999999998653


No 112
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=66.72  E-value=12  Score=29.45  Aligned_cols=25  Identities=28%  Similarity=0.236  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.-+|||..-
T Consensus       124 ~dl~p~ni~i~-~~~~~kl~dfg~~~  148 (256)
T cd05059         124 RDLAARNCLVG-EDNVVKVSDFGLAR  148 (256)
T ss_pred             ccccHhhEEEC-CCCcEEECCcccce
Confidence            88899999999 79999999999764


No 113
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=66.27  E-value=15  Score=28.95  Aligned_cols=26  Identities=27%  Similarity=0.261  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+.=+|||..-.
T Consensus       126 ~dlkp~nil~~-~~~~~kl~dfg~~~~  151 (256)
T cd05082         126 RDLAARNVLVS-EDNVAKVSDFGLTKE  151 (256)
T ss_pred             cccchheEEEc-CCCcEEecCCcccee
Confidence            67789999999 899999999997653


No 114
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=66.21  E-value=18  Score=28.44  Aligned_cols=26  Identities=31%  Similarity=0.231  Sum_probs=22.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+.=+|||....
T Consensus       126 ~di~p~Nili~-~~~~~~l~dfg~~~~  151 (260)
T cd05070         126 RDLRSANILVG-DGLVCKIADFGLARL  151 (260)
T ss_pred             CCCccceEEEe-CCceEEeCCceeeee
Confidence            78899999999 789999999998753


No 115
>KOG0583|consensus
Probab=66.01  E-value=13  Score=32.80  Aligned_cols=85  Identities=21%  Similarity=0.156  Sum_probs=49.0

Q ss_pred             hHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcc--cCCCCCceeEecCCCcEEeeeccccccc-cc-CCCCCCCCC
Q psy18027          2 REGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGI--GDRHLENTLVCTKTGRCVGIDFGYSFGV-AT-QLLPIPELM   77 (165)
Q Consensus         2 ~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgi--gDRH~~Nili~~~tG~v~hIDFg~~f~~-~~-~~l~~~E~v   77 (165)
                      -+|+.+..+-.|  -.+|+-|-.=+.+... ++-.||  .|=-|+||+++..+|++--+|||+.=-. .. ..+...--.
T Consensus       108 ~~~i~~~g~l~E--~~ar~~F~Qlisav~y-~H~~gi~HRDLK~ENilld~~~~~~Kl~DFG~s~~~~~~~~~l~t~cGs  184 (370)
T KOG0583|consen  108 FDYIVNKGRLKE--DEARKYFRQLISAVAY-CHSRGIVHRDLKPENILLDGNEGNLKLSDFGLSAISPGEDGLLKTFCGS  184 (370)
T ss_pred             HHHHHHcCCCCh--HHHHHHHHHHHHHHHH-HHhCCEeeCCCCHHHEEecCCCCCEEEeccccccccCCCCCcccCCCCC
Confidence            355555444444  5566666554444333 333444  5667999999954499999999987633 11 133333334


Q ss_pred             CcccCHHHHHhh
Q psy18027         78 PFRLTPHILAVN   89 (165)
Q Consensus        78 PFRLT~~~~~~m   89 (165)
                      |-=..|++...-
T Consensus       185 p~Y~aPEvl~~~  196 (370)
T KOG0583|consen  185 PAYAAPEVLSGK  196 (370)
T ss_pred             cccCCHHHhCCC
Confidence            444555555443


No 116
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=65.92  E-value=12  Score=29.44  Aligned_cols=25  Identities=32%  Similarity=0.353  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-+|+||+++ .+|++.-+|||...
T Consensus       137 ~~l~p~ni~~~-~~~~~~l~d~~~~~  161 (275)
T cd06608         137 RDIKGQNILLT-KNAEVKLVDFGVSA  161 (275)
T ss_pred             CCCCHHHEEEc-cCCeEEECCCccce
Confidence            89999999999 78999999999764


No 117
>PHA03207 serine/threonine kinase US3; Provisional
Probab=65.85  E-value=11  Score=32.61  Aligned_cols=25  Identities=28%  Similarity=0.276  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+|||++ ..|.+.-+|||...
T Consensus       209 rDlkp~Nill~-~~~~~~l~DfG~a~  233 (392)
T PHA03207        209 RDVKTENIFLD-EPENAVLGDFGAAC  233 (392)
T ss_pred             cCCCHHHEEEc-CCCCEEEccCcccc
Confidence            78889999999 79999999999764


No 118
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=65.69  E-value=13  Score=29.34  Aligned_cols=26  Identities=23%  Similarity=0.213  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+.-+|||..-.
T Consensus       136 ~dlkp~Nil~~-~~~~~kl~Dfg~~~~  161 (272)
T cd05075         136 RDLAARNCMLN-ENMNVCVADFGLSKK  161 (272)
T ss_pred             cccchhheEEc-CCCCEEECCCCcccc
Confidence            68889999999 789999999997543


No 119
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=65.53  E-value=37  Score=26.81  Aligned_cols=28  Identities=29%  Similarity=0.192  Sum_probs=24.5

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVA   67 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~   67 (165)
                      ||-.|+||+++ ++|.+.=+|||......
T Consensus       128 ~dlkp~nil~~-~~~~~kl~df~~~~~~~  155 (263)
T cd05052         128 RDLAARNCLVG-ENHLVKVADFGLSRLMT  155 (263)
T ss_pred             cccCcceEEEc-CCCcEEeCCCccccccc
Confidence            78999999999 89999999999876543


No 120
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=65.16  E-value=9.9  Score=31.13  Aligned_cols=27  Identities=26%  Similarity=0.327  Sum_probs=23.7

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -||-+|+||+++ .+|.+.=+|||..-.
T Consensus       138 H~dL~p~Nili~-~~~~~kl~dfg~~~~  164 (296)
T cd06655         138 HRDIKSDNVLLG-MDGSVKLTDFGFCAQ  164 (296)
T ss_pred             cCCCCHHHEEEC-CCCCEEEccCccchh
Confidence            489999999999 799999999997653


No 121
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=65.13  E-value=15  Score=28.99  Aligned_cols=26  Identities=35%  Similarity=0.322  Sum_probs=22.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|.+.=+|||..-.
T Consensus       126 ~dl~p~ni~i~-~~~~~~l~dfg~~~~  151 (260)
T cd05067         126 RDLRAANILVS-ETLCCKIADFGLARL  151 (260)
T ss_pred             ccccHHhEEEc-CCCCEEEccCcceee
Confidence            68899999999 789999999998754


No 122
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=65.13  E-value=13  Score=31.21  Aligned_cols=25  Identities=28%  Similarity=0.369  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|++-=+|||.+-
T Consensus       120 ~Dikp~Nili~-~~~~~kL~DfG~~~  144 (329)
T cd05618         120 RDLKLDNVLLD-SEGHIKLTDYGMCK  144 (329)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCCccc
Confidence            78899999999 78999999999764


No 123
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=65.10  E-value=13  Score=31.17  Aligned_cols=26  Identities=31%  Similarity=0.370  Sum_probs=22.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+|||++ .+|++.=+|||....
T Consensus       126 ~dlkp~Nill~-~~~~~kl~Dfg~~~~  151 (331)
T cd05597         126 RDIKPDNVLLD-KNGHIRLADFGSCLR  151 (331)
T ss_pred             CCCCHHHEEEC-CCCCEEEEECCceee
Confidence            78899999999 799999999998643


No 124
>KOG0603|consensus
Probab=64.93  E-value=4.7  Score=38.28  Aligned_cols=31  Identities=19%  Similarity=0.126  Sum_probs=26.4

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      .+|-||+|||++...|++--+|||+.-....
T Consensus       438 hRDLkp~NIL~~~~~g~lrltyFG~a~~~~~  468 (612)
T KOG0603|consen  438 HRDLKPGNILLDGSAGHLRLTYFGFWSELER  468 (612)
T ss_pred             ecCCChhheeecCCCCcEEEEEechhhhCch
Confidence            5899999999954889999999998776544


No 125
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=64.88  E-value=12  Score=32.11  Aligned_cols=27  Identities=30%  Similarity=0.357  Sum_probs=23.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|=.|+|||++ ++|++.=+|||.+...
T Consensus       166 rDLKp~NILl~-~~~~~kL~DFG~a~~~  192 (370)
T cd05621         166 RDVKPDNMLLD-KHGHLKLADFGTCMKM  192 (370)
T ss_pred             cCCCHHHEEEC-CCCCEEEEecccceec
Confidence            68889999999 8999999999987643


No 126
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=64.85  E-value=12  Score=29.87  Aligned_cols=25  Identities=32%  Similarity=0.181  Sum_probs=22.2

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ ++|.+.=+|||..-
T Consensus       148 ~dlkp~Nil~~-~~~~~~L~dfg~~~  172 (283)
T cd05048         148 RDLAARNCLVG-EGLTVKISDFGLSR  172 (283)
T ss_pred             cccccceEEEc-CCCcEEECCCccee
Confidence            69999999999 78999999999764


No 127
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=64.75  E-value=16  Score=29.01  Aligned_cols=27  Identities=33%  Similarity=0.433  Sum_probs=24.1

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      ||-+|+||+++ ++|++.=+|||.....
T Consensus       124 ~dl~p~nil~~-~~~~~~l~dfg~~~~~  150 (286)
T cd07847         124 RDVKPENILIT-KQGQIKLCDFGFARIL  150 (286)
T ss_pred             cCCChhhEEEc-CCCcEEECccccceec
Confidence            89999999999 7899999999987654


No 128
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=64.54  E-value=15  Score=29.23  Aligned_cols=26  Identities=27%  Similarity=0.319  Sum_probs=23.3

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-+|+||+++ .+|.+.-+|||....
T Consensus       123 ~dl~p~nil~~-~~~~~~l~df~~~~~  148 (283)
T cd07835         123 RDLKPQNLLID-REGALKLADFGLARA  148 (283)
T ss_pred             CCCCHHHEEEc-CCCcEEEeecccccc
Confidence            89999999999 599999999998753


No 129
>PF01163 RIO1:  RIO1 family;  InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents RIO kinase, they exhibit little sequence similarity with eukaryotic protein kinases, and are classified as atypical protein kinases []. The conformation of ATP when bound to the RIO kinases is unique when compared with ePKs, such as serine/threonine kinases or the insulin receptor tyrosine kinase, suggesting that the detailed mechanism by which the catalytic aspartate of RIO kinases participates in phosphoryl transfer may not be identical to that employed in known serine/threonine ePKs. Representatives of the RIO family are present in organisms varying from Archaea to humans, although the RIO3 proteins have only been identified in multicellular eukaryotes, to date.   Yeast Rio1 and Rio2 proteins are required for proper cell cycle progression and chromosome maintenance, and are necessary for survival of the cells. These proteins are involved in the processing of 20 S pre-rRNA via late 18 S rRNA processing. ; GO: 0003824 catalytic activity, 0005524 ATP binding; PDB: 1TQP_A 1ZAR_A 1TQI_A 1ZAO_A 1TQM_A 3RE4_A 1ZTH_B 1ZP9_A 1ZTF_A.
Probab=64.44  E-value=7.5  Score=31.15  Aligned_cols=28  Identities=36%  Similarity=0.432  Sum_probs=20.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      ||=++.||+++  .|+++-||||-......
T Consensus       131 GDLs~~NIlv~--~~~~~iIDf~qav~~~~  158 (188)
T PF01163_consen  131 GDLSEYNILVD--DGKVYIIDFGQAVDSSH  158 (188)
T ss_dssp             SS-STTSEEEE--TTCEEE--GTTEEETTS
T ss_pred             cCCChhhEEee--cceEEEEecCcceecCC
Confidence            89999999998  35999999987776543


No 130
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=64.43  E-value=9.9  Score=31.14  Aligned_cols=27  Identities=26%  Similarity=0.373  Sum_probs=23.5

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -||-+|+||+++ ++|++.-+|||....
T Consensus       139 H~dl~p~Nilv~-~~~~~~l~dfg~~~~  165 (292)
T cd06657         139 HRDIKSDSILLT-HDGRVKLSDFGFCAQ  165 (292)
T ss_pred             cCCCCHHHEEEC-CCCCEEEccccccee
Confidence            489999999999 789999999997643


No 131
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=64.19  E-value=16  Score=29.53  Aligned_cols=26  Identities=31%  Similarity=0.276  Sum_probs=23.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|++.=+|||....
T Consensus       134 ~dlkp~Nili~-~~~~~kl~dfg~~~~  159 (292)
T cd06644         134 RDLKAGNVLLT-LDGDIKLADFGVSAK  159 (292)
T ss_pred             cCCCcceEEEc-CCCCEEEccCcccee
Confidence            89999999998 799999999997654


No 132
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]
Probab=64.09  E-value=6.4  Score=32.49  Aligned_cols=28  Identities=32%  Similarity=0.366  Sum_probs=23.2

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      ||=.++||+++  .|.++-||||...-+..
T Consensus       116 GDLTtsNiIl~--~~~i~~IDfGLg~~s~~  143 (204)
T COG3642         116 GDLTTSNIILS--GGRIYFIDFGLGEFSDE  143 (204)
T ss_pred             CCCccceEEEe--CCcEEEEECCccccccc
Confidence            89999999997  56699999998774443


No 133
>PF01633 Choline_kinase:  Choline/ethanolamine kinase;  InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2.7.1.32 from EC) belongs to the choline/ethanolamine kinase family. Ethanolamine and choline are major membrane phospholipids, in the form of glycerophosphoethanolamine and glycerophosphocholine. Ethanolamine is also a component of the glycosylphosphatidylinositol (GPI) anchor, which is necessary for cell-surface protein attachment []. The de novo synthesis of these phospholipids begins with the creation of phosphoethanolamine and phosphocholine by ethanolamine and choline kinases in the first step of the CDP-ethanolamine pathway [, ]. There are two putative choline/ethanolamine kinases (C/EKs) in the Trypanosoma brucei genome.  Ethanolamine kinase has no choline kinase activity [] and its activity is inhibited by ADP []. Inositol supplementation represses ethanolamine kinase, decreasing the incorporation of ethanolamine into the CDP-ethanolamine pathway and into phosphatidylethanolamine and phosphatidylcholine []. ; GO: 0016773 phosphotransferase activity, alcohol group as acceptor; PDB: 3C5I_A 2IG7_A 3LQ3_A 3FEG_A 2QG7_E 3FI8_A 1NW1_A 3MES_A 3G15_A 2CKP_B ....
Probab=63.88  E-value=4.3  Score=32.04  Aligned_cols=30  Identities=30%  Similarity=0.398  Sum_probs=21.0

Q ss_pred             HHhcccCCCCCceeEecCCCcEEeeecccc
Q psy18027         34 YTLGIGDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        34 YiLgigDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      .++.=+|=+++|||++..+|++.-|||-++
T Consensus       143 ~v~cHnDl~~~Nil~~~~~~~~~lIDfEya  172 (211)
T PF01633_consen  143 LVFCHNDLNPGNILINNKDGEVKLIDFEYA  172 (211)
T ss_dssp             EEEE-S--SGGGEEETSSSSCEEE--GTT-
T ss_pred             ceEeeccCccccEEeccCCCeEEEecHHHH
Confidence            678889999999999558999999999654


No 134
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH). The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibio
Probab=63.70  E-value=6.8  Score=31.34  Aligned_cols=28  Identities=29%  Similarity=0.199  Sum_probs=22.0

Q ss_pred             HhcccCCCCCceeEecCCCcEEeeecccc
Q psy18027         35 TLGIGDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        35 iLgigDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +|-=||=|++|||++ ..+.+--|||+.+
T Consensus       164 ~l~HgD~~~~Nil~~-~~~~~~iIDwe~a  191 (244)
T cd05150         164 VVTHGDACLPNIIVD-PGKFSGFIDLGRL  191 (244)
T ss_pred             EEECCCCCCccEEEe-CCcEEEEEEcccc
Confidence            344499999999999 5555669999866


No 135
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=63.68  E-value=4.2  Score=33.61  Aligned_cols=25  Identities=32%  Similarity=0.307  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ .+|.+.-+|||.+-
T Consensus       117 rDlkp~Nili~-~~~~~kl~Dfg~~~  141 (312)
T cd05585         117 RDLKPENILLD-YQGHIALCDFGLCK  141 (312)
T ss_pred             CCCCHHHeEEC-CCCcEEEEECcccc
Confidence            68889999999 79999999999764


No 136
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=63.63  E-value=14  Score=29.24  Aligned_cols=26  Identities=27%  Similarity=0.309  Sum_probs=23.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|.+.-+|||....
T Consensus       135 ~dl~~~nili~-~~~~~~l~Dfg~~~~  160 (272)
T cd06637         135 RDIKGQNVLLT-ENAEVKLVDFGVSAQ  160 (272)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCCCcee
Confidence            68899999999 789999999998754


No 137
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=63.42  E-value=21  Score=29.28  Aligned_cols=26  Identities=35%  Similarity=0.279  Sum_probs=23.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-.|+|||++ .+|.+.=+|||..-.
T Consensus       148 ~dlkp~Nili~-~~~~~kl~dfg~~~~  173 (303)
T cd05088         148 RDLAARNILVG-ENYVAKIADFGLSRG  173 (303)
T ss_pred             cccchheEEec-CCCcEEeCccccCcc
Confidence            78889999999 789999999998753


No 138
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=63.41  E-value=17  Score=29.42  Aligned_cols=26  Identities=27%  Similarity=0.249  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ ++|++-=+|||....
T Consensus       126 ~dlkp~Nil~~-~~~~~~l~Dfg~~~~  151 (285)
T cd05605         126 RDLKPENILLD-DYGHIRISDLGLAVE  151 (285)
T ss_pred             cCCCHHHEEEC-CCCCEEEeeCCCcee
Confidence            78889999999 789999999998754


No 139
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=63.38  E-value=4.4  Score=33.64  Aligned_cols=25  Identities=36%  Similarity=0.408  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|++.=+|||.+-
T Consensus       126 ~Dlkp~NIll~-~~~~~kL~Dfg~a~  150 (330)
T cd05601         126 RDIKPENVLID-RTGHIKLADFGSAA  150 (330)
T ss_pred             ccCchHheEEC-CCCCEEeccCCCCe
Confidence            78899999999 89999999999864


No 140
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=63.35  E-value=16  Score=28.78  Aligned_cols=26  Identities=27%  Similarity=0.215  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|.+--+|||..-.
T Consensus       119 ~dlkp~nill~-~~~~~kl~Dfg~~~~  144 (257)
T cd05116         119 RDLAARNVLLV-TQHYAKISDFGLSKA  144 (257)
T ss_pred             cccchhhEEEc-CCCeEEECCCccccc
Confidence            78899999999 688899999997643


No 141
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological 
Probab=63.16  E-value=18  Score=28.64  Aligned_cols=25  Identities=24%  Similarity=0.165  Sum_probs=22.1

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.=+|||...
T Consensus       143 ~di~p~nill~-~~~~~kl~dfg~~~  167 (277)
T cd05032         143 RDLAARNCMVA-EDLTVKIGDFGMTR  167 (277)
T ss_pred             cccChheEEEc-CCCCEEECCcccch
Confidence            78889999999 78999999999754


No 142
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=62.94  E-value=13  Score=30.54  Aligned_cols=25  Identities=24%  Similarity=0.191  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ .+|.+.=+|||.+-
T Consensus       127 ~dlkp~NIll~-~~~~~kL~Dfg~~~  151 (338)
T cd07859         127 RDLKPKNILAN-ADCKLKICDFGLAR  151 (338)
T ss_pred             CCCCHHHeEEC-CCCcEEEccCcccc
Confidence            68899999999 89999999999864


No 143
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=62.82  E-value=4  Score=32.89  Aligned_cols=25  Identities=32%  Similarity=0.395  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.-+|||..-
T Consensus       134 ~dlkp~Nil~~-~~~~~kl~Dfg~~~  158 (290)
T cd07862         134 RDLKPQNILVT-SSGQIKLADFGLAR  158 (290)
T ss_pred             CCCCHHHEEEc-CCCCEEEccccceE
Confidence            78899999999 78999999999864


No 144
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=62.81  E-value=15  Score=31.19  Aligned_cols=25  Identities=28%  Similarity=0.147  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+.-+|||..-
T Consensus       127 ~dlkp~Nili~-~~~~~kL~Dfg~a~  151 (372)
T cd07853         127 RDIKPGNLLVN-SNCVLKICDFGLAR  151 (372)
T ss_pred             CCCChHHEEEC-CCCCEEecccccee
Confidence            68889999999 79999999999765


No 145
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=62.42  E-value=4.1  Score=33.88  Aligned_cols=26  Identities=27%  Similarity=0.350  Sum_probs=23.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+|||++ .+|++.-+|||.+-.
T Consensus       125 rDlkp~Nill~-~~~~~kL~DfG~~~~  150 (323)
T cd05616         125 RDLKLDNVMLD-SEGHIKIADFGMCKE  150 (323)
T ss_pred             cCCCHHHeEEC-CCCcEEEccCCCcee
Confidence            78899999999 799999999997643


No 146
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=62.27  E-value=4.4  Score=33.66  Aligned_cols=25  Identities=44%  Similarity=0.509  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ .+|++.-+|||..-
T Consensus       129 rDlkp~Nili~-~~~~~kl~DfG~~~  153 (332)
T cd05614         129 RDIKLENILLD-SEGHVVLTDFGLSK  153 (332)
T ss_pred             cCCCHHHeEEC-CCCCEEEeeCcCCc
Confidence            78899999999 78999999999753


No 147
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=61.82  E-value=4.2  Score=33.68  Aligned_cols=25  Identities=36%  Similarity=0.401  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|++.-+|||.+-
T Consensus       120 ~Dlkp~NIll~-~~~~~kl~Dfg~~~  144 (321)
T cd05603         120 RDLKPENILLD-SQGHVVLTDFGLCK  144 (321)
T ss_pred             ccCCHHHeEEC-CCCCEEEccCCCCc
Confidence            78899999999 78999999999754


No 148
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=61.59  E-value=16  Score=30.18  Aligned_cols=26  Identities=35%  Similarity=0.336  Sum_probs=23.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|.+.-+|||....
T Consensus       122 ~dlkp~Nil~~-~~~~~kL~Dfg~~~~  147 (318)
T cd05582         122 RDLKPENILLD-EEGHIKLTDFGLSKE  147 (318)
T ss_pred             CCCCHHHeEEC-CCCcEEEeeccCCcc
Confidence            78899999999 789999999997653


No 149
>KOG1235|consensus
Probab=61.40  E-value=7  Score=36.59  Aligned_cols=28  Identities=29%  Similarity=0.260  Sum_probs=23.4

Q ss_pred             cCCCCCceeEec---CCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCT---KTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~---~tG~v~hIDFg~~f~~   66 (165)
                      +|=||+||++.+   ..++++--|||..=.-
T Consensus       325 aDPHPGNilv~~~~~~~~~ivllDhGl~~~i  355 (538)
T KOG1235|consen  325 ADPHPGNILVRPNPEGDEEIVLLDHGLYAVI  355 (538)
T ss_pred             CCCCCCcEEEecCCCCCccEEEEcccccccc
Confidence            699999999994   4899999999876543


No 150
>KOG0612|consensus
Probab=61.31  E-value=9.6  Score=38.97  Aligned_cols=53  Identities=21%  Similarity=0.260  Sum_probs=40.4

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccccc-cCCCC--CCCCCCcccCHHHHHhhCCC
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVA-TQLLP--IPELMPFRLTPHILAVNEPY   92 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~-~~~l~--~~E~vPFRLT~~~~~~mg~~   92 (165)
                      .|--||||||| ..|||=-.|||.|+--. .+...  ++=-.|==++|++...+|..
T Consensus       199 RDiKPDNvLld-~~GHikLADFGsClkm~~dG~V~s~~aVGTPDYISPEvLqs~~~~  254 (1317)
T KOG0612|consen  199 RDIKPDNVLLD-KSGHIKLADFGSCLKMDADGTVRSSVAVGTPDYISPEVLQSQGDG  254 (1317)
T ss_pred             ccCCcceeEec-ccCcEeeccchhHHhcCCCCcEEeccccCCCCccCHHHHHhhcCC
Confidence            57889999999 89999999999998533 21211  23335667899999999886


No 151
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1. Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto
Probab=61.20  E-value=4.3  Score=32.10  Aligned_cols=29  Identities=28%  Similarity=0.138  Sum_probs=24.7

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVA   67 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~   67 (165)
                      -||-+|+||+++ .+|++..+|||......
T Consensus       125 H~dl~~~ni~i~-~~~~~~l~df~~~~~~~  153 (280)
T cd05581         125 HRDLKPENILLD-KDMHIKITDFGTAKVLD  153 (280)
T ss_pred             ecCCCHHHeEEC-CCCCEEecCCccccccC
Confidence            369999999999 79999999999876443


No 152
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved 
Probab=61.18  E-value=14  Score=30.60  Aligned_cols=25  Identities=32%  Similarity=0.340  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+.-+|||.+-
T Consensus       125 rdlkp~Nill~-~~~~~kL~Dfg~~~  149 (324)
T cd05589         125 RDLKLDNLLLD-TEGFVKIADFGLCK  149 (324)
T ss_pred             cCCCHHHeEEC-CCCcEEeCcccCCc
Confidence            78899999999 78999999999754


No 153
>PHA02882 putative serine/threonine kinase; Provisional
Probab=61.17  E-value=5.8  Score=32.51  Aligned_cols=24  Identities=38%  Similarity=0.483  Sum_probs=21.5

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +|=.|+|||++ ..|.+.-+|||.+
T Consensus       150 rDiKp~Nill~-~~~~~~l~DFGla  173 (294)
T PHA02882        150 GDIKPENIMVD-GNNRGYIIDYGIA  173 (294)
T ss_pred             CCCCHHHEEEc-CCCcEEEEEcCCc
Confidence            67789999999 7899999999986


No 154
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt 
Probab=61.07  E-value=4.5  Score=33.69  Aligned_cols=25  Identities=36%  Similarity=0.387  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+|||++ .+|.+.=+|||..-
T Consensus       120 rDlkp~Nili~-~~~~~kl~DfG~a~  144 (325)
T cd05602         120 RDLKPENILLD-SQGHIVLTDFGLCK  144 (325)
T ss_pred             cCCCHHHeEEC-CCCCEEEccCCCCc
Confidence            79999999999 79999999999763


No 155
>KOG0594|consensus
Probab=60.97  E-value=6.1  Score=34.74  Aligned_cols=50  Identities=26%  Similarity=0.290  Sum_probs=34.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHhcc--cCCCCCceeEecCCCcEEeeecccccccc
Q psy18027         17 RLRNNFVRSYACMCIAQYTLGI--GDRHLENTLVCTKTGRCVGIDFGYSFGVA   67 (165)
Q Consensus        17 ~~r~~F~~SlA~~sv~~YiLgi--gDRH~~Nili~~~tG~v~hIDFg~~f~~~   67 (165)
                      ...+.|.+++--.--.++-=||  .|=.|+||||+ ++|.+--+|||..-..+
T Consensus       120 ~~ik~~m~Qll~gl~~~H~~~IlHRDLKPQNlLi~-~~G~lKlaDFGlAra~~  171 (323)
T KOG0594|consen  120 RLIKSFMRQLLRGLAFLHSHGILHRDLKPQNLLIS-SSGVLKLADFGLARAFS  171 (323)
T ss_pred             HHHHHHHHHHHHHHHHHHhCCeecccCCcceEEEC-CCCcEeeeccchHHHhc
Confidence            3456666665433223333333  68899999999 69999999999877544


No 156
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=60.86  E-value=5.1  Score=33.38  Aligned_cols=25  Identities=36%  Similarity=0.417  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+.=+|||.+-
T Consensus       119 rDlkp~NIll~-~~~~~kl~DfG~a~  143 (323)
T cd05571         119 RDLKLENLMLD-KDGHIKITDFGLCK  143 (323)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCCCCc
Confidence            68899999999 79999999999753


No 157
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=60.68  E-value=4.8  Score=33.44  Aligned_cols=25  Identities=36%  Similarity=0.401  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+.-+|||.+-
T Consensus       120 ~dikp~NIll~-~~~~~kl~Dfg~~~  144 (323)
T cd05575         120 RDLKPENILLD-SQGHVVLTDFGLCK  144 (323)
T ss_pred             CCCCHHHeEEC-CCCcEEEeccCCCc
Confidence            68899999999 79999999999764


No 158
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase
Probab=60.60  E-value=7.6  Score=33.33  Aligned_cols=35  Identities=20%  Similarity=0.167  Sum_probs=29.9

Q ss_pred             HHhcccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         34 YTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        34 YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      .++.=+|-+++|||++.+.|++.-|||.++--+.+
T Consensus       182 ~v~CHnDl~~~NiL~~~~~~~l~lID~EYag~nd~  216 (330)
T PLN02421        182 VVFAHNDLLSGNLMLNEDEGKLYFIDFEYGSYSYR  216 (330)
T ss_pred             eEEEECCCCcccEEEeCCCCcEEEEcccccCCCcc
Confidence            57788999999999986678999999988876666


No 159
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=60.59  E-value=5.9  Score=32.44  Aligned_cols=25  Identities=32%  Similarity=0.385  Sum_probs=22.2

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      -+|=+|+||+++ .+|.+.-+|||..
T Consensus       124 H~dl~p~NIll~-~~~~~~l~dfg~~  148 (305)
T cd05609         124 HRDLKPDNLLIT-SMGHIKLTDFGLS  148 (305)
T ss_pred             ccCCchHHEEEC-CCCCEEEeeCCCc
Confidence            368899999999 8999999999965


No 160
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=60.55  E-value=5  Score=33.29  Aligned_cols=25  Identities=36%  Similarity=0.545  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|++.-+|||.+-
T Consensus       120 rDikp~Nill~-~~~~~kL~Dfg~~~  144 (321)
T cd05591         120 RDLKLDNILLD-AEGHCKLADFGMCK  144 (321)
T ss_pred             cCCCHHHeEEC-CCCCEEEeecccce
Confidence            68889999999 79999999999764


No 161
>PRK09188 serine/threonine protein kinase; Provisional
Probab=60.53  E-value=7.3  Score=34.47  Aligned_cols=25  Identities=28%  Similarity=0.315  Sum_probs=21.7

Q ss_pred             cCC-CCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDR-HLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDR-H~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|= -|+|||++ .+|++.-+|||.+-
T Consensus       135 rDL~KP~NILv~-~~~~ikLiDFGlA~  160 (365)
T PRK09188        135 NDLAKPQNWLMG-PDGEAAVIDFQLAS  160 (365)
T ss_pred             CCCCCcceEEEc-CCCCEEEEECccce
Confidence            677 59999998 78999999999765


No 162
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=60.47  E-value=19  Score=28.75  Aligned_cols=26  Identities=31%  Similarity=0.335  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ ..|.+--+|||....
T Consensus       148 ~dlkp~nili~-~~~~~kl~dfg~~~~  173 (286)
T cd06638         148 RDVKGNNILLT-TEGGVKLVDFGVSAQ  173 (286)
T ss_pred             cCCCHHhEEEC-CCCCEEEccCCceee
Confidence            78899999999 789999999998754


No 163
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=60.33  E-value=16  Score=26.59  Aligned_cols=33  Identities=27%  Similarity=0.273  Sum_probs=26.0

Q ss_pred             hcccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         36 LGIGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        36 LgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      +--||-+|+||+++..++++.-+|||..-....
T Consensus       113 ~~H~dl~~~ni~~~~~~~~~~l~d~~~~~~~~~  145 (215)
T cd00180         113 IIHRDLKPENILLDSDNGKVKLADFGLSKLLTS  145 (215)
T ss_pred             eeccCCCHhhEEEeCCCCcEEEecCCceEEccC
Confidence            344799999999993389999999988765444


No 164
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=60.10  E-value=14  Score=28.70  Aligned_cols=28  Identities=18%  Similarity=0.062  Sum_probs=24.2

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      -||=+|+||+++ .+|++.-+|||..-..
T Consensus       133 h~dl~p~nili~-~~~~~kl~d~g~~~~~  160 (265)
T cd08217         133 HRDLKPANIFLD-ANNNVKLGDFGLAKIL  160 (265)
T ss_pred             ecCCCHHHEEEe-cCCCEEEecccccccc
Confidence            478899999999 7899999999976654


No 165
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH2' is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). MPH2' catalyzes the transfer of the gamma-phosphoryl group from ATP to the 2'-hydroxyl of macrolide antibiotics such as erythromycin, clarithromycin, and azithromycin, among others. Macrolides penetrate the bacterial cell and bind to ribosomes, where it interrupts protein elongation, leading ultimately to the demise of the bacterium. Phosphorylation of macrolides leads to their inactivation. Based on substrate specificity and amino acid sequence, MPH2' is divided into types I and II, encoded by mphA and mphB genes, respectively. MPH2'I inactivates 14-membered ring macrolides while MPH2'II inactivates both 14- and 16-membered ring macrolides. Enzymatic inactivation of macrolides has been reported 
Probab=59.93  E-value=7.8  Score=32.55  Aligned_cols=28  Identities=29%  Similarity=0.279  Sum_probs=21.8

Q ss_pred             hcccCCCCCceeEecCCCcEE-eeeccccc
Q psy18027         36 LGIGDRHLENTLVCTKTGRCV-GIDFGYSF   64 (165)
Q Consensus        36 LgigDRH~~Nili~~~tG~v~-hIDFg~~f   64 (165)
                      +-=||=|++|||++ ++|++. -|||+.+-
T Consensus       187 lvHGD~~~~Nilv~-~~~~~~gviDWe~a~  215 (276)
T cd05152         187 LVHGDLHPGHILID-EDARVTGLIDWTEAK  215 (276)
T ss_pred             eEeCCCCCCcEEEe-CCCCEEEEECcHhcc
Confidence            34499999999999 457764 78998754


No 166
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=59.91  E-value=23  Score=27.60  Aligned_cols=28  Identities=29%  Similarity=0.138  Sum_probs=24.5

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      -+|-.|+||+++ .+|++-=+|||.....
T Consensus       116 h~di~p~nili~-~~~~~~l~d~g~~~~~  143 (251)
T cd05041         116 HRDLAARNCLVG-ENNVLKISDFGMSREE  143 (251)
T ss_pred             hhhcCcceEEEc-CCCcEEEeeccccccc
Confidence            489999999999 7999999999987643


No 167
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=59.84  E-value=16  Score=30.30  Aligned_cols=25  Identities=32%  Similarity=0.391  Sum_probs=22.2

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ ++|.+.-+|||..-
T Consensus       120 ~dlkp~Nill~-~~~~~kl~Dfg~~~  144 (318)
T cd05570         120 RDLKLDNVLLD-SEGHIKIADFGMCK  144 (318)
T ss_pred             cCCCHHHeEEC-CCCcEEecccCCCe
Confidence            78889999999 79999999999763


No 168
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=59.78  E-value=15  Score=29.35  Aligned_cols=25  Identities=28%  Similarity=0.323  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-+|+||+++ .+|.+.-+|||..-
T Consensus       125 ~dl~p~ni~i~-~~~~~~l~dfg~~~  149 (277)
T cd06642         125 RDIKAANVLLS-EQGDVKLADFGVAG  149 (277)
T ss_pred             cCCChheEEEe-CCCCEEEccccccc
Confidence            78999999999 78999999999764


No 169
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=59.67  E-value=26  Score=27.20  Aligned_cols=27  Identities=33%  Similarity=0.267  Sum_probs=23.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      ||-.|+||+++ .+|.+-=+|||.....
T Consensus       126 ~dl~~~ni~~~-~~~~~kl~d~~~~~~~  152 (258)
T cd06632         126 RDIKGANILVD-TNGVVKLADFGMAKQV  152 (258)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCccceec
Confidence            78899999999 7899999999976543


No 170
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=59.64  E-value=19  Score=29.03  Aligned_cols=26  Identities=27%  Similarity=0.295  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|.+.=+|||....
T Consensus       121 ~dlkp~Nili~-~~~~~~l~dfg~~~~  146 (280)
T cd05608         121 RDLKPENVLLD-NDGNVRISDLGLAVE  146 (280)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCcccee
Confidence            67789999999 799999999998753


No 171
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=59.39  E-value=5.6  Score=32.44  Aligned_cols=26  Identities=35%  Similarity=0.409  Sum_probs=23.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|.+.-+|||..-.
T Consensus       125 ~dlkp~NIli~-~~~~~kl~Dfg~~~~  150 (291)
T cd05612         125 RDLKPENILLD-KEGHIKLTDFGFAKK  150 (291)
T ss_pred             cCCCHHHeEEC-CCCCEEEEecCcchh
Confidence            68889999999 799999999998654


No 172
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=59.38  E-value=22  Score=28.75  Aligned_cols=25  Identities=28%  Similarity=0.292  Sum_probs=22.2

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ ++|.+.=+|||..-
T Consensus       126 ~dikp~Nill~-~~~~~kl~Dfg~~~  150 (285)
T cd05631         126 RDLKPENILLD-DRGHIRISDLGLAV  150 (285)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCCCcE
Confidence            78889999999 78999999999764


No 173
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as 
Probab=59.33  E-value=18  Score=29.33  Aligned_cols=26  Identities=27%  Similarity=0.262  Sum_probs=22.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|.+.=+|||....
T Consensus       126 ~dikp~Nil~~-~~~~~~l~Dfg~~~~  151 (285)
T cd05630         126 RDLKPENILLD-DHGHIRISDLGLAVH  151 (285)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeccceee
Confidence            68889999999 789999999997753


No 174
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=59.24  E-value=6.5  Score=30.74  Aligned_cols=26  Identities=31%  Similarity=0.198  Sum_probs=23.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-+|+||+++ .+|.+.=+|||..-.
T Consensus       117 ~dl~p~nili~-~~~~~~l~d~g~~~~  142 (250)
T cd05085         117 RDLAARNCLVG-ENNVLKISDFGMSRQ  142 (250)
T ss_pred             cccChheEEEc-CCCeEEECCCcccee
Confidence            79999999999 799999999997643


No 175
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=59.23  E-value=17  Score=29.93  Aligned_cols=29  Identities=31%  Similarity=0.281  Sum_probs=25.1

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      ||-+|+||+++ .+|++.-+|||.......
T Consensus       127 ~dlkp~nili~-~~~~~~L~dfg~~~~~~~  155 (330)
T cd07834         127 RDLKPSNILVN-SNCDLKICDFGLARGVDP  155 (330)
T ss_pred             CCCCHHHEEEc-CCCCEEEcccCceEeecc
Confidence            78999999999 679999999998876544


No 176
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=59.14  E-value=19  Score=28.79  Aligned_cols=27  Identities=26%  Similarity=0.333  Sum_probs=23.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|=.|+||+++ .+|.+.=+|||.....
T Consensus       124 ~dlkp~Nill~-~~~~~kl~Dfg~~~~~  150 (287)
T cd07848         124 RDIKPENLLIS-HNDVLKLCDFGFARNL  150 (287)
T ss_pred             CCCCHHHEEEc-CCCcEEEeeccCcccc
Confidence            67889999999 7899999999987643


No 177
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=58.77  E-value=29  Score=28.31  Aligned_cols=26  Identities=27%  Similarity=0.252  Sum_probs=23.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-+|+||+++ .+|.+.=+|||....
T Consensus       139 ~dl~p~nIl~~-~~~~~kL~dfg~~~~  164 (307)
T cd06607         139 RDIKAGNILLT-EPGTVKLADFGSASL  164 (307)
T ss_pred             cCCCcccEEEC-CCCCEEEeecCccee
Confidence            78999999999 789999999997753


No 178
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=58.61  E-value=5.2  Score=32.81  Aligned_cols=26  Identities=27%  Similarity=0.330  Sum_probs=22.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|.+.=+|||..-.
T Consensus       128 ~dlkp~Nill~-~~~~~kl~Dfg~~~~  153 (309)
T cd07872         128 RDLKPQNLLIN-ERGELKLADFGLARA  153 (309)
T ss_pred             CCCCHHHEEEC-CCCCEEECcccccee
Confidence            78899999999 789999999998643


No 179
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=58.33  E-value=5.3  Score=33.20  Aligned_cols=25  Identities=36%  Similarity=0.433  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+.-+|||.+-
T Consensus       120 ~dlkp~Nill~-~~~~~kL~Dfg~a~  144 (316)
T cd05592         120 RDLKLDNVLLD-KDGHIKIADFGMCK  144 (316)
T ss_pred             CCCCHHHeEEC-CCCCEEEccCcCCe
Confidence            68889999999 78999999999764


No 180
>KOG0667|consensus
Probab=58.13  E-value=21  Score=33.82  Aligned_cols=65  Identities=28%  Similarity=0.204  Sum_probs=44.4

Q ss_pred             ChHHHhccCCCchHHHHHHHHHHHHHHHHHHHHHHhcc--cCCCCCceeE-ecCCCcEEeeeccccccc
Q psy18027          1 MREGLLSVAKSPMNRVRLRNNFVRSYACMCIAQYTLGI--GDRHLENTLV-CTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus         1 L~~~f~~~~~~~~~~~~~r~~F~~SlA~~sv~~YiLgi--gDRH~~Nili-~~~tG~v~hIDFg~~f~~   66 (165)
                      |++++..+...+-.. ...+.|++|+.-.-..-.-+||  +|--|+|||+ +....+|=-||||..=-.
T Consensus       274 LYellK~n~f~Glsl-~~ir~~~~Qil~~L~~L~~l~IIHcDLKPENILL~~~~r~~vKVIDFGSSc~~  341 (586)
T KOG0667|consen  274 LYELLKNNKFRGLSL-PLVRKFAQQILTALLFLHELGIIHCDLKPENILLKDPKRSRIKVIDFGSSCFE  341 (586)
T ss_pred             HHHHHHhcCCCCCCH-HHHHHHHHHHHHHHHHHHhCCeeeccCChhheeeccCCcCceeEEeccccccc
Confidence            345555555444222 3456788887777666677887  7999999999 445568999999975433


No 181
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=57.92  E-value=5.9  Score=33.12  Aligned_cols=27  Identities=30%  Similarity=0.377  Sum_probs=23.7

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -+|=.|+|||++ .+|.+.=+|||..-.
T Consensus       141 H~dlkp~NIll~-~~~~~kl~Dfg~~~~  167 (329)
T PTZ00263        141 YRDLKPENLLLD-NKGHVKVTDFGFAKK  167 (329)
T ss_pred             ecCCCHHHEEEC-CCCCEEEeeccCceE
Confidence            478899999999 899999999998754


No 182
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=57.31  E-value=26  Score=27.93  Aligned_cols=25  Identities=28%  Similarity=0.254  Sum_probs=22.1

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|++.=+|||..-
T Consensus       133 ~dlkp~Nil~~-~~~~~kL~dfG~~~  157 (279)
T cd05109         133 RDLAARNVLVK-SPNHVKITDFGLAR  157 (279)
T ss_pred             cccccceEEEc-CCCcEEECCCCcee
Confidence            78899999998 78999999999753


No 183
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=57.22  E-value=21  Score=29.16  Aligned_cols=25  Identities=28%  Similarity=0.248  Sum_probs=22.2

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.-+|||..-
T Consensus       164 ~dlkp~Nill~-~~~~~kL~dfg~a~  188 (307)
T cd05098         164 RDLAARNVLVT-EDNVMKIADFGLAR  188 (307)
T ss_pred             ccccHHheEEc-CCCcEEECCCcccc
Confidence            78889999999 78999999999764


No 184
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.
Probab=57.20  E-value=9  Score=29.99  Aligned_cols=25  Identities=20%  Similarity=0.171  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-.|+||+++ .+|.+.=+|||..-
T Consensus       126 ~di~p~nil~~-~~~~~~l~df~~~~  150 (257)
T cd08223         126 RDLKTQNVFLT-RTNIIKVGDLGIAR  150 (257)
T ss_pred             cCCCchhEEEe-cCCcEEEecccceE
Confidence            78999999999 79999999999764


No 185
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=57.19  E-value=33  Score=27.61  Aligned_cols=26  Identities=27%  Similarity=0.264  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-+|+||+++..++.+.-+|||.+.
T Consensus       126 ~dl~p~nill~~~~~~~kl~dfg~~~  151 (294)
T PLN00009        126 RDLKPQNLLIDRRTNALKLADFGLAR  151 (294)
T ss_pred             CCCCcceEEEECCCCEEEEccccccc
Confidence            78899999999667788888999874


No 186
>TIGR02906 spore_CotS spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers.
Probab=57.09  E-value=9.6  Score=31.41  Aligned_cols=28  Identities=25%  Similarity=0.278  Sum_probs=23.6

Q ss_pred             HHhcccCCCCCceeEecCCCcEEeeecccc
Q psy18027         34 YTLGIGDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        34 YiLgigDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +.+-=||=|++|++++ . |.+.-|||..+
T Consensus       187 ~~liHgD~~~~Nil~~-~-~~i~lIDfd~~  214 (313)
T TIGR02906       187 RGFCHQDYAYHNILLK-D-NEVYVIDFDYC  214 (313)
T ss_pred             CceEcCCCCcccEEEe-C-CcEEEEECccc
Confidence            5567899999999998 4 78999999854


No 187
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=57.07  E-value=20  Score=28.58  Aligned_cols=26  Identities=31%  Similarity=0.364  Sum_probs=22.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=+|+||+++ .+|.+.=+|||..-.
T Consensus       123 ~dl~~~nil~~-~~~~~~l~dfg~~~~  148 (284)
T cd07839         123 RDLKPQNLLIN-KNGELKLADFGLARA  148 (284)
T ss_pred             CCCCHHHEEEc-CCCcEEECccchhhc
Confidence            88899999999 789999999997653


No 188
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=56.99  E-value=22  Score=27.75  Aligned_cols=26  Identities=23%  Similarity=0.170  Sum_probs=22.6

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      -+|-+|+||+++ .+|.+.=+|||..-
T Consensus       120 H~di~p~nil~~-~~~~~kl~dfg~~~  145 (257)
T cd05040         120 HRDLAARNILLA-SDDKVKIGDFGLMR  145 (257)
T ss_pred             ccccCcccEEEe-cCCEEEeccccccc
Confidence            378899999999 67999999999764


No 189
>TIGR02721 ycfN_thiK thiamine kinase. Members of this family are the ycfN gene product of Escherichia coli, now identified as the salvage enzyme thiamine kinase (thiK), and additional proteobacterial homologs taken to be orthologs with equivalent function.
Probab=56.98  E-value=9.1  Score=31.01  Aligned_cols=32  Identities=25%  Similarity=0.128  Sum_probs=25.1

Q ss_pred             HhcccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         35 TLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        35 iLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      ++.=||=|++||+++ .+| +.-|||..+--..+
T Consensus       147 ~l~H~Dl~~~Nil~~-~~~-~~lIDwE~a~~gdp  178 (256)
T TIGR02721       147 APLHMDVHAYNLVVT-PQG-LKLIDWEYASDGDI  178 (256)
T ss_pred             eeecCCCCcCcEEEe-CCC-CEEEeccccCcCCH
Confidence            455699999999998 566 78999977655544


No 190
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=56.95  E-value=21  Score=28.49  Aligned_cols=26  Identities=27%  Similarity=0.287  Sum_probs=22.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||=+|+||+++ .+|.+.=+|||....
T Consensus       119 ~di~p~Nil~~-~~~~~~l~dfg~~~~  144 (277)
T cd05577         119 RDLKPENVLLD-DHGNVRISDLGLAVE  144 (277)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCcchhh
Confidence            78889999999 799999999997654


No 191
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=56.83  E-value=21  Score=29.73  Aligned_cols=26  Identities=27%  Similarity=0.300  Sum_probs=23.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|++.-+|||....
T Consensus       126 rDlkp~Nili~-~~~~~kL~DfG~a~~  151 (332)
T cd05623         126 RDIKPDNILMD-MNGHIRLADFGSCLK  151 (332)
T ss_pred             cCCCHHHEEEC-CCCCEEEeecchhee
Confidence            78889999999 899999999997643


No 192
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=56.65  E-value=17  Score=29.27  Aligned_cols=28  Identities=25%  Similarity=0.291  Sum_probs=24.6

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVA   67 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~   67 (165)
                      ||-.|+||+++ .+|.+.=+|||......
T Consensus       126 ~dl~p~nill~-~~~~~~l~dfg~~~~~~  153 (298)
T cd07841         126 RDLKPNNLLIA-SDGVLKLADFGLARSFG  153 (298)
T ss_pred             cCCChhhEEEc-CCCCEEEccceeeeecc
Confidence            89999999999 79999999999876543


No 193
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=56.55  E-value=27  Score=28.68  Aligned_cols=25  Identities=36%  Similarity=0.292  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.-+|||..-
T Consensus       124 ~dl~p~nil~~-~~~~~~l~dfg~~~  148 (308)
T cd06615         124 RDVKPSNILVN-SRGEIKLCDFGVSG  148 (308)
T ss_pred             CCCChHHEEEe-cCCcEEEccCCCcc
Confidence            89999999999 78999999999754


No 194
>PLN02236 choline kinase
Probab=56.54  E-value=10  Score=32.81  Aligned_cols=34  Identities=18%  Similarity=0.161  Sum_probs=27.8

Q ss_pred             HHHhcccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         33 QYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        33 ~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      ..++.=+|=+++|||++.+++.+.-|||.++--.
T Consensus       199 ~~~~cH~Dl~~~Nil~~~~~~~~~lID~Eya~~~  232 (344)
T PLN02236        199 EIGFCHNDLQYGNIMIDEETRAITIIDYEYASYN  232 (344)
T ss_pred             CceEEeCCCCcCcEEEeCCCCcEEEEeehhcccc
Confidence            4577889999999999966789999999766543


No 195
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=56.20  E-value=25  Score=27.78  Aligned_cols=25  Identities=32%  Similarity=0.147  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-.|+||+++ .+|.+.=+|||..-
T Consensus       130 ~dl~p~nil~~-~~~~~~l~Dfg~~~  154 (265)
T cd06652         130 RDIKGANILRD-SVGNVKLGDFGASK  154 (265)
T ss_pred             CCCCHHHEEec-CCCCEEECcCcccc
Confidence            78899999999 79999999999664


No 196
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=56.20  E-value=23  Score=28.60  Aligned_cols=26  Identities=27%  Similarity=0.245  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=+|+||+++ ++|.+-=+|||....
T Consensus       126 ~dikp~Nili~-~~~~~kl~Dfg~~~~  151 (285)
T cd05632         126 RDLKPENILLD-DYGHIRISDLGLAVK  151 (285)
T ss_pred             cCCCHHHEEEC-CCCCEEEecCCccee
Confidence            78899999999 789999999997754


No 197
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=56.13  E-value=8.4  Score=30.54  Aligned_cols=27  Identities=33%  Similarity=0.319  Sum_probs=23.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      ||-+|+||+++ .+|.+.-+|||.....
T Consensus       130 ~di~p~nili~-~~~~~~l~dfg~~~~~  156 (266)
T cd05033         130 RDLAARNILVN-SNLVCKVSDFGLSRRL  156 (266)
T ss_pred             CCCCcceEEEc-CCCCEEECccchhhcc
Confidence            68899999999 7999999999987654


No 198
>PHA03209 serine/threonine kinase US3; Provisional
Probab=56.03  E-value=21  Score=30.25  Aligned_cols=25  Identities=20%  Similarity=0.186  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ ..|.+.-+|||..-
T Consensus       181 rDlkp~Nill~-~~~~~kl~DfG~a~  205 (357)
T PHA03209        181 RDVKTENIFIN-DVDQVCIGDLGAAQ  205 (357)
T ss_pred             CCCCHHHEEEC-CCCCEEEecCcccc
Confidence            78889999999 78999999999764


No 199
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex 
Probab=56.01  E-value=26  Score=27.92  Aligned_cols=25  Identities=28%  Similarity=0.315  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-+|+||+++ .+|.+.-+|||..-
T Consensus       124 ~~l~p~nill~-~~~~~~l~dfg~~~  148 (284)
T cd07860         124 RDLKPQNLLIN-TEGAIKLADFGLAR  148 (284)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeccchh
Confidence            89999999999 78999999999764


No 200
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=55.92  E-value=21  Score=29.68  Aligned_cols=26  Identities=31%  Similarity=0.247  Sum_probs=23.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+|||++ .+|++.=+|||....
T Consensus       129 ~dlkp~Nili~-~~~~~kl~Dfg~a~~  154 (332)
T cd07857         129 RDLKPGNLLVN-ADCELKICDFGLARG  154 (332)
T ss_pred             CCCCHHHeEEc-CCCCEEeCcCCCcee
Confidence            78899999999 789999999997754


No 201
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,  and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=55.87  E-value=22  Score=27.53  Aligned_cols=48  Identities=17%  Similarity=0.117  Sum_probs=33.0

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcccCHHHH
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHIL   86 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFRLT~~~~   86 (165)
                      -||=+|+||+++ .+|.+.-+|||...-............|.-+.|+..
T Consensus       126 h~~l~~~ni~~~-~~~~~kl~d~g~~~~~~~~~~~~~~~~~~~~~Pe~~  173 (256)
T cd08530         126 HRDLKSANILLV-ANDLVKIGDLGISKVLKKNMAKTQIGTPHYMAPEVW  173 (256)
T ss_pred             cCCCCcceEEEe-cCCcEEEeeccchhhhccCCcccccCCccccCHHHH
Confidence            478899999999 689999999998765443211112234556667765


No 202
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1 
Probab=55.82  E-value=24  Score=27.59  Aligned_cols=26  Identities=31%  Similarity=0.289  Sum_probs=22.7

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      -||-.|+||+++ ++|.+.=+|||..-
T Consensus       125 h~~l~p~ni~~~-~~~~~~l~df~~~~  150 (267)
T cd06610         125 HRDIKAGNILLG-EDGSVKIADFGVSA  150 (267)
T ss_pred             cCCCCHHhEEEc-CCCCEEEcccchHH
Confidence            478999999999 78999999998764


No 203
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=55.66  E-value=6  Score=32.88  Aligned_cols=25  Identities=28%  Similarity=0.410  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+.=+|||..-
T Consensus       120 rDlkp~Nil~~-~~~~~kl~Dfg~~~  144 (316)
T cd05620         120 RDLKLDNVMLD-RDGHIKIADFGMCK  144 (316)
T ss_pred             cCCCHHHeEEC-CCCCEEeCccCCCe
Confidence            78899999999 78999999999754


No 204
>KOG2345|consensus
Probab=55.55  E-value=9.9  Score=32.91  Aligned_cols=26  Identities=27%  Similarity=0.294  Sum_probs=23.3

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|--|+||+++ .+|..+-+|||.+=.
T Consensus       153 ~DiKP~NILls-~~~~~vl~D~GS~~~  178 (302)
T KOG2345|consen  153 RDIKPANILLS-DSGLPVLMDLGSATQ  178 (302)
T ss_pred             cCCCcceeEec-CCCceEEEeccCccc
Confidence            58899999999 799999999998754


No 205
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=55.14  E-value=6.3  Score=33.23  Aligned_cols=25  Identities=28%  Similarity=0.224  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.-+|||..-
T Consensus       192 rDlkp~NIll~-~~~~~kL~DfG~~~  216 (353)
T PLN00034        192 RDIKPSNLLIN-SAKNVKIADFGVSR  216 (353)
T ss_pred             cCCCHHHEEEc-CCCCEEEcccccce
Confidence            78899999999 78999999999764


No 206
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=54.98  E-value=27  Score=28.01  Aligned_cols=26  Identities=31%  Similarity=0.456  Sum_probs=23.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-+|+||+++ .+|++.-+|||....
T Consensus       140 ~dl~p~ni~i~-~~~~~~l~d~~~~~~  165 (286)
T cd06614         140 RDIKSDNILLS-KDGSVKLADFGFAAQ  165 (286)
T ss_pred             CCCChhhEEEc-CCCCEEECccchhhh
Confidence            88999999999 799999999997653


No 207
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=54.97  E-value=9.9  Score=31.57  Aligned_cols=25  Identities=24%  Similarity=0.242  Sum_probs=22.1

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+.-+|||..-
T Consensus       198 rDiKp~Nil~~-~~~~~kl~DfG~a~  222 (338)
T cd05102         198 RDLAARNILLS-ENNVVKICDFGLAR  222 (338)
T ss_pred             CCCccceEEEc-CCCcEEEeeccccc
Confidence            68889999999 78999999999764


No 208
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=54.94  E-value=7.4  Score=31.50  Aligned_cols=28  Identities=32%  Similarity=0.339  Sum_probs=24.2

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      -||-+|+||+|+ .+|.+.-+|||..-..
T Consensus       124 H~dl~p~nili~-~~~~~kl~dfg~~~~~  151 (290)
T cd05580         124 YRDLKPENLLLD-SDGYIKITDFGFAKRV  151 (290)
T ss_pred             cCCCCHHHEEEC-CCCCEEEeeCCCcccc
Confidence            489999999999 7899999999976543


No 209
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=54.89  E-value=11  Score=29.43  Aligned_cols=26  Identities=15%  Similarity=-0.086  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|++.=+|||....
T Consensus       125 ~dl~~~nili~-~~~~~~l~df~~~~~  150 (256)
T cd08529         125 RDIKSLNLFLD-AYDNVKIGDLGVAKL  150 (256)
T ss_pred             CCCCcceEEEe-CCCCEEEccccccee
Confidence            68999999999 789999999997654


No 210
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=54.87  E-value=31  Score=27.37  Aligned_cols=25  Identities=28%  Similarity=0.240  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|++.-+|||..-
T Consensus       124 ~dlkp~nil~~-~~~~~kL~dfg~~~  148 (269)
T cd05087         124 SDLALRNCLLT-ADLTVKIGDYGLSH  148 (269)
T ss_pred             cccCcceEEEc-CCCcEEECCccccc
Confidence            78899999999 78999999999764


No 211
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=54.70  E-value=7.7  Score=32.61  Aligned_cols=27  Identities=22%  Similarity=0.172  Sum_probs=23.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|=.|+||+++ .+|.+.-+|||.+-..
T Consensus       143 rDikp~Nill~-~~~~~kl~Dfg~~~~~  169 (355)
T cd07874         143 RDLKPSNIVVK-SDCTLKILDFGLARTA  169 (355)
T ss_pred             CCCChHHEEEC-CCCCEEEeeCcccccC
Confidence            58889999999 7899999999987543


No 212
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=54.69  E-value=6  Score=33.01  Aligned_cols=25  Identities=36%  Similarity=0.414  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ .+|.+.=+|||.+-
T Consensus       119 ~Dlkp~NIll~-~~~~~kL~Dfg~~~  143 (323)
T cd05595         119 RDIKLENLMLD-KDGHIKITDFGLCK  143 (323)
T ss_pred             cCCCHHHEEEc-CCCCEEecccHHhc
Confidence            68899999999 79999999999764


No 213
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=54.62  E-value=6.5  Score=32.12  Aligned_cols=26  Identities=31%  Similarity=0.379  Sum_probs=23.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|.+.=+|||.+-.
T Consensus       127 ~dlkp~Nill~-~~~~~kl~Dfg~~~~  152 (303)
T cd07869         127 RDLKPQNLLIS-DTGELKLADFGLARA  152 (303)
T ss_pred             CCCCHHHEEEC-CCCCEEECCCCccee
Confidence            68899999999 799999999998753


No 214
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=54.42  E-value=27  Score=28.05  Aligned_cols=26  Identities=31%  Similarity=0.335  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|.+.=+|||..-.
T Consensus       152 ~dlkp~nili~-~~~~~kl~dfg~~~~  177 (291)
T cd06639         152 RDVKGNNILLT-TEGGVKLVDFGVSAQ  177 (291)
T ss_pred             cCCCHHHEEEc-CCCCEEEeecccchh
Confidence            78999999999 789999999997654


No 215
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=54.38  E-value=33  Score=27.13  Aligned_cols=25  Identities=36%  Similarity=0.306  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-+|+||+++ .+|.+.=+|||..-
T Consensus       124 ~dl~p~nili~-~~~~~kl~d~g~~~  148 (256)
T cd05113         124 RDLAARNCLVD-DQGCVKVSDFGLSR  148 (256)
T ss_pred             cccCcceEEEc-CCCCEEECCCccce
Confidence            78899999999 78999999998754


No 216
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=54.36  E-value=7.1  Score=32.58  Aligned_cols=26  Identities=27%  Similarity=0.350  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|++.-+|||..-.
T Consensus       125 rDikp~Nill~-~~~~ikL~Dfg~~~~  150 (323)
T cd05615         125 RDLKLDNVMLD-SEGHIKIADFGMCKE  150 (323)
T ss_pred             cCCCHHHeEEC-CCCCEEEeccccccc
Confidence            68889999999 799999999997643


No 217
>KOG0593|consensus
Probab=54.33  E-value=7.9  Score=34.50  Aligned_cols=63  Identities=16%  Similarity=0.123  Sum_probs=38.1

Q ss_pred             HHHHHHHHHHHHHHHHHHhcc--cCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCccc
Q psy18027         18 LRNNFVRSYACMCIAQYTLGI--GDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRL   81 (165)
Q Consensus        18 ~r~~F~~SlA~~sv~~YiLgi--gDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFRL   81 (165)
                      ..+.++.++.-..-.+.-=++  .|--|+||+|+ .+|.+=-.||||+=--+.+.-...+-|--|.
T Consensus       102 ~vk~~l~Q~l~ai~~cHk~n~IHRDIKPENILit-~~gvvKLCDFGFAR~L~~pgd~YTDYVATRW  166 (396)
T KOG0593|consen  102 LVKKYLYQLLKAIHFCHKNNCIHRDIKPENILIT-QNGVVKLCDFGFARTLSAPGDNYTDYVATRW  166 (396)
T ss_pred             HHHHHHHHHHHHhhhhhhcCeecccCChhheEEe-cCCcEEeccchhhHhhcCCcchhhhhhhhhh
Confidence            344555555443333332222  57789999999 8999999999998654422333344344343


No 218
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=54.26  E-value=7.4  Score=30.87  Aligned_cols=29  Identities=28%  Similarity=0.302  Sum_probs=24.9

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      ||-+|+||+++ .+|.+.=+|||.......
T Consensus       122 ~dl~p~nili~-~~~~~~l~df~~~~~~~~  150 (283)
T cd05118         122 RDLKPENLLIN-TEGVLKLADFGLARSFGS  150 (283)
T ss_pred             cCcCHHHEEEC-CCCcEEEeeeeeeEecCC
Confidence            89999999999 789999999998765443


No 219
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=54.21  E-value=7.7  Score=33.27  Aligned_cols=27  Identities=30%  Similarity=0.379  Sum_probs=23.9

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|=.|+|||++ .+|++.-+|||.+...
T Consensus       166 rDLkp~NILl~-~~~~~kL~DfG~~~~~  192 (370)
T cd05596         166 RDVKPDNMLLD-KSGHLKLADFGTCMKM  192 (370)
T ss_pred             cCCCHHHEEEc-CCCCEEEEeccceeec
Confidence            78899999999 7999999999987543


No 220
>KOG0605|consensus
Probab=54.18  E-value=7.7  Score=36.37  Aligned_cols=26  Identities=35%  Similarity=0.441  Sum_probs=22.7

Q ss_pred             CCCCCceeEecCCCcEEeeeccccccc
Q psy18027         40 DRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        40 DRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      |--|+|+||| .+|||=-.|||.+=|-
T Consensus       266 DIKPdNlLiD-~~GHiKLSDFGLs~gl  291 (550)
T KOG0605|consen  266 DIKPDNLLID-AKGHIKLSDFGLSTGL  291 (550)
T ss_pred             cCChhheeec-CCCCEeeccccccchh
Confidence            5669999999 8999999999998543


No 221
>KOG0610|consensus
Probab=54.09  E-value=10  Score=34.78  Aligned_cols=36  Identities=36%  Similarity=0.453  Sum_probs=28.3

Q ss_pred             HHHHHH--hcc--cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         30 CIAQYT--LGI--GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        30 sv~~Yi--Lgi--gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      ..+-|+  |||  .|--|+||||. ++|||.-.||-..+..
T Consensus       190 ~ALEYLHmlGivYRDLKPENILvr-edGHIMLsDFDLS~~~  229 (459)
T KOG0610|consen  190 LALEYLHMLGIVYRDLKPENILVR-EDGHIMLSDFDLSLRC  229 (459)
T ss_pred             HHHHHHHhhceeeccCCcceeEEe-cCCcEEeeeccccccC
Confidence            344454  555  48889999999 8999999999877765


No 222
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=54.03  E-value=7.3  Score=32.86  Aligned_cols=25  Identities=24%  Similarity=0.199  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+.-+|||..-
T Consensus       147 rDlkp~NIl~~-~~~~~kl~Dfg~a~  171 (359)
T cd07876         147 RDLKPSNIVVK-SDCTLKILDFGLAR  171 (359)
T ss_pred             CCCCHHHEEEC-CCCCEEEecCCCcc
Confidence            68899999999 79999999999764


No 223
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=53.82  E-value=7.6  Score=32.32  Aligned_cols=24  Identities=33%  Similarity=0.386  Sum_probs=22.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +|=.|+|||++ .+|.+.=+|||..
T Consensus       124 ~dlkp~Nil~~-~~~~~kl~Dfg~~  147 (323)
T cd05584         124 RDLKPENILLD-AQGHVKLTDFGLC  147 (323)
T ss_pred             CCCCHHHeEEC-CCCCEEEeeCcCC
Confidence            78899999999 7999999999975


No 224
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=53.82  E-value=8.6  Score=34.39  Aligned_cols=26  Identities=31%  Similarity=0.281  Sum_probs=23.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=+|+|||++ .+|.+.-+|||..-.
T Consensus       193 rDlkp~NIll~-~~~~~kL~DFgla~~  218 (478)
T PTZ00267        193 RDLKSANIFLM-PTGIIKLGDFGFSKQ  218 (478)
T ss_pred             CCcCHHhEEEC-CCCcEEEEeCcCcee
Confidence            68899999999 799999999998753


No 225
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly 
Probab=53.73  E-value=33  Score=27.60  Aligned_cols=25  Identities=32%  Similarity=0.135  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.=+|||..-
T Consensus       144 ~dlkp~Nili~-~~~~~kl~dfg~~~  168 (288)
T cd05093         144 RDLATRNCLVG-ENLLVKIGDFGMSR  168 (288)
T ss_pred             cccCcceEEEc-cCCcEEeccCCccc
Confidence            78899999999 79999999999765


No 226
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=53.64  E-value=6.9  Score=31.89  Aligned_cols=26  Identities=27%  Similarity=0.330  Sum_probs=23.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=+|+||+++ .+|.+.-+|||..-.
T Consensus       128 ~dlkp~Nil~~-~~~~~kl~dfg~~~~  153 (301)
T cd07873         128 RDLKPQNLLIN-ERGELKLADFGLARA  153 (301)
T ss_pred             CCCCHHHEEEC-CCCcEEECcCcchhc
Confidence            78999999999 789999999998754


No 227
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=53.64  E-value=11  Score=29.69  Aligned_cols=26  Identities=23%  Similarity=0.234  Sum_probs=23.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-.|+||+++ .+|.+.-+|||....
T Consensus       124 ~dl~p~nili~-~~~~~~l~dfg~~~~  149 (255)
T cd08219         124 RDIKSKNIFLT-QNGKVKLGDFGSARL  149 (255)
T ss_pred             CCCCcceEEEC-CCCcEEEcccCccee
Confidence            78999999999 799999999998753


No 228
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular 
Probab=53.60  E-value=9.5  Score=29.90  Aligned_cols=26  Identities=31%  Similarity=0.215  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-+|+||+++ .+|++.=+|||..-.
T Consensus       118 ~dl~p~nil~~-~~~~~kl~dfg~~~~  143 (252)
T cd05084         118 RDLAARNCLVT-EKNVLKISDFGMSRE  143 (252)
T ss_pred             cccchheEEEc-CCCcEEECccccCcc
Confidence            78899999999 799999999997643


No 229
>smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily.
Probab=53.59  E-value=9.8  Score=29.55  Aligned_cols=30  Identities=27%  Similarity=0.121  Sum_probs=25.5

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      -+|-.|+||+++ .+|.+.-+|||.......
T Consensus       126 h~dl~~~nil~~-~~~~~~l~dfg~~~~~~~  155 (258)
T smart00219      126 HRDLAARNCLVG-ENLVVKISDFGLSRDLYD  155 (258)
T ss_pred             ecccccceEEEc-cCCeEEEcccCCceeccc
Confidence            379999999999 789999999998865544


No 230
>PHA03211 serine/threonine kinase US3; Provisional
Probab=53.56  E-value=22  Score=32.12  Aligned_cols=24  Identities=33%  Similarity=0.261  Sum_probs=21.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +|-.|+||||+ .+|.+.-+|||..
T Consensus       284 rDLKP~NILl~-~~~~vkL~DFGla  307 (461)
T PHA03211        284 RDIKTENVLVN-GPEDICLGDFGAA  307 (461)
T ss_pred             CcCCHHHEEEC-CCCCEEEcccCCc
Confidence            68899999999 7899999999975


No 231
>PF07804 HipA_C:  HipA-like C-terminal domain;  InterPro: IPR012893 The members of this entry are similar to a region close to the C terminus of the HipA protein expressed by various bacterial species (for example P23874 from SWISSPROT). This protein is known to be involved in high-frequency persistence to the lethal effects of inhibition of either DNA or peptidoglycan synthesis []. When expressed alone, it is toxic to bacterial cells [], but it is usually tightly associated with HipB [], and the HipA-HipB complex may be involved in autoregulation of the hip operon. The hip proteins may be involved in cell division control and may interact with cell division genes or their products []. ; PDB: 3AKL_D 3AKJ_B 3AKK_D 2WIU_C 3HZI_A 3DNT_B 3FBR_A 3DNU_A 3DNV_A.
Probab=53.13  E-value=21  Score=24.20  Aligned_cols=35  Identities=29%  Similarity=0.295  Sum_probs=24.2

Q ss_pred             HHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCc
Q psy18027         20 NNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGR   54 (165)
Q Consensus        20 ~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~   54 (165)
                      ..-.+.+.-+.++.+++|=+|||..|+=+-..++.
T Consensus        37 ~~~~~~l~~~~~fn~ligN~D~H~kN~s~l~~~~~   71 (79)
T PF07804_consen   37 AADVRELFRRLVFNYLIGNTDRHLKNFSFLYDGGG   71 (79)
T ss_dssp             HHHHHHHHHHHHHHHHCTBS---CCCSEEEEECCE
T ss_pred             HHHHHHHHHHHHHHHHHcCCcCCcCCEEEEEcCCe
Confidence            34556677788999999999999999977644443


No 232
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=52.91  E-value=29  Score=27.69  Aligned_cols=26  Identities=27%  Similarity=0.309  Sum_probs=23.3

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|.+.=+|||....
T Consensus       145 ~dl~~~nili~-~~~~~~l~dfg~~~~  170 (282)
T cd06636         145 RDIKGQNVLLT-ENAEVKLVDFGVSAQ  170 (282)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCcchhh
Confidence            79999999999 899999999998654


No 233
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=52.57  E-value=21  Score=29.15  Aligned_cols=26  Identities=27%  Similarity=0.360  Sum_probs=23.3

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-.|+||+++ .+|.+.=+|||....
T Consensus       140 ~dLkp~Nill~-~~~~~kl~dfg~~~~  165 (296)
T cd06654         140 RDIKSDNILLG-MDGSVKLTDFGFCAQ  165 (296)
T ss_pred             CCCCHHHEEEc-CCCCEEECccccchh
Confidence            79999999999 789999999997654


No 234
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=52.36  E-value=43  Score=25.97  Aligned_cols=29  Identities=28%  Similarity=0.269  Sum_probs=24.8

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVA   67 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~   67 (165)
                      -||-+|+||+++ .+|++.-+|||......
T Consensus       122 H~dl~~~ni~~~-~~~~~~l~dfg~~~~~~  150 (256)
T cd06612         122 HRDIKAGNILLN-EEGQAKLADFGVSGQLT  150 (256)
T ss_pred             cCCCCcceEEEC-CCCcEEEcccccchhcc
Confidence            489999999999 79999999999876543


No 235
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=52.22  E-value=8.8  Score=32.12  Aligned_cols=26  Identities=27%  Similarity=0.310  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|++.-+|||.+..
T Consensus       126 rDlkp~Nill~-~~~~~kl~DfG~a~~  151 (331)
T cd05624         126 RDIKPDNVLLD-MNGHIRLADFGSCLK  151 (331)
T ss_pred             ccCchHHEEEc-CCCCEEEEeccceee
Confidence            57889999999 899999999998653


No 236
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=52.21  E-value=8.5  Score=32.53  Aligned_cols=27  Identities=22%  Similarity=0.172  Sum_probs=23.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|=.|+||+++ .+|.+.-+|||..-..
T Consensus       150 ~Dlkp~NIll~-~~~~~kL~DfG~a~~~  176 (364)
T cd07875         150 RDLKPSNIVVK-SDCTLKILDFGLARTA  176 (364)
T ss_pred             CCCCHHHEEEC-CCCcEEEEeCCCcccc
Confidence            78899999999 7999999999987543


No 237
>KOG0662|consensus
Probab=52.06  E-value=31  Score=28.85  Aligned_cols=60  Identities=20%  Similarity=0.292  Sum_probs=35.8

Q ss_pred             ChHHHhccCC--CchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccc
Q psy18027          1 MREGLLSVAK--SPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus         1 L~~~f~~~~~--~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      |++||-+.+.  +++.-..+.-+..+-+ +.|-..-||. .|-.|+|++|+ ++|++--.|||..
T Consensus        87 lkkyfdslng~~d~~~~rsfmlqllrgl-~fchshnvlh-rdlkpqnllin-~ngelkladfgla  148 (292)
T KOG0662|consen   87 LKKYFDSLNGDLDPEIVRSFMLQLLRGL-GFCHSHNVLH-RDLKPQNLLIN-RNGELKLADFGLA  148 (292)
T ss_pred             HHHHHHhcCCcCCHHHHHHHHHHHHhhh-hhhhhhhhhh-ccCCcceEEec-cCCcEEecccchh
Confidence            3566666554  2332222222222222 2333344554 68889999999 8999999999874


No 238
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins. Serine/Threonine Kinases (STKs), RPK118-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RPK118-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily show similarity to human RPK118, which contains an N-terminal Phox homology (PX) domain, a Microtubule Interacting and Trafficking (MIT) domain, and a kinase domain containing a long insert. Also included in the family is human RPK60 (or ribosomal protein S6 kinase-like 1), which also contains MIT and kinase domains but lacks a PX domain. RPK118 binds sphingosine kinase, a key enzyme in the synthesis of sphingosine 1-phospha
Probab=51.98  E-value=28  Score=27.26  Aligned_cols=24  Identities=21%  Similarity=0.092  Sum_probs=21.6

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +|-.|+||+++ .+|.+--+|||..
T Consensus       109 ~dlkp~Nil~~-~~~~~~l~df~~~  132 (237)
T cd05576         109 RDLNPNNILLD-DRGHIQLTYFSRW  132 (237)
T ss_pred             cCCCHHHEEEc-CCCCEEEecccch
Confidence            78899999999 7899999999954


No 239
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=51.78  E-value=15  Score=30.61  Aligned_cols=27  Identities=22%  Similarity=0.174  Sum_probs=23.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|=.|+||+++ .+|.+--+|||.....
T Consensus       142 rdikp~Nil~~-~~~~~kl~Dfg~~~~~  168 (343)
T cd07878         142 RDLKPSNVAVN-EDCELRILDFGLARQA  168 (343)
T ss_pred             ccCChhhEEEC-CCCCEEEcCCccceec
Confidence            68899999999 7899999999987643


No 240
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=51.68  E-value=46  Score=26.03  Aligned_cols=28  Identities=29%  Similarity=0.260  Sum_probs=23.6

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      -+|-.|+||+++ .+|.+--+|||.....
T Consensus       127 h~dl~~~nilv~-~~~~~kl~d~g~~~~~  154 (261)
T cd05148         127 HRDLAARNILVG-EDLVCKVADFGLARLI  154 (261)
T ss_pred             ccccCcceEEEc-CCceEEEccccchhhc
Confidence            378999999999 7899998999977543


No 241
>KOG0984|consensus
Probab=51.68  E-value=11  Score=32.01  Aligned_cols=46  Identities=26%  Similarity=0.400  Sum_probs=30.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc---cccccCCC--C-CCCCCCcccCHHH
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS---FGVATQLL--P-IPELMPFRLTPHI   85 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~---f~~~~~~l--~-~~E~vPFRLT~~~   85 (165)
                      .|--|+||||+ ..|++=-.|||..   -++-.+..  + -|=.+|=|+.|+.
T Consensus       173 RDvKPsNiLIn-~~GqVKiCDFGIsG~L~dSiAkt~daGCkpYmaPEri~~e~  224 (282)
T KOG0984|consen  173 RDVKPSNILIN-YDGQVKICDFGISGYLVDSIAKTMDAGCKPYMAPERINPEL  224 (282)
T ss_pred             ccCCcceEEEc-cCCcEEEcccccceeehhhhHHHHhcCCCccCChhhcCccc
Confidence            46789999999 7999999999853   12111111  1 1445666777665


No 242
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=51.58  E-value=9  Score=32.62  Aligned_cols=24  Identities=33%  Similarity=0.414  Sum_probs=21.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +|-.|+|||++ .+|.+.-+|||..
T Consensus       125 rDlkp~NIll~-~~~~~kl~DfGla  148 (377)
T cd05629         125 RDIKPDNILID-RGGHIKLSDFGLS  148 (377)
T ss_pred             cCCCHHHEEEC-CCCCEEEeecccc
Confidence            68889999999 7999999999976


No 243
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=51.57  E-value=8.2  Score=32.50  Aligned_cols=25  Identities=28%  Similarity=0.288  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ .+|.+.-+|||.+-
T Consensus       125 ~Dlkp~NIl~~-~~~~~kl~Dfg~~~  149 (364)
T cd05599         125 RDIKPDNLLLD-AKGHIKLSDFGLCT  149 (364)
T ss_pred             ccCCHHHeEEC-CCCCEEEeecccce
Confidence            68889999999 79999999999764


No 244
>KOG0592|consensus
Probab=51.22  E-value=10  Score=35.88  Aligned_cols=34  Identities=32%  Similarity=0.377  Sum_probs=27.3

Q ss_pred             HHHHHHHhccc----CCCCCceeEecCCCcEEeeecccc
Q psy18027         29 MCIAQYTLGIG----DRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        29 ~sv~~YiLgig----DRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      .+.+-|+=+.|    |--|+|||+| ++||+--.|||-+
T Consensus       184 ldAleylH~~GIIHRDlKPENILLd-~dmhikITDFGsA  221 (604)
T KOG0592|consen  184 LDALEYLHSNGIIHRDLKPENILLD-KDGHIKITDFGSA  221 (604)
T ss_pred             HHHHHHHHhcCceeccCChhheeEc-CCCcEEEeecccc
Confidence            44566766655    6679999999 8999999999964


No 245
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=51.11  E-value=11  Score=29.54  Aligned_cols=26  Identities=27%  Similarity=0.152  Sum_probs=23.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|.+.-+|||..-.
T Consensus       124 ~dl~p~ni~i~-~~~~~~l~d~g~~~~  149 (256)
T cd05112         124 RDLAARNCLVG-ENQVVKVSDFGMTRF  149 (256)
T ss_pred             cccccceEEEc-CCCeEEECCCcceee
Confidence            79999999999 899999999997653


No 246
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=51.11  E-value=21  Score=28.59  Aligned_cols=25  Identities=28%  Similarity=0.368  Sum_probs=22.4

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      -+|-+|+||+++ .+|.+.-+|||..
T Consensus       124 h~dl~p~Ni~i~-~~~~~~l~dfg~~  148 (277)
T cd06641         124 HRDIKAANVLLS-EHGEVKLADFGVA  148 (277)
T ss_pred             cCCCCHHhEEEC-CCCCEEEeecccc
Confidence            479999999999 7899999999965


No 247
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both
Probab=51.08  E-value=11  Score=29.86  Aligned_cols=28  Identities=29%  Similarity=0.254  Sum_probs=24.0

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      -+|-.|+||+++ .+|++.=+|||.....
T Consensus       130 h~~l~~~nili~-~~~~~~l~dfg~~~~~  157 (287)
T cd07838         130 HRDLKPQNILVT-SDGQVKIADFGLARIY  157 (287)
T ss_pred             eccCChhhEEEc-cCCCEEEeccCcceec
Confidence            389999999999 6799999999977543


No 248
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=51.01  E-value=24  Score=29.45  Aligned_cols=25  Identities=36%  Similarity=0.292  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+|||++ .+|++.=+|||..-
T Consensus       128 ~dlkp~Nil~~-~~~~~kl~Dfg~~~  152 (331)
T cd06649         128 RDVKPSNILVN-SRGEIKLCDFGVSG  152 (331)
T ss_pred             CCCChhhEEEc-CCCcEEEccCcccc
Confidence            78999999999 78999999999764


No 249
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=51.00  E-value=9.5  Score=30.33  Aligned_cols=27  Identities=33%  Similarity=0.241  Sum_probs=23.4

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -+|-+|+||+++ .+|++.-+|||..-.
T Consensus       129 h~dlkp~nili~-~~~~~~l~dfg~~~~  155 (267)
T cd05066         129 HRDLAARNILVN-SNLVCKVSDFGLSRV  155 (267)
T ss_pred             ehhhchhcEEEC-CCCeEEeCCCCcccc
Confidence            389999999999 789999999997754


No 250
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=50.78  E-value=9.9  Score=32.64  Aligned_cols=26  Identities=31%  Similarity=0.373  Sum_probs=23.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|++.=+|||.+..
T Consensus       166 rDLkp~NIll~-~~~~ikL~DfG~a~~  191 (371)
T cd05622         166 RDVKPDNMLLD-KSGHLKLADFGTCMK  191 (371)
T ss_pred             CCCCHHHEEEC-CCCCEEEEeCCceeE
Confidence            68899999999 799999999998754


No 251
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=50.52  E-value=26  Score=28.36  Aligned_cols=25  Identities=28%  Similarity=0.438  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-+|+||+++ .+|.+.-+|||..-
T Consensus       139 ~dl~p~Nil~~-~~~~~~l~d~g~~~  163 (285)
T cd06648         139 RDIKSDSILLT-SDGRVKLSDFGFCA  163 (285)
T ss_pred             CCCChhhEEEc-CCCcEEEcccccch
Confidence            89999999999 78999999998653


No 252
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=50.50  E-value=39  Score=27.70  Aligned_cols=26  Identities=31%  Similarity=0.323  Sum_probs=23.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|++.=+|||..-.
T Consensus       158 ~dlkp~Nill~-~~~~~kL~Dfg~~~~  183 (314)
T cd05099         158 RDLAARNVLVT-EDNVMKIADFGLARG  183 (314)
T ss_pred             ccccceeEEEc-CCCcEEEcccccccc
Confidence            78899999998 789999999998754


No 253
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=50.45  E-value=32  Score=27.85  Aligned_cols=25  Identities=32%  Similarity=0.287  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-+|+||+++ .+|.+.=+|||..-
T Consensus       139 ~dl~p~nill~-~~~~~kL~dfg~~~  163 (296)
T cd06618         139 RDVKPSNILLD-ASGNVKLCDFGISG  163 (296)
T ss_pred             CCCcHHHEEEc-CCCCEEECccccch
Confidence            89999999999 89999999999764


No 254
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=50.17  E-value=29  Score=28.31  Aligned_cols=27  Identities=26%  Similarity=0.278  Sum_probs=23.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|=.|+||+++ .+|.+.-+|||.....
T Consensus       132 ~dl~p~nil~~-~~~~~kL~dfg~~~~~  158 (309)
T cd07845         132 RDLKVSNLLLT-DKGCLKIADFGLARTY  158 (309)
T ss_pred             CCCCHHHEEEC-CCCCEEECccceeeec
Confidence            68889999999 7999999999987644


No 255
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=50.10  E-value=22  Score=29.01  Aligned_cols=25  Identities=28%  Similarity=0.424  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-.|+||+++ ++|.+.-+|||..-
T Consensus       142 ~dlkp~Nill~-~~~~~kL~dfg~~~  166 (292)
T cd06658         142 RDIKSDSILLT-SDGRIKLSDFGFCA  166 (292)
T ss_pred             cCCCHHHEEEc-CCCCEEEccCcchh
Confidence            89999999999 78999999999764


No 256
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They 
Probab=49.58  E-value=10  Score=29.24  Aligned_cols=30  Identities=23%  Similarity=0.197  Sum_probs=24.7

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      -||-+|+||+++ .+|.+.-+|||.......
T Consensus       126 H~dl~~~nil~~-~~~~~~l~d~~~~~~~~~  155 (258)
T cd08215         126 HRDIKPQNIFLT-SNGLVKLGDFGISKVLSS  155 (258)
T ss_pred             cccCChHHeEEc-CCCcEEECCccceeeccc
Confidence            368899999999 789999999998765433


No 257
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=49.56  E-value=44  Score=26.50  Aligned_cols=29  Identities=28%  Similarity=0.147  Sum_probs=24.5

Q ss_pred             hcccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         36 LGIGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        36 LgigDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +-=||-+|+||+++ .+|.+.-+|||..-.
T Consensus       120 i~H~dl~~~ni~i~-~~~~~~l~d~~~~~~  148 (283)
T cd07830         120 FFHRDLKPENLLVS-GPEVVKIADFGLARE  148 (283)
T ss_pred             cccCCCChhhEEEc-CCCCEEEeeccccee
Confidence            34589999999999 799999999997653


No 258
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO3 is present only in multicellular eukaryotes. Its function is still unknown.
Probab=49.50  E-value=11  Score=30.59  Aligned_cols=26  Identities=27%  Similarity=0.121  Sum_probs=22.1

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      ||=.+.|||++  .|+++-||||-.-..
T Consensus       149 GDLs~~NIL~~--~~~v~iIDF~qav~~  174 (197)
T cd05146         149 ADLSEYNMLWH--DGKVWFIDVSQSVEP  174 (197)
T ss_pred             CCCCHHHEEEE--CCcEEEEECCCceeC
Confidence            99999999997  589999999855443


No 259
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in 
Probab=49.49  E-value=9.1  Score=31.87  Aligned_cols=25  Identities=32%  Similarity=0.384  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.-+|||..-
T Consensus       120 rdikp~Nil~~-~~~~~kl~Dfg~~~  144 (316)
T cd05619         120 RDLKLDNILLD-TDGHIKIADFGMCK  144 (316)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCCcce
Confidence            78899999999 78999999999764


No 260
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=49.45  E-value=36  Score=28.23  Aligned_cols=26  Identities=27%  Similarity=0.254  Sum_probs=23.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+--+|||....
T Consensus       131 ~dl~p~nill~-~~~~~kl~d~g~~~~  156 (337)
T cd07852         131 RDLKPSNILLN-SDCRVKLADFGLARS  156 (337)
T ss_pred             CCCCHHHEEEc-CCCcEEEeeccchhc
Confidence            79999999999 899999999997653


No 261
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=49.01  E-value=23  Score=29.71  Aligned_cols=25  Identities=36%  Similarity=0.292  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.=+|||...
T Consensus       128 ~dlkp~Nili~-~~~~~kL~Dfg~~~  152 (333)
T cd06650         128 RDVKPSNILVN-SRGEIKLCDFGVSG  152 (333)
T ss_pred             cCCChhhEEEc-CCCCEEEeeCCcch
Confidence            79999999999 78999999999764


No 262
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=48.94  E-value=12  Score=30.19  Aligned_cols=26  Identities=27%  Similarity=0.188  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|.+.=+|||..-.
T Consensus       133 ~dlkp~Nil~~-~~~~~~l~dfg~~~~  158 (284)
T cd05079         133 RDLAARNVLVE-SEHQVKIGDFGLTKA  158 (284)
T ss_pred             cccchheEEEc-CCCCEEECCCccccc
Confidence            58899999999 789999999997653


No 263
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=48.79  E-value=19  Score=27.65  Aligned_cols=32  Identities=25%  Similarity=0.178  Sum_probs=26.2

Q ss_pred             hcccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         36 LGIGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        36 LgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      +--||-+|+||+++ .+|.+.=+|||.......
T Consensus       122 ~~h~dl~p~ni~i~-~~~~~~l~d~~~~~~~~~  153 (260)
T cd06606         122 IVHRDIKGANILVD-SDGVVKLADFGCAKRLGD  153 (260)
T ss_pred             ccccCCCHHHEEEc-CCCCEEEcccccEEeccc
Confidence            33479999999999 689999999998775544


No 264
>PF01386 Ribosomal_L25p:  Ribosomal L25p family;  InterPro: IPR020055 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  This entry models the short-form of the ribosomal L25 protein. The long-form has homology to the general stress protein Ctc of Bacillus subtilis, a mesophile, and ribosomal protein TL5 of Thermus thermophilus, a thermophile. Ribosomal protein L25 of Escherichia coli and Haemophilus influenzae appear to be orthologous but consist only of the N-terminal half of Ctc and TL5. Both short (L25-like) and full-length (CTC-like) members of this family bind the E-loop of bacterial 5S rRNA.; GO: 0003735 structural constituent of ribosome, 0008097 5S rRNA binding, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2HGQ_Y 2HGJ_Y 2Y19_Z 2WRL_Z 3KIT_Z 2WH2_Z 2WDN_Z 3V25_Z 3HUZ_Z 3KIY_Z ....
Probab=48.78  E-value=16  Score=25.68  Aligned_cols=15  Identities=20%  Similarity=0.246  Sum_probs=12.3

Q ss_pred             eeEecCCCcEEeeec
Q psy18027         46 TLVCTKTGRCVGIDF   60 (165)
Q Consensus        46 ili~~~tG~v~hIDF   60 (165)
                      +..+.-++++.||||
T Consensus        74 vQ~~p~~~~i~HvDF   88 (88)
T PF01386_consen   74 VQRDPVTDKILHVDF   88 (88)
T ss_dssp             EEEESSSSSEEEEEE
T ss_pred             eeeCCCCCCeEeccC
Confidence            344778999999998


No 265
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the 
Probab=48.71  E-value=16  Score=28.35  Aligned_cols=30  Identities=27%  Similarity=0.256  Sum_probs=25.0

Q ss_pred             hcccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         36 LGIGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        36 LgigDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +--||-+|+||+++ .+|.+.-+|||..-..
T Consensus       114 ~~H~~l~p~ni~~~-~~~~~~l~d~~~~~~~  143 (250)
T cd05123         114 IIYRDLKPENILLD-ADGHIKLTDFGLAKEL  143 (250)
T ss_pred             ceecCCCcceEEEc-CCCcEEEeecCcceec
Confidence            34589999999999 7899999999976543


No 266
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=48.63  E-value=50  Score=27.16  Aligned_cols=26  Identities=27%  Similarity=0.272  Sum_probs=22.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-+|+||+++ .+|++.-+|||....
T Consensus       149 ~dL~p~Nil~~-~~~~~kl~dfg~~~~  174 (317)
T cd06635         149 RDIKAGNILLT-EPGQVKLADFGSASI  174 (317)
T ss_pred             CCCCcccEEEC-CCCCEEEecCCCccc
Confidence            78899999998 789999999997653


No 267
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan
Probab=48.49  E-value=48  Score=25.51  Aligned_cols=30  Identities=30%  Similarity=0.133  Sum_probs=25.1

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      -+|=.|+||+++ .+|.+.-+|||.......
T Consensus       128 H~di~p~nili~-~~~~~~l~dfg~~~~~~~  157 (262)
T cd00192         128 HRDLAARNCLVG-EDLVVKISDFGLSRDVYD  157 (262)
T ss_pred             cCccCcceEEEC-CCCcEEEccccccccccc
Confidence            378999999999 789999999998865443


No 268
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a
Probab=48.42  E-value=12  Score=29.39  Aligned_cols=25  Identities=24%  Similarity=0.197  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-+|+||+++ .+|.+.=+|||...
T Consensus       130 ~dl~p~nil~~-~~~~~~l~d~~~~~  154 (267)
T cd08224         130 RDIKPANVFIT-ATGVVKLGDLGLGR  154 (267)
T ss_pred             CCcChhhEEEC-CCCcEEEeccceee
Confidence            89999999999 78999999999764


No 269
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=48.41  E-value=39  Score=28.39  Aligned_cols=28  Identities=21%  Similarity=0.146  Sum_probs=23.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVA   67 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~   67 (165)
                      +|-+|+||+++ .+|.+.-+|||......
T Consensus       144 ~dlkp~NIll~-~~~~~kl~dfg~~~~~~  171 (345)
T cd07877         144 RDLKPSNLAVN-EDCELKILDFGLARHTD  171 (345)
T ss_pred             cCCChHHEEEc-CCCCEEEeccccccccc
Confidence            68889999999 78999999999876543


No 270
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=48.34  E-value=29  Score=28.86  Aligned_cols=27  Identities=22%  Similarity=0.099  Sum_probs=23.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|-+|+||+++ .+|++-=+|||.....
T Consensus       130 ~dlkp~Nill~-~~~~~kl~dfg~~~~~  156 (336)
T cd07849         130 RDLKPSNLLLN-TNCDLKICDFGLARIA  156 (336)
T ss_pred             cCCCHHHEEEC-CCCCEEECcccceeec
Confidence            78999999999 7999999999977543


No 271
>KOG0983|consensus
Probab=48.32  E-value=13  Score=32.81  Aligned_cols=58  Identities=24%  Similarity=0.243  Sum_probs=37.0

Q ss_pred             HHHHHHHHHHHh---cc--cCCCCCceeEecCCCcEEeeeccccc---cc---ccCCCCC-CCCCCcccCHH
Q psy18027         25 SYACMCIAQYTL---GI--GDRHLENTLVCTKTGRCVGIDFGYSF---GV---ATQLLPI-PELMPFRLTPH   84 (165)
Q Consensus        25 SlA~~sv~~YiL---gi--gDRH~~Nili~~~tG~v~hIDFg~~f---~~---~~~~l~~-~E~vPFRLT~~   84 (165)
                      +.|+.+.+.|+=   ||  .|--|+|||+| .+|++=-.|||..=   +.   .+ .-+. +=-+|=|++|+
T Consensus       197 tva~v~AL~YLKeKH~viHRDvKPSNILlD-e~GniKlCDFGIsGrlvdSkAhtr-sAGC~~YMaPERidp~  266 (391)
T KOG0983|consen  197 TVAIVKALYYLKEKHGVIHRDVKPSNILLD-ERGNIKLCDFGISGRLVDSKAHTR-SAGCAAYMAPERIDPP  266 (391)
T ss_pred             HHHHHHHHHHHHHhcceeecccCccceEEc-cCCCEEeecccccceeeccccccc-ccCCccccCccccCCC
Confidence            456666666652   22  46679999999 99999999998531   11   11 1121 33456677776


No 272
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=48.32  E-value=39  Score=31.24  Aligned_cols=26  Identities=38%  Similarity=0.440  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+|||++ .+|.+.-+|||....
T Consensus       333 rDLKp~NILl~-~~~~~kL~DFGla~~  358 (507)
T PLN03224        333 RDIKPENLLVT-VDGQVKIIDFGAAVD  358 (507)
T ss_pred             CCCchHhEEEC-CCCcEEEEeCcCccc
Confidence            78899999999 789999999998743


No 273
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=48.28  E-value=42  Score=26.40  Aligned_cols=27  Identities=30%  Similarity=0.267  Sum_probs=23.1

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      =+|=+|+||+++ ..|.+.-+|||....
T Consensus       125 H~dl~p~ni~i~-~~~~~~l~d~~~~~~  151 (260)
T cd05073         125 HRDLRAANILVS-ASLVCKIADFGLARV  151 (260)
T ss_pred             ccccCcceEEEc-CCCcEEECCCcceee
Confidence            368889999999 789999999998754


No 274
>KOG0658|consensus
Probab=48.26  E-value=13  Score=33.20  Aligned_cols=25  Identities=36%  Similarity=0.327  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      .|=-|+|+|+|..||.+=-.|||.+
T Consensus       149 RDIKPqNlLvD~~tg~LKicDFGSA  173 (364)
T KOG0658|consen  149 RDIKPQNLLVDPDTGVLKICDFGSA  173 (364)
T ss_pred             CCCChheEEEcCCCCeEEeccCCcc
Confidence            4778999999999999999999864


No 275
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional
Probab=48.10  E-value=15  Score=30.99  Aligned_cols=46  Identities=20%  Similarity=0.184  Sum_probs=33.8

Q ss_pred             HHHHHHHHHHHHHHHHHHhcc--cCCCCCceeEec------CCCcEEeeecccc
Q psy18027         18 LRNNFVRSYACMCIAQYTLGI--GDRHLENTLVCT------KTGRCVGIDFGYS   63 (165)
Q Consensus        18 ~r~~F~~SlA~~sv~~YiLgi--gDRH~~Nili~~------~tG~v~hIDFg~~   63 (165)
                      .+....+.+|....-=+--|+  ||=++.|||++.      ..++++-|||+-+
T Consensus       139 ~~~~ll~~la~~i~~LH~~Gi~HgDL~~~NiLl~~~~~~~~~~~~~~LIDl~r~  192 (268)
T PRK15123        139 LKRMLIKRVATMVRDMHAAGINHRDCYICHFLLHLPFPGREEDLKLSVIDLHRA  192 (268)
T ss_pred             HHHHHHHHHHHHHHHHHHCcCccCCCChhhEEEeccccCCCCCceEEEEECCcc
Confidence            445666666666655555555  899999999984      2578999999765


No 276
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=47.94  E-value=10  Score=29.63  Aligned_cols=28  Identities=29%  Similarity=0.247  Sum_probs=23.6

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      -||-+|+||+++ .+|.+.=+|||..-..
T Consensus       123 H~~l~~~ni~~~-~~~~~~l~df~~~~~~  150 (264)
T cd06623         123 HRDIKPSNLLIN-SKGEVKIADFGISKVL  150 (264)
T ss_pred             cCCCCHHHEEEC-CCCCEEEccCccceec
Confidence            368899999999 7999999999976543


No 277
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis.  Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=47.76  E-value=11  Score=29.63  Aligned_cols=26  Identities=23%  Similarity=0.123  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|.+.-+|||....
T Consensus       130 ~dl~~~nil~~-~~~~~~l~d~g~~~~  155 (267)
T cd08228         130 RDIKPANVFIT-ATGVVKLGDLGLGRF  155 (267)
T ss_pred             CCCCHHHEEEc-CCCCEEECcccccee
Confidence            68899999999 789999999997653


No 278
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=47.75  E-value=47  Score=27.57  Aligned_cols=25  Identities=28%  Similarity=0.248  Sum_probs=21.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.=+|||..-
T Consensus       158 ~dlkp~Nill~-~~~~~kL~Dfg~~~  182 (334)
T cd05100         158 RDLAARNVLVT-EDNVMKIADFGLAR  182 (334)
T ss_pred             cccccceEEEc-CCCcEEECCcccce
Confidence            57779999999 78999999999764


No 279
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored 
Probab=47.64  E-value=12  Score=29.51  Aligned_cols=28  Identities=32%  Similarity=0.222  Sum_probs=23.8

Q ss_pred             cccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         37 GIGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        37 gigDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      --+|-+|+||+++ .++.+.=+|||....
T Consensus       129 ~H~dlkp~Nili~-~~~~~kl~dfg~~~~  156 (268)
T cd05063         129 VHRDLAARNILVN-SNLECKVSDFGLSRV  156 (268)
T ss_pred             eccccchhhEEEc-CCCcEEECCCcccee
Confidence            3479999999999 799999999997653


No 280
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=47.58  E-value=12  Score=30.25  Aligned_cols=26  Identities=31%  Similarity=0.151  Sum_probs=22.7

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      -+|-+|+||+++ .+|.+-=+|||..-
T Consensus       152 H~dlkp~Nill~-~~~~~kl~dfg~~~  177 (295)
T cd05097         152 HRDLATRNCLVG-NHYTIKIADFGMSR  177 (295)
T ss_pred             ccccChhhEEEc-CCCcEEeccccccc
Confidence            479999999999 78999999999764


No 281
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=47.53  E-value=11  Score=29.62  Aligned_cols=26  Identities=35%  Similarity=0.282  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|.+.=+|||....
T Consensus       125 ~dl~~~ni~~~-~~~~~~l~d~g~~~~  150 (265)
T cd06605         125 RDVKPSNILVN-SRGQIKLCDFGVSGQ  150 (265)
T ss_pred             CCCCHHHEEEC-CCCCEEEeecccchh
Confidence            78899999999 699999999997653


No 282
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=47.40  E-value=11  Score=29.98  Aligned_cols=28  Identities=25%  Similarity=0.218  Sum_probs=24.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVA   67 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~   67 (165)
                      +|-+|+||+++ .+|.+.-+|||......
T Consensus       123 ~dl~p~ni~~~-~~~~~~l~dfg~~~~~~  150 (286)
T cd07832         123 RDLKPANLLIS-ADGVLKIADFGLARLFS  150 (286)
T ss_pred             CCcCHHHEEEc-CCCcEEEeeeeeccccc
Confidence            68899999999 68999999999776543


No 283
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=47.26  E-value=14  Score=29.67  Aligned_cols=25  Identities=20%  Similarity=0.118  Sum_probs=22.1

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.-+|||..-
T Consensus       133 ~dlkp~nili~-~~~~~kl~Dfg~~~  157 (279)
T cd05111         133 RNLAARNILLK-SDSIVQIADFGVAD  157 (279)
T ss_pred             cccCcceEEEc-CCCcEEEcCCccce
Confidence            68889999999 78999999999773


No 284
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=47.02  E-value=13  Score=29.64  Aligned_cols=25  Identities=24%  Similarity=0.154  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+.-+|||...
T Consensus       143 ~dlkp~Nil~~-~~~~~~l~dfg~~~  167 (277)
T cd05062         143 RDLAARNCMVA-EDFTVKIGDFGMTR  167 (277)
T ss_pred             CCcchheEEEc-CCCCEEECCCCCcc
Confidence            68889999999 79999999999764


No 285
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=46.97  E-value=12  Score=29.12  Aligned_cols=27  Identities=30%  Similarity=0.246  Sum_probs=23.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      ||-+|+||+++ .+|.+.-+|||.....
T Consensus       117 ~di~~~nil~~-~~~~~~l~dfg~~~~~  143 (265)
T cd05579         117 RDLKPDNILID-SNGHLKLTDFGLSKVG  143 (265)
T ss_pred             CCCCHHHeEEc-CCCCEEEEecccchhc
Confidence            78999999999 7899999999976643


No 286
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms]
Probab=46.95  E-value=17  Score=31.77  Aligned_cols=43  Identities=30%  Similarity=0.288  Sum_probs=31.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccccccCCCCC-CCCCCcccCHHHHHhh
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPI-PELMPFRLTPHILAVN   89 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~-~E~vPFRLT~~~~~~m   89 (165)
                      ||-.+-||+++ ++|.++-|||       |+..+. .+.+++.|-+++.+++
T Consensus       226 GDlSefNIlV~-~dg~~~vIDw-------PQ~v~~~hp~a~e~l~RDv~nii  269 (304)
T COG0478         226 GDLSEFNILVT-EDGDIVVIDW-------PQAVPISHPDAEELLERDVENII  269 (304)
T ss_pred             cCCchheEEEe-cCCCEEEEeC-------cccccCCCCCHHHHHHhHHHHHH
Confidence            79999999999 8999999999       222332 3445666666666554


No 287
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=46.90  E-value=12  Score=30.12  Aligned_cols=26  Identities=35%  Similarity=0.335  Sum_probs=23.4

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|.+.=+|||..-.
T Consensus       119 ~dlkp~Nill~-~~~~~~l~dfg~~~~  144 (279)
T cd06619         119 RDVKPSNMLVN-TRGQVKLCDFGVSTQ  144 (279)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCCccee
Confidence            69999999999 799999999997754


No 288
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=46.86  E-value=49  Score=26.73  Aligned_cols=25  Identities=36%  Similarity=0.228  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+.=+|||..-
T Consensus       154 ~dlkp~Nili~-~~~~~~l~dfg~~~  178 (296)
T cd05095         154 RDLATRNCLVG-KNYTIKIADFGMSR  178 (296)
T ss_pred             ccCChheEEEc-CCCCEEeccCcccc
Confidence            78899999999 78999999999754


No 289
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=46.47  E-value=16  Score=29.25  Aligned_cols=25  Identities=32%  Similarity=0.271  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-.|+||+++ .+|++.-+|||...
T Consensus       127 ~dlkp~nili~-~~~~~kl~dfg~~~  151 (282)
T cd06643         127 RDLKAGNILFT-LDGDIKLADFGVSA  151 (282)
T ss_pred             cCCCcccEEEc-cCCCEEEccccccc
Confidence            78899999999 79999999999764


No 290
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=46.37  E-value=15  Score=29.50  Aligned_cols=26  Identities=27%  Similarity=0.211  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-+|+||+++..+|.+-=+|||..-
T Consensus       134 ~dl~~~nil~~~~~~~~kl~dfg~~~  159 (295)
T cd07837         134 RDLKPQNLLVDKQKGLLKIADLGLGR  159 (295)
T ss_pred             cCCChHHEEEecCCCeEEEeecccce
Confidence            78899999999558999999999654


No 291
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=46.36  E-value=21  Score=28.54  Aligned_cols=26  Identities=35%  Similarity=0.312  Sum_probs=23.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+.=+|||....
T Consensus       127 ~dl~p~nil~~-~~~~~~l~dfg~~~~  152 (286)
T cd06622         127 RDVKPTNVLVN-GNGQVKLCDFGVSGN  152 (286)
T ss_pred             CCCCHHHEEEC-CCCCEEEeecCCccc
Confidence            88899999999 699999999997653


No 292
>COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism]
Probab=46.35  E-value=17  Score=30.64  Aligned_cols=34  Identities=21%  Similarity=0.111  Sum_probs=28.1

Q ss_pred             HHhcccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         34 YTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        34 YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      .++.=+|=+++|++.+ ..|+++-|||-.+--..+
T Consensus       153 ~v~cH~Dl~~~N~l~t-~~~~l~LIDWEyAg~~D~  186 (269)
T COG0510         153 LVPCHNDLNPGNLLLT-DKGGLFLIDWEYAGLNDP  186 (269)
T ss_pred             eeeecCCCCccceEEc-CCCcEEEEecccCCCccH
Confidence            5667799999999998 679999999977665554


No 293
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=46.34  E-value=23  Score=28.59  Aligned_cols=27  Identities=22%  Similarity=0.229  Sum_probs=23.4

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      =+|=.|+||+++ .+|.+.=+|||....
T Consensus       120 H~dikp~Nil~~-~~~~~~l~dfg~~~~  146 (279)
T cd05633         120 YRDLKPANILLD-EHGHVRISDLGLACD  146 (279)
T ss_pred             CCCCCHHHEEEC-CCCCEEEccCCccee
Confidence            378889999999 789999999998753


No 294
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=46.30  E-value=61  Score=25.34  Aligned_cols=30  Identities=23%  Similarity=0.230  Sum_probs=25.5

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      -+|-.|+||+++ +.|++.-+|||.......
T Consensus       123 h~dl~~~nil~~-~~~~~~l~d~~~~~~~~~  152 (258)
T cd05578         123 HRDIKPDNILLD-EQGHVHITDFNIATKVTP  152 (258)
T ss_pred             ccCCCHHHeEEc-CCCCEEEeecccccccCC
Confidence            378999999999 789999999998876544


No 295
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=46.21  E-value=46  Score=26.46  Aligned_cols=25  Identities=32%  Similarity=0.308  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=+|+||+++ .+|.+.-+|||...
T Consensus       127 ~dl~p~nili~-~~~~~~l~d~g~~~  151 (280)
T cd06611         127 RDLKAGNILLT-LDGDVKLADFGVSA  151 (280)
T ss_pred             CCCChhhEEEC-CCCCEEEccCccch
Confidence            89999999999 79999999999654


No 296
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=46.06  E-value=16  Score=28.89  Aligned_cols=25  Identities=32%  Similarity=0.296  Sum_probs=21.2

Q ss_pred             cCCCCCceeEecCCC-----cEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTG-----RCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG-----~v~hIDFg~~f   64 (165)
                      +|-+|+||+++ .++     .+.-+|||..-
T Consensus       130 ~dl~p~nil~~-~~~~~~~~~~~l~dfg~~~  159 (269)
T cd05044         130 RDLAARNCLVS-EKGYDADRVVKIGDFGLAR  159 (269)
T ss_pred             CCCChheEEEe-cCCCCCCcceEECCccccc
Confidence            78899999999 556     78899999764


No 297
>KOG0198|consensus
Probab=45.80  E-value=25  Score=30.59  Aligned_cols=47  Identities=19%  Similarity=0.171  Sum_probs=30.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcccCHHH
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLTPHI   85 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFRLT~~~   85 (165)
                      +|--|+|||++..+|.+--.|||................+++-||+.
T Consensus       141 ~DiK~~NiLl~~~~~~~KlaDFG~a~~~~~~~~~~~~~~~~~Gtp~~  187 (313)
T KOG0198|consen  141 CDIKPANILLDPSNGDVKLADFGLAKKLESKGTKSDSELSVQGTPNY  187 (313)
T ss_pred             cCcccceEEEeCCCCeEEeccCccccccccccccccccccccCCccc
Confidence            56778999999447999999999887555311112334456655443


No 298
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain. subfamily of choline kinases
Probab=45.65  E-value=18  Score=28.49  Aligned_cols=33  Identities=27%  Similarity=0.250  Sum_probs=24.1

Q ss_pred             HhcccCCCCCceeEecC-CC---cEEeeecccccccc
Q psy18027         35 TLGIGDRHLENTLVCTK-TG---RCVGIDFGYSFGVA   67 (165)
Q Consensus        35 iLgigDRH~~Nili~~~-tG---~v~hIDFg~~f~~~   67 (165)
                      ++.=||=|++|+|++.. +|   .+.-|||..+--..
T Consensus       121 vl~HgD~~~~N~~~~~~~~~~~~~~~liDfq~~~~g~  157 (196)
T smart00587      121 VLNHGDLWANNIMFKYDDEGKPEDVALIDFQLSHYGS  157 (196)
T ss_pred             EEeeCCCCccceeeccCCCCCccceEEEecccCCcCC
Confidence            45559999999999843 34   68999997654333


No 299
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=45.52  E-value=13  Score=29.93  Aligned_cols=25  Identities=44%  Similarity=0.509  Sum_probs=22.2

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-+|+||+++ .+|.+.-+|||..-
T Consensus       129 ~dl~p~nil~~-~~~~~~l~dfg~~~  153 (288)
T cd05583         129 RDIKLENILLD-SEGHVVLTDFGLSK  153 (288)
T ss_pred             cCCCHHHeEEC-CCCCEEEEECcccc
Confidence            78899999999 78999999999654


No 300
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=45.50  E-value=51  Score=26.37  Aligned_cols=27  Identities=30%  Similarity=0.245  Sum_probs=22.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++..++++.=+|||..-.
T Consensus       133 ~dl~p~nil~~~~~~~~~l~dfg~~~~  159 (267)
T PHA03390        133 NDIKLENVLYDRAKDRIYLCDYGLCKI  159 (267)
T ss_pred             CCCCHHHEEEeCCCCeEEEecCcccee
Confidence            788999999995444999999997643


No 301
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=45.48  E-value=31  Score=27.36  Aligned_cols=26  Identities=31%  Similarity=0.303  Sum_probs=23.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-+|+||+++ .+|.+.-+|||..-.
T Consensus       122 ~dl~p~ni~i~-~~~~~~l~d~g~~~~  147 (274)
T cd06609         122 RDIKAANILLS-EEGDVKLADFGVSGQ  147 (274)
T ss_pred             CCCCHHHEEEC-CCCCEEEccccccee
Confidence            79999999999 799999999997643


No 302
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=45.48  E-value=55  Score=28.04  Aligned_cols=25  Identities=24%  Similarity=0.174  Sum_probs=21.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .++.+--+|||..-
T Consensus       238 ~Dlkp~Nill~-~~~~~kl~DfG~a~  262 (375)
T cd05104         238 RDLAARNILLT-HGRITKICDFGLAR  262 (375)
T ss_pred             cCCchhhEEEE-CCCcEEEecCccce
Confidence            68889999999 68888889999764


No 303
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l
Probab=45.16  E-value=19  Score=28.66  Aligned_cols=26  Identities=35%  Similarity=0.279  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+--+|||..-+
T Consensus       136 ~dikp~nili~-~~~~~kl~dfgl~~~  161 (270)
T cd05047         136 RDLAARNILVG-ENYVAKIADFGLSRG  161 (270)
T ss_pred             cccccceEEEc-CCCeEEECCCCCccc
Confidence            78889999999 789999999997643


No 304
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=44.83  E-value=15  Score=29.44  Aligned_cols=26  Identities=23%  Similarity=0.118  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+|||++ .++.+-=+|||..-.
T Consensus       148 ~dlkp~nili~-~~~~~kl~dfg~~~~  173 (283)
T cd05090         148 KDLAARNILIG-EQLHVKISDLGLSRE  173 (283)
T ss_pred             hccccceEEEc-CCCcEEecccccccc
Confidence            68889999999 789999999998754


No 305
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=44.80  E-value=15  Score=28.91  Aligned_cols=25  Identities=24%  Similarity=0.218  Sum_probs=22.2

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ ++|.+.=+|||..-
T Consensus       137 ~dlkp~Nil~~-~~~~~kl~dfg~~~  161 (273)
T cd05035         137 RDLAARNCMLR-EDMTVCVADFGLSK  161 (273)
T ss_pred             cccchheEEEC-CCCeEEECCcccee
Confidence            68889999999 78999999999754


No 306
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=44.74  E-value=16  Score=29.52  Aligned_cols=25  Identities=24%  Similarity=0.146  Sum_probs=22.2

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+.-+|||..-
T Consensus       143 ~dikp~nili~-~~~~~~L~Dfg~~~  167 (288)
T cd05061         143 RDLAARNCMVA-HDFTVKIGDFGMTR  167 (288)
T ss_pred             CCCChheEEEc-CCCcEEECcCCccc
Confidence            78889999999 79999999999753


No 307
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=44.71  E-value=15  Score=29.66  Aligned_cols=26  Identities=27%  Similarity=0.263  Sum_probs=23.0

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      -+|-+|+||+++ .+|++.=+|||..-
T Consensus       126 H~dlkp~Nil~~-~~~~~~l~Dfg~~~  151 (291)
T cd07870         126 HRDLKPQNLLIS-YLGELKLADFGLAR  151 (291)
T ss_pred             cCCCChHHEEEc-CCCcEEEecccccc
Confidence            379999999999 79999999999664


No 308
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=44.57  E-value=13  Score=29.95  Aligned_cols=25  Identities=32%  Similarity=0.202  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-+|+||+++ .+|.+.-+|||..-
T Consensus       154 ~dl~p~nil~~-~~~~~~l~dfg~~~  178 (288)
T cd05050         154 RDLATRNCLVG-ENMVVKIADFGLSR  178 (288)
T ss_pred             ccccHhheEec-CCCceEECccccce
Confidence            78999999999 79999999999764


No 309
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=44.57  E-value=22  Score=28.83  Aligned_cols=26  Identities=35%  Similarity=0.294  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .++.+-=+|||....
T Consensus       143 ~dlkp~Nill~-~~~~~kl~dfg~~~~  168 (297)
T cd05089         143 RDLAARNVLVG-ENLASKIADFGLSRG  168 (297)
T ss_pred             CcCCcceEEEC-CCCeEEECCcCCCcc
Confidence            68999999999 789999999998754


No 310
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=44.31  E-value=31  Score=28.21  Aligned_cols=25  Identities=28%  Similarity=0.409  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.=+|||..-
T Consensus       141 ~dl~p~Nill~-~~~~~kL~dfg~~~  165 (297)
T cd06659         141 RDIKSDSILLT-LDGRVKLSDFGFCA  165 (297)
T ss_pred             CCCCHHHeEEc-cCCcEEEeechhHh
Confidence            79999999999 78999999999764


No 311
>KOG3087|consensus
Probab=44.19  E-value=21  Score=29.84  Aligned_cols=30  Identities=30%  Similarity=0.339  Sum_probs=26.7

Q ss_pred             cCCCCCceeEecCCCcE--Eeeeccccccccc
Q psy18027         39 GDRHLENTLVCTKTGRC--VGIDFGYSFGVAT   68 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v--~hIDFg~~f~~~~   68 (165)
                      ||-.-+||++....+++  +-||||....+..
T Consensus       137 GDLTTSNill~~~~~~~~~~lIdfgls~~s~~  168 (229)
T KOG3087|consen  137 GDLTTSNILLRSDGNQITPILIDFGLSSVSRL  168 (229)
T ss_pred             ccccccceEEecCCCcCceEEEeecchhcccC
Confidence            79999999999888888  8999999987755


No 312
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=44.02  E-value=15  Score=29.04  Aligned_cols=27  Identities=26%  Similarity=0.150  Sum_probs=23.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|-.|+||+++ .+|.+.-+|||..-..
T Consensus       133 ~dl~p~nil~~-~~~~~~l~dfg~~~~~  159 (284)
T cd05038         133 RDLAARNILVE-SEDLVKISDFGLAKVL  159 (284)
T ss_pred             CCCCHHhEEEc-CCCCEEEccccccccc
Confidence            79999999999 7899999999876543


No 313
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=44.00  E-value=12  Score=29.60  Aligned_cols=30  Identities=23%  Similarity=0.171  Sum_probs=25.2

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      -||-+|+||+++ .+|.+.=+|||.......
T Consensus       123 h~dl~p~nil~~-~~~~~~l~d~g~~~~~~~  152 (287)
T cd07840         123 HRDIKGSNILIN-NDGVLKLADFGLARPYTK  152 (287)
T ss_pred             eccCcHHHeEEc-CCCCEEEccccceeeccC
Confidence            479999999999 799999999998765433


No 314
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=43.53  E-value=46  Score=25.95  Aligned_cols=28  Identities=21%  Similarity=0.201  Sum_probs=23.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVA   67 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~   67 (165)
                      +|-.|+||+++ .+|.+.=+|||......
T Consensus       123 ~dl~~~nil~~-~~~~~kl~d~g~~~~~~  150 (264)
T cd06626         123 RDIKPANIFLD-HNGVIKLGDFGCAVKLK  150 (264)
T ss_pred             CCCCHHHEEEC-CCCCEEEcccccccccC
Confidence            68889999999 69999999999876543


No 315
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=43.49  E-value=65  Score=24.97  Aligned_cols=27  Identities=30%  Similarity=0.238  Sum_probs=22.1

Q ss_pred             cCCCCCceeEecCCC-------cEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTG-------RCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG-------~v~hIDFg~~f~~   66 (165)
                      +|-.|+||+++ .+|       .+-=+|||.....
T Consensus       125 ~dlkp~Nill~-~~~~~~~~~~~~kl~Dfg~a~~~  158 (259)
T cd05037         125 GNVCGKNILVA-RYGLNEGYVPFIKLSDPGIPITV  158 (259)
T ss_pred             ccCccceEEEe-cCccccCCceeEEeCCCCccccc
Confidence            78899999999 555       6888899977653


No 316
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=43.43  E-value=17  Score=28.76  Aligned_cols=26  Identities=38%  Similarity=0.424  Sum_probs=23.4

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-+|+||+++ .+|.+.-+|||..-.
T Consensus       132 ~dl~~~nil~~-~~~~~~l~d~~~~~~  157 (272)
T cd06629         132 RDLKADNLLVD-ADGICKISDFGISKK  157 (272)
T ss_pred             cCCChhhEEEc-CCCeEEEeecccccc
Confidence            79999999999 799999999998754


No 317
>KOG0986|consensus
Probab=43.16  E-value=19  Score=33.69  Aligned_cols=38  Identities=24%  Similarity=0.308  Sum_probs=28.9

Q ss_pred             HHHHHHhccc----------CCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         30 CIAQYTLGIG----------DRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        30 sv~~YiLgig----------DRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      -.+--++|+-          |--|+|||+| +.||+=-.|+|.+-.-..
T Consensus       292 YAAEi~cGLehlH~~~iVYRDLKPeNILLD-d~GhvRISDLGLAvei~~  339 (591)
T KOG0986|consen  292 YAAEIICGLEHLHRRRIVYRDLKPENILLD-DHGHVRISDLGLAVEIPE  339 (591)
T ss_pred             HHHHHHhhHHHHHhcceeeccCChhheeec-cCCCeEeeccceEEecCC
Confidence            3445566664          5558999999 999999999998876544


No 318
>KOG1006|consensus
Probab=43.15  E-value=17  Score=31.93  Aligned_cols=47  Identities=23%  Similarity=0.232  Sum_probs=33.2

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc---cccCC--CC-CCCCCCcccCHHHH
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG---VATQL--LP-IPELMPFRLTPHIL   86 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~---~~~~~--l~-~~E~vPFRLT~~~~   86 (165)
                      .|--|+|||+| .+|.+=-.|||.+=.   +-.+.  .+ .|=-+|=|++|+=-
T Consensus       192 RDvKPSNILld-r~G~vKLCDFGIcGqLv~SiAkT~daGCrpYmAPERi~p~~~  244 (361)
T KOG1006|consen  192 RDVKPSNILLD-RHGDVKLCDFGICGQLVDSIAKTVDAGCRPYMAPERIDPSDK  244 (361)
T ss_pred             ccCChhheEEe-cCCCEeeecccchHhHHHHHHhhhccCCccccChhccCCccC
Confidence            57789999999 799999999997632   11111  12 26677888887643


No 319
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=43.01  E-value=70  Score=26.79  Aligned_cols=25  Identities=24%  Similarity=0.242  Sum_probs=22.0

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.-+|||..-
T Consensus       203 ~dikp~Nil~~-~~~~~kl~dfg~~~  227 (343)
T cd05103         203 RDLAARNILLS-ENNVVKICDFGLAR  227 (343)
T ss_pred             CCCccCeEEEc-CCCcEEEEeccccc
Confidence            67789999999 78999999999764


No 320
>KOG0599|consensus
Probab=42.95  E-value=15  Score=32.48  Aligned_cols=29  Identities=24%  Similarity=0.260  Sum_probs=24.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      .|--|+||+++ ++-++.-.||||.=.-.+
T Consensus       147 RDLKpENILld-dn~~i~isDFGFa~~l~~  175 (411)
T KOG0599|consen  147 RDLKPENILLD-DNMNIKISDFGFACQLEP  175 (411)
T ss_pred             cccChhheeec-cccceEEeccceeeccCC
Confidence            57789999999 899999999999865443


No 321
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=42.83  E-value=77  Score=25.67  Aligned_cols=25  Identities=20%  Similarity=0.271  Sum_probs=22.2

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+--.|||...
T Consensus       125 ~dlk~~Nili~-~~~~~kl~d~~~~~  149 (314)
T cd08216         125 RSVKASHILLS-GDGKVVLSGLRYSV  149 (314)
T ss_pred             CCCCcceEEEe-cCCceEEecCccce
Confidence            78999999999 78999999998764


No 322
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=42.82  E-value=15  Score=29.48  Aligned_cols=26  Identities=31%  Similarity=0.088  Sum_probs=22.7

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      -+|-.|+||+++ .+|.+.-+|||..-
T Consensus       145 H~dlkp~nil~~-~~~~~kL~dfg~~~  170 (280)
T cd05092         145 HRDLATRNCLVG-QGLVVKIGDFGMSR  170 (280)
T ss_pred             cccccHhhEEEc-CCCCEEECCCCcee
Confidence            378889999999 79999999999764


No 323
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=42.37  E-value=33  Score=28.71  Aligned_cols=28  Identities=21%  Similarity=0.154  Sum_probs=24.7

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVA   67 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~   67 (165)
                      +|-.|+||+++ .+|.+.=+|||.+....
T Consensus       142 ~dlkp~Nill~-~~~~~kL~dfg~~~~~~  169 (343)
T cd07851         142 RDLKPSNIAVN-EDCELKILDFGLARHTD  169 (343)
T ss_pred             CCCCHHHeEEC-CCCCEEEcccccccccc
Confidence            78899999999 79999999999887543


No 324
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=42.30  E-value=19  Score=28.81  Aligned_cols=25  Identities=24%  Similarity=0.126  Sum_probs=21.8

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.=+|||..-
T Consensus       131 ~dlkp~Nili~-~~~~~~l~dfg~~~  155 (283)
T cd05080         131 RDLAARNVLLD-NDRLVKIGDFGLAK  155 (283)
T ss_pred             cccChheEEEc-CCCcEEEeeccccc
Confidence            67889999999 78999999999764


No 325
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
Probab=42.20  E-value=41  Score=25.30  Aligned_cols=30  Identities=27%  Similarity=0.283  Sum_probs=25.5

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      -||-+|+||+++ ..|++.-+|||.......
T Consensus       110 h~~i~~~ni~~~-~~~~~~l~d~~~~~~~~~  139 (244)
T smart00220      110 HRDLKPENILLD-EDGHVKLADFGLARQLDP  139 (244)
T ss_pred             cCCcCHHHeEEC-CCCcEEEccccceeeecc
Confidence            488899999999 679999999999876544


No 326
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=42.04  E-value=18  Score=28.72  Aligned_cols=25  Identities=28%  Similarity=0.226  Sum_probs=21.9

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .++.+--+|||..-
T Consensus       119 ~dlkp~nil~~-~~~~~kl~dfg~~~  143 (257)
T cd05115         119 RDLAARNVLLV-NQHYAKISDFGLSK  143 (257)
T ss_pred             cccchheEEEc-CCCcEEeccCCccc
Confidence            58899999999 78999999999764


No 327
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=41.89  E-value=56  Score=25.33  Aligned_cols=26  Identities=19%  Similarity=0.109  Sum_probs=19.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-.|+||+++.+...+.=+|||..-
T Consensus       125 ~dl~~~nil~~~~~~~~~l~d~~~~~  150 (257)
T cd08225         125 RDIKSQNIFLSKNGMVAKLGDFGIAR  150 (257)
T ss_pred             ccCCHHHEEEcCCCCeEEecccccch
Confidence            78899999999433445678998654


No 328
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=41.76  E-value=14  Score=31.10  Aligned_cols=27  Identities=22%  Similarity=0.172  Sum_probs=23.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|-.|+||+++ .+|.+.-+|||..-..
T Consensus       142 ~dlkp~Nil~~-~~~~~kL~Dfg~~~~~  168 (353)
T cd07850         142 RDLKPSNIVVK-SDCTLKILDFGLARTA  168 (353)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCccceeC
Confidence            78899999999 7899999999987643


No 329
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=41.72  E-value=19  Score=29.08  Aligned_cols=26  Identities=31%  Similarity=0.111  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+.=+|||..-.
T Consensus       147 ~dlkp~Nil~~-~~~~~~l~dfg~a~~  172 (291)
T cd05094         147 RDLATRNCLVG-ANLLVKIGDFGMSRD  172 (291)
T ss_pred             cccCcceEEEc-cCCcEEECCCCcccc
Confidence            68899999999 789999999997743


No 330
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=41.50  E-value=15  Score=29.44  Aligned_cols=25  Identities=32%  Similarity=0.300  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.=+|||..-
T Consensus       132 ~dlkp~Nil~~-~~~~~kl~dfg~~~  156 (288)
T cd06616         132 RDVKPSNILLD-RNGNIKLCDFGISG  156 (288)
T ss_pred             cCCCHHHEEEc-cCCcEEEeecchhH
Confidence            79999999999 78999999999763


No 331
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=41.23  E-value=17  Score=33.78  Aligned_cols=26  Identities=23%  Similarity=0.277  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+|||++..+|.+-=+|||..-
T Consensus       279 RDLKP~NILl~~~~~~~KL~DFGlA~  304 (566)
T PLN03225        279 RDVKPQNIIFSEGSGSFKIIDLGAAA  304 (566)
T ss_pred             CcCCHHHEEEeCCCCcEEEEeCCCcc
Confidence            57789999999668999999999873


No 332
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=41.09  E-value=56  Score=25.87  Aligned_cols=26  Identities=35%  Similarity=0.441  Sum_probs=23.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|.+-=+|||..-.
T Consensus       124 ~dl~~~ni~~~-~~~~~kl~d~g~~~~  149 (288)
T cd07833         124 RDIKPENILVS-ESGVLKLCDFGFARA  149 (288)
T ss_pred             CCCCHHHeEEC-CCCCEEEEeeecccc
Confidence            88999999999 799999999997553


No 333
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=40.99  E-value=16  Score=30.54  Aligned_cols=26  Identities=23%  Similarity=0.148  Sum_probs=23.3

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-.|+||+++ .+|.+.-+|||....
T Consensus       141 ~dlkp~NIll~-~~~~~kL~dfg~~~~  166 (342)
T cd07879         141 RDLKPGNLAVN-EDCELKILDFGLARH  166 (342)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeCCCCcC
Confidence            78899999999 789999999998754


No 334
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=40.78  E-value=19  Score=29.43  Aligned_cols=26  Identities=27%  Similarity=0.188  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+.=+|||....
T Consensus       133 ~dikp~Nill~-~~~~~kL~Dfg~~~~  158 (303)
T cd05110         133 RDLAARNVLVK-SPNHVKITDFGLARL  158 (303)
T ss_pred             cccccceeeec-CCCceEEcccccccc
Confidence            58899999998 789999999998764


No 335
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=40.78  E-value=17  Score=28.92  Aligned_cols=26  Identities=35%  Similarity=0.327  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-.|+||+++ .+|.+.-+|||..-.
T Consensus       125 ~dl~p~ni~i~-~~~~~~l~dfg~~~~  150 (277)
T cd06917         125 RDIKAANILVT-NTGNVKLCDFGVAAL  150 (277)
T ss_pred             CCcCHHHEEEc-CCCCEEEccCCceee
Confidence            68889999999 799999999997653


No 336
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=40.71  E-value=57  Score=25.52  Aligned_cols=27  Identities=26%  Similarity=0.225  Sum_probs=23.0

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -||=.|+||+++ .+|.+.=+|||..-.
T Consensus       118 H~di~p~nili~-~~~~~kl~df~~~~~  144 (257)
T cd05060         118 HRDLAARNVLLV-NRHQAKISDFGMSRA  144 (257)
T ss_pred             ccCcccceEEEc-CCCcEEeccccccce
Confidence            378889999999 799999999987543


No 337
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs),  (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast 
Probab=40.62  E-value=18  Score=27.90  Aligned_cols=30  Identities=27%  Similarity=0.253  Sum_probs=25.4

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      -||-+|+||+++ .+|.+.=+|||.......
T Consensus       122 H~dl~p~ni~i~-~~~~~~l~d~~~~~~~~~  151 (254)
T cd06627         122 HRDIKAANILTT-KDGVVKLADFGVATKLND  151 (254)
T ss_pred             cCCCCHHHEEEC-CCCCEEEeccccceecCC
Confidence            478999999999 689999999998875543


No 338
>PRK10593 hypothetical protein; Provisional
Probab=40.59  E-value=23  Score=29.90  Aligned_cols=31  Identities=13%  Similarity=0.163  Sum_probs=23.5

Q ss_pred             ccCCCCCceeEecCCCc-EEeeecc-ccccccc
Q psy18027         38 IGDRHLENTLVCTKTGR-CVGIDFG-YSFGVAT   68 (165)
Q Consensus        38 igDRH~~Nili~~~tG~-v~hIDFg-~~f~~~~   68 (165)
                      =||=|++|+|++..+|. ..-||.. .-+|...
T Consensus       197 HGDlw~gNvl~~~~~~~i~~liDPa~~~~g~rE  229 (297)
T PRK10593        197 HGNFTLRSMLKDPRSDQLLAMLNPGLMLWAPRE  229 (297)
T ss_pred             eCCCCcccEEECCCCCceEEEECchHhCCCCHH
Confidence            38889999999965566 6788887 5666643


No 339
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=40.54  E-value=18  Score=32.73  Aligned_cols=24  Identities=38%  Similarity=0.560  Sum_probs=21.7

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      +|=.|+|||++ .+|++.-+|||..
T Consensus       167 rDLKP~NILl~-~~~~vkL~DFGls  190 (496)
T PTZ00283        167 RDIKSANILLC-SNGLVKLGDFGFS  190 (496)
T ss_pred             CCCCHHHEEEe-CCCCEEEEecccC
Confidence            68889999999 7999999999975


No 340
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=40.32  E-value=18  Score=28.94  Aligned_cols=25  Identities=32%  Similarity=0.246  Sum_probs=22.2

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|++.=+|||..-
T Consensus       132 ~dlkp~nili~-~~~~~~l~dfg~~~  156 (284)
T cd05081         132 RDLATRNILVE-SENRVKIGDFGLTK  156 (284)
T ss_pred             ccCCHhhEEEC-CCCeEEECCCcccc
Confidence            68889999999 78999999999765


No 341
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=39.98  E-value=17  Score=28.66  Aligned_cols=27  Identities=22%  Similarity=0.091  Sum_probs=23.2

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -+|-+|+||+++ .+|.+.=+|||....
T Consensus       129 H~dl~p~nili~-~~~~~~l~dfg~~~~  155 (267)
T cd08229         129 HRDIKPANVFIT-ATGVVKLGDLGLGRF  155 (267)
T ss_pred             cCCCCHHHEEEc-CCCCEEECcchhhhc
Confidence            378999999999 799999999997643


No 342
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=39.82  E-value=22  Score=28.19  Aligned_cols=26  Identities=31%  Similarity=0.176  Sum_probs=22.7

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      -||-.|+||+++ .+|.+.-+|||..-
T Consensus       130 H~dl~p~nili~-~~~~~~l~d~g~~~  155 (270)
T cd05056         130 HRDIAARNVLVS-SPDCVKLGDFGLSR  155 (270)
T ss_pred             ccccChheEEEe-cCCCeEEccCceee
Confidence            368889999999 78999999999764


No 343
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=39.81  E-value=44  Score=27.85  Aligned_cols=27  Identities=22%  Similarity=0.117  Sum_probs=23.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|-+|+||+++ .+|.+.=+|||.....
T Consensus       132 ~dl~p~Nili~-~~~~~~l~dfg~~~~~  158 (328)
T cd07856         132 RDLKPSNILIN-ENCDLKICDFGLARIQ  158 (328)
T ss_pred             CCCCHHHEeEC-CCCCEEeCcccccccc
Confidence            78899999999 7999999999977643


No 344
>TIGR01767 MTRK 5-methylthioribose kinase. This enzyme is involved in the methionine salvage pathway in certain bacteria.
Probab=39.81  E-value=20  Score=32.14  Aligned_cols=29  Identities=31%  Similarity=0.299  Sum_probs=22.2

Q ss_pred             HhcccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         35 TLGIGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        35 iLgigDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      .|=-||=|++|||++ . ++.+-||+-+++-
T Consensus       193 ~llHGDl~~gNi~~~-~-~~~~~iD~e~~~~  221 (370)
T TIGR01767       193 TLLHGDLHSGSIFVS-E-HETKVIDPEFAFY  221 (370)
T ss_pred             eeeeccCCcccEEEc-C-CCCEEEcCccccc
Confidence            345699999999997 3 4577999975553


No 345
>PRK11768 serine/threonine protein kinase; Provisional
Probab=39.75  E-value=16  Score=31.18  Aligned_cols=30  Identities=23%  Similarity=0.088  Sum_probs=23.0

Q ss_pred             HHHHhcccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         32 AQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        32 ~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ..+.+-=||=|++||+++ . | +.-|||+.+-
T Consensus       194 ~~~~liHgD~h~~NvL~~-d-~-~~iIDFDd~~  223 (325)
T PRK11768        194 VRLLRLHGDCHPGNILWR-D-G-PHFVDLDDAR  223 (325)
T ss_pred             CCccceecCCCchhcccc-C-C-cEEEeCCCCC
Confidence            356666799999999995 3 4 6669997654


No 346
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi
Probab=39.61  E-value=18  Score=29.13  Aligned_cols=25  Identities=32%  Similarity=0.292  Sum_probs=21.8

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-.|+||+++ .+|.+.=+|||..-
T Consensus       151 ~dikp~nill~-~~~~~kl~dfg~~~  175 (290)
T cd05045         151 RDLAARNVLVA-EGRKMKISDFGLSR  175 (290)
T ss_pred             hhhhhheEEEc-CCCcEEeccccccc
Confidence            78899999998 78888888999764


No 347
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=39.41  E-value=55  Score=25.86  Aligned_cols=25  Identities=32%  Similarity=0.155  Sum_probs=22.1

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-.|+||+++ .+|++.=+|||..-
T Consensus       130 ~~l~p~nil~~-~~~~~~l~dfg~~~  154 (266)
T cd06651         130 RDIKGANILRD-SAGNVKLGDFGASK  154 (266)
T ss_pred             CCCCHHHEEEC-CCCCEEEccCCCcc
Confidence            78899999999 78999999999754


No 348
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=39.34  E-value=18  Score=28.51  Aligned_cols=26  Identities=27%  Similarity=0.275  Sum_probs=23.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-.|+||+++ .+|.+.=+|||....
T Consensus       130 ~dl~p~nill~-~~~~~~l~dfg~~~~  155 (267)
T cd06646         130 RDIKGANILLT-DNGDVKLADFGVAAK  155 (267)
T ss_pred             cCCCHHHEEEC-CCCCEEECcCcccee
Confidence            68899999998 789999999998753


No 349
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=39.14  E-value=16  Score=28.72  Aligned_cols=26  Identities=35%  Similarity=0.229  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-+|+||+++ .+|.+.=+|||..-.
T Consensus       130 ~di~p~nil~~-~~~~~~l~dfg~~~~  155 (267)
T cd06628         130 RDIKGANILVD-NKGGIKISDFGISKK  155 (267)
T ss_pred             ccCCHHHEEEc-CCCCEEecccCCCcc
Confidence            78999999999 899999999997643


No 350
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=38.96  E-value=19  Score=28.30  Aligned_cols=30  Identities=27%  Similarity=0.339  Sum_probs=25.3

Q ss_pred             hcccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         36 LGIGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        36 LgigDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +--+|=+|+||+++ .+|.+.=+|||..-..
T Consensus       114 ~~h~dl~~~nilv~-~~~~~~l~df~~~~~~  143 (262)
T cd05572         114 IIYRDLKPENLLLD-SNGYVKLVDFGFAKKL  143 (262)
T ss_pred             cccCCCCHHHEEEc-CCCCEEEeeCCccccc
Confidence            45589999999999 7899999999986544


No 351
>PRK05943 50S ribosomal protein L25; Reviewed
Probab=38.70  E-value=20  Score=25.52  Aligned_cols=18  Identities=22%  Similarity=0.086  Sum_probs=13.9

Q ss_pred             CceeE-----ecCCCcEEeeecc
Q psy18027         44 ENTLV-----CTKTGRCVGIDFG   61 (165)
Q Consensus        44 ~Nili-----~~~tG~v~hIDFg   61 (165)
                      .+.++     +.-++++.|+||-
T Consensus        70 ~~v~ikevQ~~pv~~~i~HvDF~   92 (94)
T PRK05943         70 VKVKVQAVQRHPFKPKLEHIDFV   92 (94)
T ss_pred             EEEEEeeeecCcCCCCeEeEeee
Confidence            35555     6679999999994


No 352
>PTZ00036 glycogen synthase kinase; Provisional
Probab=38.49  E-value=19  Score=31.89  Aligned_cols=26  Identities=27%  Similarity=0.197  Sum_probs=22.0

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++..++.+-=+|||.+-
T Consensus       194 rDLKp~NILl~~~~~~vkL~DFGla~  219 (440)
T PTZ00036        194 RDLKPQNLLIDPNTHTLKLCDFGSAK  219 (440)
T ss_pred             CCcCHHHEEEcCCCCceeeeccccch
Confidence            58899999999666678889999875


No 353
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=38.14  E-value=19  Score=28.40  Aligned_cols=29  Identities=17%  Similarity=0.180  Sum_probs=24.9

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVA   67 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~   67 (165)
                      =||-+|+||+++ ..|.+.=+|||......
T Consensus       137 H~dl~~~nil~~-~~~~~~l~dfg~~~~~~  165 (269)
T cd08528         137 HRDLTPNNIMLG-EDDKVTITDFGLAKQKQ  165 (269)
T ss_pred             ecCCCHHHEEEC-CCCcEEEecccceeecc
Confidence            478999999999 78999999999886543


No 354
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=38.08  E-value=18  Score=29.40  Aligned_cols=26  Identities=31%  Similarity=0.396  Sum_probs=22.0

Q ss_pred             cCCCCCceeEe---cCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVC---TKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~---~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||++.   ..+|.+.-+|||.+-
T Consensus       132 ~Dlkp~Nil~~~~~~~~~~~kl~DfG~a~  160 (317)
T cd07867         132 RDLKPANILVMGEGPERGRVKIADMGFAR  160 (317)
T ss_pred             CCCCHHHEEEccCCCCCCcEEEeecccee
Confidence            78889999993   367899999999874


No 355
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. 
Probab=37.97  E-value=18  Score=28.74  Aligned_cols=28  Identities=29%  Similarity=0.252  Sum_probs=24.2

Q ss_pred             cccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         37 GIGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        37 gigDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      =-||-+|+||+++ .+|++.-+|||....
T Consensus       122 ~h~dl~p~ni~~~-~~~~~~l~d~g~~~~  149 (284)
T cd07836         122 LHRDLKPQNLLIN-KRGELKLADFGLARA  149 (284)
T ss_pred             eeCCCCHHHEEEC-CCCcEEEeecchhhh
Confidence            3478899999999 899999999998753


No 356
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=37.96  E-value=17  Score=29.27  Aligned_cols=28  Identities=25%  Similarity=0.188  Sum_probs=23.8

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      =+|-.|+||+++ +.|++.-+|||.....
T Consensus       138 H~dl~p~nil~~-~~~~~~l~dfg~~~~~  165 (311)
T cd07866         138 HRDIKAANILID-NQGILKIADFGLARPY  165 (311)
T ss_pred             cCCCCHHHEEEC-CCCCEEECcCccchhc
Confidence            368889999999 7899999999987643


No 357
>cd04792 LanM-like LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
Probab=37.93  E-value=46  Score=31.99  Aligned_cols=50  Identities=20%  Similarity=0.164  Sum_probs=41.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeeccccccccc
Q psy18027         17 RLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVAT   68 (165)
Q Consensus        17 ~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~   68 (165)
                      +-.++|-+-++.+..+.|+|+..|=|.+||.-+  -..=+=||+--+|+...
T Consensus       171 ~e~~~fY~r~G~llal~y~L~~tD~H~ENiIA~--g~~PvlIDlETlf~~~~  220 (825)
T cd04792         171 EEVERYYYRLGGLLALLYLLNATDLHFENIIAS--GEYPVLIDLETLFHPRL  220 (825)
T ss_pred             HHHHHHHHHHHHHHHHHHHcCCcccchhhheee--CCCceEEeeHHhcCCCc
Confidence            456889999999999999999999999999544  56778889877776543


No 358
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=37.82  E-value=17  Score=29.20  Aligned_cols=26  Identities=31%  Similarity=0.346  Sum_probs=22.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+.-+|||.+..
T Consensus       143 ~dl~p~nil~~-~~~~~kl~dfg~~~~  168 (310)
T cd07865         143 RDMKAANILIT-KDGILKLADFGLARA  168 (310)
T ss_pred             cCCCHHHEEEC-CCCcEEECcCCCccc
Confidence            68889999999 789999999998753


No 359
>PHA02988 hypothetical protein; Provisional
Probab=37.82  E-value=71  Score=25.93  Aligned_cols=25  Identities=16%  Similarity=-0.036  Sum_probs=21.6

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|--|+||+++ ++|.+-=+|||..-
T Consensus       147 rdlkp~nill~-~~~~~kl~dfg~~~  171 (283)
T PHA02988        147 KNLTSVSFLVT-ENYKLKIICHGLEK  171 (283)
T ss_pred             CcCChhhEEEC-CCCcEEEcccchHh
Confidence            67779999999 78999999999754


No 360
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=37.81  E-value=21  Score=28.37  Aligned_cols=26  Identities=35%  Similarity=0.443  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-+|+||+++ .+|.+.-+|||....
T Consensus       124 ~~l~p~ni~~~-~~~~~~l~dfg~~~~  149 (286)
T cd07846         124 RDIKPENILVS-QSGVVKLCDFGFART  149 (286)
T ss_pred             cCCCHHHEEEC-CCCcEEEEeeeeeee
Confidence            78899999999 799999999997653


No 361
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=37.55  E-value=21  Score=28.42  Aligned_cols=25  Identities=32%  Similarity=0.375  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-+|+||+++ .+|.+.=+|||..-
T Consensus       128 ~dlkp~nil~~-~~~~~kl~dfg~~~  152 (283)
T cd06617         128 RDVKPSNVLIN-RNGQVKLCDFGISG  152 (283)
T ss_pred             CCCCHHHEEEC-CCCCEEEeeccccc
Confidence            79999999999 78999999999754


No 362
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=37.54  E-value=87  Score=25.82  Aligned_cols=26  Identities=8%  Similarity=0.101  Sum_probs=21.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|.+.-.||+....
T Consensus       125 ~dlkp~Nil~~-~~~~~~l~~~~~~~~  150 (327)
T cd08227         125 RSVKASHILIS-VDGKVYLSGLRSNLS  150 (327)
T ss_pred             CCCChhhEEEe-cCCcEEEcccchhhc
Confidence            78889999999 789998889876543


No 363
>PHA03210 serine/threonine kinase US3; Provisional
Probab=37.54  E-value=19  Score=32.49  Aligned_cols=25  Identities=36%  Similarity=0.450  Sum_probs=22.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++ .+|.+.-+|||..-
T Consensus       291 rDLKP~NILl~-~~~~vkL~DFGla~  315 (501)
T PHA03210        291 RDIKLENIFLN-CDGKIVLGDFGTAM  315 (501)
T ss_pred             CCCCHHHEEEC-CCCCEEEEeCCCce
Confidence            58889999999 78999999999874


No 364
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the 
Probab=37.48  E-value=71  Score=25.12  Aligned_cols=28  Identities=25%  Similarity=0.281  Sum_probs=24.0

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      =||-+|+||+++ .+|.+.=+|||.....
T Consensus       121 H~~l~~~ni~~~-~~~~~~l~d~g~~~~~  148 (282)
T cd07829         121 HRDLKPQNILIN-RDGVLKLADFGLARAF  148 (282)
T ss_pred             cCCCChheEEEc-CCCCEEEecCCccccc
Confidence            489999999999 6899999999977543


No 365
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=37.35  E-value=20  Score=28.84  Aligned_cols=27  Identities=41%  Similarity=0.460  Sum_probs=23.1

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -+|=+|+||+++ .+|++.=+|||..-.
T Consensus       128 H~dl~p~nil~~-~~~~~kl~dfg~~~~  154 (290)
T cd05613         128 YRDIKLENILLD-SNGHVVLTDFGLSKE  154 (290)
T ss_pred             ccCCCHHHeEEC-CCCCEEEeeCcccee
Confidence            378899999999 789999999997643


No 366
>cd00495 Ribosomal_L25_TL5_CTC Ribosomal_L25_TL5_CTC: Ribosomal L25/TL5/CTC N-terminal 5S rRNA binding domain. L25 is a single-domain protein, homologous to the N-terminal domain of TL5 and CTC, which each contain two domains. CTC is a known stress protein, and proteins of this family are believed to have two functions, acting as both ribosomal and stress proteins. In Escherichia coli, cells deleted for L25 were found to be viable; however, these cells grew slowly and had impaired protein synthesis capability. In Bacillus subtilis, CTC is induced under stress conditions and located in the ribosome; it has been proposed that CTC may be necessary for accurate translation under stress conditions. Ribosomal_L25_TL5_CTC is found only in bacteria and some plastids. Due to its limited taxonomic diversity and the viability of cells deleted for L25, this protein is not believed to be necessary for ribosomal assembly. Eukaryotes contain a protein called L25, which is not homologous to bacterial L
Probab=37.26  E-value=18  Score=25.35  Aligned_cols=12  Identities=17%  Similarity=0.393  Sum_probs=11.0

Q ss_pred             ecCCCcEEeeec
Q psy18027         49 CTKTGRCVGIDF   60 (165)
Q Consensus        49 ~~~tG~v~hIDF   60 (165)
                      |.-++++.||||
T Consensus        78 ~pv~~~i~HvDF   89 (91)
T cd00495          78 HPVKDKILHVDF   89 (91)
T ss_pred             ccCCCCEEEEec
Confidence            678999999999


No 367
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=36.78  E-value=24  Score=27.90  Aligned_cols=25  Identities=36%  Similarity=0.333  Sum_probs=21.8

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-+|+||+++ .++.+.-+|||...
T Consensus       130 ~dl~p~nili~-~~~~~kl~dfg~~~  154 (269)
T cd05065         130 RDLAARNILVN-SNLVCKVSDFGLSR  154 (269)
T ss_pred             cccChheEEEc-CCCcEEECCCcccc
Confidence            68899999999 78899999999754


No 368
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=36.75  E-value=48  Score=26.63  Aligned_cols=26  Identities=31%  Similarity=0.309  Sum_probs=22.9

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      -+|-+|+||+++ .+|.+.-+|||..-
T Consensus       128 H~dl~~~nil~~-~~~~~~l~dfg~~~  153 (287)
T cd06621         128 HRDIKPSNILLT-RKGQVKLCDFGVSG  153 (287)
T ss_pred             cCCCCHHHEEEe-cCCeEEEeeccccc
Confidence            478999999999 78999999999754


No 369
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=36.72  E-value=19  Score=28.48  Aligned_cols=27  Identities=30%  Similarity=0.263  Sum_probs=23.2

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -+|-.|+||+++ .+|.+.-+|||....
T Consensus       129 H~dlkp~nili~-~~~~~~l~dfg~~~~  155 (267)
T cd06645         129 HRDIKGANILLT-DNGHVKLADFGVSAQ  155 (267)
T ss_pred             cCCCCHHHEEEC-CCCCEEECcceeeeE
Confidence            378899999999 789999999998643


No 370
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=36.37  E-value=75  Score=25.20  Aligned_cols=26  Identities=15%  Similarity=-0.028  Sum_probs=22.1

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+-=+|||..-.
T Consensus       131 ~dikp~nili~-~~~~~~l~dfg~~~~  156 (266)
T cd05064         131 KGLAAHKVLVN-SDLVCKISGFRRLQE  156 (266)
T ss_pred             ccccHhhEEEc-CCCcEEECCCccccc
Confidence            78899999999 789999899986543


No 371
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=36.24  E-value=21  Score=28.07  Aligned_cols=27  Identities=37%  Similarity=0.348  Sum_probs=22.9

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      =||=+|+||+++ .+|.+.-+|||..-.
T Consensus       120 H~dl~p~nil~~-~~~~~~l~dfg~~~~  146 (260)
T cd05611         120 HRDIKPENLLID-QTGHLKLTDFGLSRN  146 (260)
T ss_pred             cCCCCHHHeEEC-CCCcEEEeeccccee
Confidence            378889999999 789999999997653


No 372
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.
Probab=36.23  E-value=80  Score=24.87  Aligned_cols=25  Identities=32%  Similarity=0.267  Sum_probs=21.7

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++.  |.+-=+|||..-.
T Consensus       124 ~dl~p~ni~l~~--~~~kl~dfg~~~~  148 (282)
T cd07831         124 RDIKPENILIKD--DILKLADFGSCRG  148 (282)
T ss_pred             cccCHHHEEEcC--CCeEEEecccccc
Confidence            788999999994  9999999997753


No 373
>PRK09550 mtnK methylthioribose kinase; Reviewed
Probab=36.18  E-value=28  Score=31.31  Aligned_cols=28  Identities=29%  Similarity=0.344  Sum_probs=23.0

Q ss_pred             HhcccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         35 TLGIGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        35 iLgigDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      .|-=||=|++|||++ . +.+.-|||-+++
T Consensus       224 ~l~HgDl~~gni~~~-~-~~~~viD~E~a~  251 (401)
T PRK09550        224 ALLHGDLHTGSIFVT-E-EETKVIDPEFAF  251 (401)
T ss_pred             ceeeccCCcccEEee-C-CCcEEEeccccc
Confidence            477899999999997 3 468999997665


No 374
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=36.04  E-value=25  Score=28.91  Aligned_cols=26  Identities=27%  Similarity=0.169  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|.+.=+|||..-.
T Consensus       133 ~dlkp~Nill~-~~~~~kl~DfG~a~~  158 (316)
T cd05108         133 RDLAARNVLVK-TPQHVKITDFGLAKL  158 (316)
T ss_pred             cccchhheEec-CCCcEEEcccccccc
Confidence            68889999998 789999999998753


No 375
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=35.96  E-value=23  Score=29.02  Aligned_cols=25  Identities=24%  Similarity=0.187  Sum_probs=22.2

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .++.+.-+|||..-
T Consensus       165 ~dlkp~Nil~~-~~~~~~l~dfg~~~  189 (302)
T cd05055         165 RDLAARNVLLT-HGKIVKICDFGLAR  189 (302)
T ss_pred             hhhccceEEEc-CCCeEEECCCcccc
Confidence            78899999999 78888899999764


No 376
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only]
Probab=35.89  E-value=29  Score=30.32  Aligned_cols=26  Identities=35%  Similarity=0.281  Sum_probs=19.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||=|++|++++-.+.-+--|||+.+-
T Consensus       202 ~D~~~~NVl~d~~~~~~g~iDFdDa~  227 (331)
T COG2334         202 GDLHPDNVLFDDDTDVSGFIDFDDAG  227 (331)
T ss_pred             cCCCccceeEcCCCCeeeEEEccccc
Confidence            89999999999443325668998764


No 377
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=35.86  E-value=28  Score=27.32  Aligned_cols=28  Identities=32%  Similarity=0.202  Sum_probs=23.1

Q ss_pred             cccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         37 GIGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        37 gigDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      --+|-.|+||+++ .+|.+.=+|||..-.
T Consensus       122 ~H~dl~p~ni~i~-~~~~~kl~d~g~~~~  149 (256)
T cd05114         122 IHRDLAARNCLVS-STGVVKVSDFGMTRY  149 (256)
T ss_pred             cccccCcceEEEc-CCCeEEECCCCCccc
Confidence            3467889999999 789999999997653


No 378
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=35.86  E-value=29  Score=29.83  Aligned_cols=25  Identities=24%  Similarity=0.202  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+|||++ .++.+.=+|||..-
T Consensus       236 rDLkp~Nil~~-~~~~~kL~DfGla~  260 (374)
T cd05106         236 RDVAARNVLLT-DGRVAKICDFGLAR  260 (374)
T ss_pred             ccCchheEEEe-CCCeEEEeeceeee
Confidence            78899999999 78999999999763


No 379
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=35.80  E-value=19  Score=29.89  Aligned_cols=26  Identities=31%  Similarity=0.230  Sum_probs=23.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+--+|||....
T Consensus       131 ~dlkp~Nil~~-~~~~~kl~dfg~~~~  156 (334)
T cd07855         131 RDLKPSNLLVN-EDCELRIGDFGMARG  156 (334)
T ss_pred             CCCCHHHEEEc-CCCcEEeccccccee
Confidence            68889999999 799999999998754


No 380
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=35.76  E-value=22  Score=33.53  Aligned_cols=25  Identities=32%  Similarity=0.404  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||||+ .+|++.-+|||..-
T Consensus       128 rDLKP~NILl~-~~g~vkL~DFGls~  152 (669)
T cd05610         128 RDLKPDNMLIS-NEGHIKLTDFGLSK  152 (669)
T ss_pred             CCccHHHEEEc-CCCCEEEEeCCCCc
Confidence            57889999999 78999999999764


No 381
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the 
Probab=35.64  E-value=18  Score=29.24  Aligned_cols=26  Identities=27%  Similarity=0.116  Sum_probs=23.0

Q ss_pred             cCCCCCceeEecC----CCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTK----TGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~----tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .    +|.+.=+|||....
T Consensus       132 ~dlkp~Nil~~-~~~~~~~~~kl~Dfg~~~~  161 (316)
T cd07842         132 RDLKPANILVM-GEGPERGVVKIGDLGLARL  161 (316)
T ss_pred             CCCCHHHEEEc-CCCCccceEEECCCccccc
Confidence            79999999999 6    89999999997653


No 382
>smart00221 STYKc Protein kinase; unclassified specificity. Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase.
Probab=35.00  E-value=23  Score=26.59  Aligned_cols=29  Identities=28%  Similarity=0.204  Sum_probs=24.1

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVA   67 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~   67 (165)
                      -+|-+++||+++ .++.+.-+|||......
T Consensus       121 h~di~~~ni~v~-~~~~~~l~d~g~~~~~~  149 (225)
T smart00221      121 HRDLKPENILLG-MDGLVKLADFGLARFIH  149 (225)
T ss_pred             cCCCCHHHEEEc-CCCCEEEeeCceeeEec
Confidence            478899999999 67999999999766543


No 383
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=34.88  E-value=29  Score=27.20  Aligned_cols=25  Identities=20%  Similarity=0.166  Sum_probs=21.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+.=+|||..-
T Consensus       122 ~dlk~~nili~-~~~~~kl~dfg~~~  146 (262)
T cd05058         122 RDLAARNCMLD-ESFTVKVADFGLAR  146 (262)
T ss_pred             cccCcceEEEc-CCCcEEECCccccc
Confidence            57789999999 78999899999764


No 384
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their 
Probab=34.81  E-value=76  Score=24.80  Aligned_cols=28  Identities=25%  Similarity=0.185  Sum_probs=22.0

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|-.|+||+++...+.+.=+|||.....
T Consensus       127 ~~i~~~nil~~~~~~~~~l~dfg~~~~~  154 (268)
T cd06630         127 RDVKGANLLIDSTGQRLRIADFGAAARL  154 (268)
T ss_pred             CCCCHHHEEEcCCCCEEEEccccccccc
Confidence            7999999999844445888999987544


No 385
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=34.50  E-value=94  Score=27.22  Aligned_cols=25  Identities=24%  Similarity=0.212  Sum_probs=21.8

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+|||++ .++.+.-+|||..-
T Consensus       261 ~dikp~Nill~-~~~~~kL~DfGla~  285 (400)
T cd05105         261 RDLAARNVLLA-QGKIVKICDFGLAR  285 (400)
T ss_pred             CCCChHhEEEe-CCCEEEEEeCCcce
Confidence            68889999999 78899999999764


No 386
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=34.38  E-value=29  Score=27.66  Aligned_cols=25  Identities=28%  Similarity=0.234  Sum_probs=22.0

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-+|+||+++ ..|.+-=+|||..-
T Consensus       133 ~di~p~nil~~-~~~~~kL~dfg~~~  157 (279)
T cd05057         133 RDLAARNVLVK-TPQHVKITDFGLAK  157 (279)
T ss_pred             cccCcceEEEc-CCCeEEECCCcccc
Confidence            68899999998 78999999999764


No 387
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho
Probab=34.37  E-value=20  Score=28.36  Aligned_cols=25  Identities=32%  Similarity=0.155  Sum_probs=22.0

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+.=+|||..-
T Consensus       130 ~dl~p~ni~i~-~~~~~~l~dfg~~~  154 (264)
T cd06653         130 RDIKGANILRD-SAGNVKLGDFGASK  154 (264)
T ss_pred             CCCCHHHEEEc-CCCCEEECcccccc
Confidence            68899999999 78999999999764


No 388
>KOG3010|consensus
Probab=34.13  E-value=32  Score=29.40  Aligned_cols=97  Identities=14%  Similarity=0.118  Sum_probs=69.0

Q ss_pred             CchHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCceeEecCCC-------------cEEeeeccccc-ccccCCCCC-CC
Q psy18027         11 SPMNRVRLRNNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTG-------------RCVGIDFGYSF-GVATQLLPI-PE   75 (165)
Q Consensus        11 ~~~~~~~~r~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG-------------~v~hIDFg~~f-~~~~~~l~~-~E   75 (165)
                      .+++|..+|=.|-     ....+++....+.|.  +.+|..+|             +|+-+|-.... .-+++..++ -.
T Consensus         8 ~a~~Y~~ARP~YP-----tdw~~~ia~~~~~h~--~a~DvG~G~Gqa~~~iae~~k~VIatD~s~~mL~~a~k~~~~~y~   80 (261)
T KOG3010|consen    8 QAADYLNARPSYP-----TDWFKKIASRTEGHR--LAWDVGTGNGQAARGIAEHYKEVIATDVSEAMLKVAKKHPPVTYC   80 (261)
T ss_pred             cHHHHhhcCCCCc-----HHHHHHHHhhCCCcc--eEEEeccCCCcchHHHHHhhhhheeecCCHHHHHHhhcCCCcccc
Confidence            5677788887776     567788888888887  88887777             47778876554 444444444 77


Q ss_pred             CCCcccC-HHHHHhhCCCC-------chhHHH--HHHHHHHHHHHhhhh
Q psy18027         76 LMPFRLT-PHILAVNEPYG-------SQGKRL--WVRHLNEIDTLLSKS  114 (165)
Q Consensus        76 ~vPFRLT-~~~~~~mg~~g-------~~g~~~--~~~~~~~~~~~l~~~  114 (165)
                      .+|++++ .+++.++|+-.       .+.+.+  +.+....++.+||++
T Consensus        81 ~t~~~ms~~~~v~L~g~e~SVDlI~~Aqa~HWFdle~fy~~~~rvLRk~  129 (261)
T KOG3010|consen   81 HTPSTMSSDEMVDLLGGEESVDLITAAQAVHWFDLERFYKEAYRVLRKD  129 (261)
T ss_pred             cCCccccccccccccCCCcceeeehhhhhHHhhchHHHHHHHHHHcCCC
Confidence            8999998 56777777632       244444  467888999999985


No 389
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=33.82  E-value=62  Score=26.28  Aligned_cols=26  Identities=27%  Similarity=0.360  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ ..|.+.=+|||..-.
T Consensus       139 ~dL~p~Nili~-~~~~~kL~dfg~~~~  164 (293)
T cd06647         139 RDIKSDNILLG-MDGSVKLTDFGFCAQ  164 (293)
T ss_pred             ccCCHHHEEEc-CCCCEEEccCcceec
Confidence            68889999999 789999999997643


No 390
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=33.53  E-value=27  Score=27.88  Aligned_cols=25  Identities=24%  Similarity=0.081  Sum_probs=22.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+||+++ .+|.+--+|||..-
T Consensus       148 ~dlkp~Nil~~-~~~~~kl~Dfg~~~  172 (283)
T cd05091         148 KDLATRNVLVF-DKLNVKISDLGLFR  172 (283)
T ss_pred             cccchhheEec-CCCceEeccccccc
Confidence            78899999999 78999999999754


No 391
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=33.47  E-value=73  Score=26.60  Aligned_cols=26  Identities=23%  Similarity=0.107  Sum_probs=22.0

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-+|+||+++..++.+.-+|||..-
T Consensus       138 ~dikp~Nili~~~~~~~kl~dfg~~~  163 (342)
T cd07854         138 RDLKPANVFINTEDLVLKIGDFGLAR  163 (342)
T ss_pred             CCCCHHHEEEcCCCceEEECCcccce
Confidence            67789999998777888889999764


No 392
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=33.45  E-value=76  Score=25.44  Aligned_cols=26  Identities=27%  Similarity=0.266  Sum_probs=22.7

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-+|+||+++ .+|.+.=+|||..-.
T Consensus       140 ~dl~p~nili~-~~~~~kl~dfg~~~~  165 (302)
T cd07864         140 RDIKCSNILLN-NKGQIKLADFGLARL  165 (302)
T ss_pred             CCCCHHHEEEC-CCCcEEeCccccccc
Confidence            78899999999 789999999997653


No 393
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=33.22  E-value=23  Score=28.54  Aligned_cols=26  Identities=23%  Similarity=0.236  Sum_probs=22.6

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      =+|=.|+||+++ ++|.+.-+|||...
T Consensus       120 H~di~p~nili~-~~~~~kl~dfg~~~  145 (278)
T cd05606         120 YRDLKPANILLD-EHGHVRISDLGLAC  145 (278)
T ss_pred             cCCCCHHHEEEC-CCCCEEEccCcCcc
Confidence            378889999999 78999999999764


No 394
>KOG0694|consensus
Probab=33.05  E-value=31  Score=33.31  Aligned_cols=24  Identities=33%  Similarity=0.452  Sum_probs=22.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      .|--.||||+| ..||+=-+|||.+
T Consensus       492 RDlKLdNiLLD-~eGh~kiADFGlc  515 (694)
T KOG0694|consen  492 RDLKLDNLLLD-TEGHVKIADFGLC  515 (694)
T ss_pred             eecchhheEEc-ccCcEEecccccc
Confidence            47789999999 8999999999987


No 395
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=33.04  E-value=30  Score=27.76  Aligned_cols=26  Identities=27%  Similarity=0.217  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|.+.=+|||..-.
T Consensus       156 ~dlkp~Nil~~-~~~~~kL~Dfg~~~~  181 (293)
T cd05053         156 RDLAARNVLVT-EDHVMKIADFGLARD  181 (293)
T ss_pred             cccceeeEEEc-CCCeEEeCccccccc
Confidence            57789999999 799999999997653


No 396
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=32.47  E-value=26  Score=28.19  Aligned_cols=28  Identities=25%  Similarity=0.188  Sum_probs=23.7

Q ss_pred             ccCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      -||-.|+||+++ ..|.+.=+|||.....
T Consensus       129 H~dl~p~nili~-~~~~~~l~d~g~~~~~  156 (293)
T cd07843         129 HRDLKTSNLLLN-NRGILKICDFGLAREY  156 (293)
T ss_pred             eccCCHHHEEEC-CCCcEEEeecCceeec
Confidence            368889999999 7899999999976643


No 397
>PRK10345 hypothetical protein; Provisional
Probab=32.36  E-value=32  Score=27.80  Aligned_cols=23  Identities=17%  Similarity=-0.110  Sum_probs=18.3

Q ss_pred             ccCCCCCceeEecCC---CcEEeeec
Q psy18027         38 IGDRHLENTLVCTKT---GRCVGIDF   60 (165)
Q Consensus        38 igDRH~~Nili~~~t---G~v~hIDF   60 (165)
                      -.|=.|+|||+++.+   ++++=||+
T Consensus       128 hrDlKp~NILl~~~~~~~~~~~LiDg  153 (210)
T PRK10345        128 TMELKPQNILCQRISESEVIPVVCDN  153 (210)
T ss_pred             ecCCCHHHEEEeccCCCCCcEEEEEC
Confidence            468899999998533   37999995


No 398
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=32.36  E-value=24  Score=28.33  Aligned_cols=26  Identities=27%  Similarity=0.354  Sum_probs=22.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+.=+|||..-.
T Consensus       127 ~dl~p~nil~~-~~~~~kl~dfg~~~~  152 (291)
T cd07844         127 RDLKPQNLLIS-ERGELKLADFGLARA  152 (291)
T ss_pred             ccCCHHHEEEc-CCCCEEECccccccc
Confidence            68889999999 799999999997654


No 399
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with 
Probab=32.23  E-value=72  Score=24.67  Aligned_cols=28  Identities=25%  Similarity=0.035  Sum_probs=21.5

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -||-.|+||+++..++.+--+|||..-.
T Consensus       124 h~dl~~~nil~~~~~~~~~l~d~~~~~~  151 (256)
T cd08220         124 HRDLKTQNILLDKHKMVVKIGDFGISKI  151 (256)
T ss_pred             cCCCCHHHEEEcCCCCEEEEccCCCcee
Confidence            4788999999985555566789987653


No 400
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=31.93  E-value=28  Score=29.22  Aligned_cols=26  Identities=23%  Similarity=0.153  Sum_probs=22.8

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|++.-+|||..-.
T Consensus       142 ~dlkp~Nill~-~~~~~kl~dfg~~~~  167 (343)
T cd07880         142 RDLKPGNLAVN-EDCELKILDFGLARQ  167 (343)
T ss_pred             CCCCHHHEEEc-CCCCEEEeecccccc
Confidence            68889999999 789999999997653


No 401
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=31.89  E-value=34  Score=27.08  Aligned_cols=25  Identities=32%  Similarity=0.088  Sum_probs=21.8

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .+|.+--+|||..-
T Consensus       146 ~dlkp~nili~-~~~~~kl~d~g~~~  170 (280)
T cd05049         146 RDLATRNCLVG-YDLVVKIGDFGMSR  170 (280)
T ss_pred             cccccceEEEc-CCCeEEECCcccce
Confidence            67789999999 78999999999764


No 402
>TIGR02904 spore_ysxE spore coat protein YsxE. Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YsxE, are found only in the family Bacillaceae, from among the endospore-forming members of the Firmicutes branch of the Bacteria. As a rule, the ysxE gene is found immediately downstream of spoVID, a gene necessary for spore coat assembly. The protein has been shown to be part of the spore coat.
Probab=31.60  E-value=31  Score=28.93  Aligned_cols=28  Identities=25%  Similarity=0.099  Sum_probs=22.7

Q ss_pred             hcccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         36 LGIGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        36 LgigDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +.=||=+++|++++ .+|.+.-|||-.+-
T Consensus       198 lcHgD~~~~Nvl~~-~~~~~~iIDfd~~~  225 (309)
T TIGR02904       198 LVHGKLSLSHFLYD-ETRGGYFINFEKAS  225 (309)
T ss_pred             eeCCCCcHHhEEEc-CCCCEEEEEhhhcc
Confidence            44499999999998 67888889986554


No 403
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=31.17  E-value=26  Score=29.23  Aligned_cols=27  Identities=22%  Similarity=0.133  Sum_probs=23.7

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|-.|+||+++ .+|.+-=+|||.....
T Consensus       132 ~dlkp~Nil~~-~~~~~kL~Dfg~~~~~  158 (337)
T cd07858         132 RDLKPSNLLLN-ANCDLKICDFGLARTT  158 (337)
T ss_pred             CCCCHHHEEEc-CCCCEEECcCcccccc
Confidence            78899999999 7899999999987644


No 404
>KOG0696|consensus
Probab=31.03  E-value=34  Score=31.94  Aligned_cols=27  Identities=26%  Similarity=0.310  Sum_probs=23.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      .|--.||+|+| ..||+=-.|||.+=.+
T Consensus       474 RDLKLDNvmLd-~eGHiKi~DFGmcKEn  500 (683)
T KOG0696|consen  474 RDLKLDNVMLD-SEGHIKIADFGMCKEN  500 (683)
T ss_pred             eeccccceEec-cCCceEeeeccccccc
Confidence            57789999999 8999999999987543


No 405
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=30.88  E-value=1.4e+02  Score=23.56  Aligned_cols=26  Identities=19%  Similarity=0.013  Sum_probs=21.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|.+--.|||....
T Consensus       141 ~dlkp~Nili~-~~~~~~l~~~~~~~~  166 (275)
T cd05046         141 RDLAARNCLVS-SQREVKVSLLSLSKD  166 (275)
T ss_pred             CcCccceEEEe-CCCcEEEcccccccc
Confidence            78999999999 688888889887643


No 406
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=30.85  E-value=25  Score=29.12  Aligned_cols=25  Identities=28%  Similarity=0.409  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      ||-+|+||+++ ..|.+.-+|||..-
T Consensus       143 ~dl~~~nill~-~~~~~kl~dfg~~~  167 (335)
T PTZ00024        143 RDLSPANIFIN-SKGICKIADFGLAR  167 (335)
T ss_pred             ccccHHHeEEC-CCCCEEECCcccee
Confidence            78899999999 78999999999774


No 407
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=30.52  E-value=39  Score=27.85  Aligned_cols=27  Identities=26%  Similarity=0.292  Sum_probs=23.4

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      +|-+|+||+++ .+|++.-+|||.....
T Consensus       145 ~dl~p~nili~-~~~~~kL~dfg~~~~~  171 (313)
T cd06633         145 RDIKAGNILLT-EPGQVKLADFGSASKS  171 (313)
T ss_pred             CCCChhhEEEC-CCCCEEEeecCCCccc
Confidence            68889999998 7899999999987543


No 408
>KOG0690|consensus
Probab=30.34  E-value=26  Score=31.74  Aligned_cols=49  Identities=27%  Similarity=0.245  Sum_probs=36.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhc----ccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         14 NRVRLRNNFVRSYACMCIAQYTLG----IGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        14 ~~~~~r~~F~~SlA~~sv~~YiLg----igDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      .|-+.|.+|--+ -..|.++|+=.    -.|-..+|+|+| ++||+=-.|||.|=
T Consensus       264 ~FsE~RtRFYGa-EIvsAL~YLHs~~ivYRDlKLENLlLD-kDGHIKitDFGLCK  316 (516)
T KOG0690|consen  264 VFSEDRTRFYGA-EIVSALGYLHSRNIVYRDLKLENLLLD-KDGHIKITDFGLCK  316 (516)
T ss_pred             cccchhhhhhhH-HHHHHhhhhhhCCeeeeechhhhheec-cCCceEeeecccch
Confidence            344567777543 45566777654    247788999999 89999999999874


No 409
>PRK12396 5-methylribose kinase; Reviewed
Probab=30.31  E-value=34  Score=31.05  Aligned_cols=27  Identities=30%  Similarity=0.322  Sum_probs=19.7

Q ss_pred             hcccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         36 LGIGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        36 LgigDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      |==||=|++|||++.  .+..-||.-+.|
T Consensus       229 LlHGDlHtGSI~v~~--~~~kvIDpEFAf  255 (409)
T PRK12396        229 LIHGDLHTGSVFVKN--DSTKVIDPEFAF  255 (409)
T ss_pred             hccCcCCCCCEEecC--CceEEEcccccc
Confidence            345999999999984  346667765555


No 410
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=29.57  E-value=33  Score=28.14  Aligned_cols=27  Identities=26%  Similarity=0.203  Sum_probs=23.3

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      ||-.|+||+++ .+|.+.-+|||.....
T Consensus       139 ~dl~p~nil~~-~~~~~kl~dfg~~~~~  165 (308)
T cd06634         139 RDVKAGNILLS-EPGLVKLGDFGSASIM  165 (308)
T ss_pred             CCCCHHhEEEC-CCCcEEECCcccceee
Confidence            78889999999 7899999999976543


No 411
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=28.98  E-value=41  Score=33.66  Aligned_cols=26  Identities=27%  Similarity=0.303  Sum_probs=23.0

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|++.=+|||..-.
T Consensus       137 RDLKPeNILLd-~dg~vKLiDFGLAk~  162 (932)
T PRK13184        137 RDLKPDNILLG-LFGEVVILDWGAAIF  162 (932)
T ss_pred             cCCchheEEEc-CCCCEEEEecCccee
Confidence            68899999999 789999999998753


No 412
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=28.95  E-value=37  Score=26.49  Aligned_cols=26  Identities=27%  Similarity=0.234  Sum_probs=22.6

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      ||-.|+||+++ .+|.+-=+|||..-.
T Consensus       125 ~~l~~~nil~~-~~~~~~l~d~~~~~~  150 (256)
T cd08218         125 RDIKSQNIFLT-KDGTIKLGDFGIARV  150 (256)
T ss_pred             CCCCHHHEEEc-CCCCEEEeeccceee
Confidence            78899999999 789999999987653


No 413
>PRK06148 hypothetical protein; Provisional
Probab=28.93  E-value=45  Score=33.44  Aligned_cols=27  Identities=33%  Similarity=0.294  Sum_probs=21.6

Q ss_pred             cCCCCCceeEecCCC--cEE-eeeccccccc
Q psy18027         39 GDRHLENTLVCTKTG--RCV-GIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG--~v~-hIDFg~~f~~   66 (165)
                      ||=|++||+++ .++  ++. -||||.+...
T Consensus       208 gDln~~NiLv~-~~~~~~isGiIDFgDa~~~  237 (1013)
T PRK06148        208 NDANDYNILVD-ADDGERISGLIDFGDAVHA  237 (1013)
T ss_pred             CCCCcccEEEc-CCCCcceEEEEECcccccc
Confidence            89999999999 444  676 8999877644


No 414
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=27.93  E-value=53  Score=26.78  Aligned_cols=26  Identities=31%  Similarity=0.396  Sum_probs=21.7

Q ss_pred             cCCCCCceeEe---cCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVC---TKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~---~~tG~v~hIDFg~~f   64 (165)
                      +|=.|+|||++   ..+|.+.=+|||..-
T Consensus       132 rDlkp~Nil~~~~~~~~~~~kl~DfG~a~  160 (317)
T cd07868         132 RDLKPANILVMGEGPERGRVKIADMGFAR  160 (317)
T ss_pred             CCCCHHHEEEecCCCCcCcEEEeecCcee
Confidence            67889999994   367899999999874


No 415
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=27.88  E-value=42  Score=26.15  Aligned_cols=27  Identities=30%  Similarity=0.133  Sum_probs=23.2

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccc
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      -||=.|+||+++ ..|.+-=+|||....
T Consensus       124 h~dl~p~ni~~~-~~~~~kl~d~~~~~~  150 (256)
T cd08221         124 HRDIKTLNIFLT-KAGLIKLGDFGISKI  150 (256)
T ss_pred             ccCCChHhEEEe-CCCCEEECcCcceEE
Confidence            478899999999 789999999997654


No 416
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac
Probab=27.60  E-value=42  Score=26.47  Aligned_cols=25  Identities=24%  Similarity=0.230  Sum_probs=21.2

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ .++.+.=+|||..-
T Consensus       137 ~dikp~nili~-~~~~~kl~dfg~~~  161 (273)
T cd05074         137 RDLAARNCMLN-ENMTVCVADFGLSK  161 (273)
T ss_pred             cccchhhEEEc-CCCCEEECcccccc
Confidence            46679999998 78999999999654


No 417
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=27.59  E-value=41  Score=26.91  Aligned_cols=25  Identities=36%  Similarity=0.228  Sum_probs=21.9

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ ..|.+.-+|||..-
T Consensus       154 ~dlkp~Nili~-~~~~~~l~dfg~~~  178 (296)
T cd05051         154 RDLATRNCLVG-KNYTIKIADFGMSR  178 (296)
T ss_pred             cccchhceeec-CCCceEEcccccee
Confidence            68889999999 77999999999753


No 418
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only]
Probab=27.17  E-value=57  Score=28.53  Aligned_cols=47  Identities=9%  Similarity=-0.005  Sum_probs=28.8

Q ss_pred             HHHHHHHHHHHHHH-HHHHHHHhcccCCCCCceeEecCCCcEEeeecccc
Q psy18027         15 RVRLRNNFVRSYAC-MCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        15 ~~~~r~~F~~SlA~-~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      .+.+...+..+.+. ..=-+-+.+ ||=|++||+|+ ..+-+=-|||+..
T Consensus       179 ~~~~~~~Wl~~~~p~~~~~~~lvH-GD~~~gNlii~-~~~~~gVlDwe~~  226 (321)
T COG3173         179 LADRLIKWLEANRPPWAGPPVLVH-GDYRPGNLIID-PGRPTGVLDWELA  226 (321)
T ss_pred             hHHHHHHHHHhcCCCcCCCceeee-CCcccCCEEEe-CCCeeEEEecccc
Confidence            33444444444444 222222333 99999999999 5666778888643


No 419
>KOG2464|consensus
Probab=26.92  E-value=49  Score=27.32  Aligned_cols=19  Identities=42%  Similarity=0.499  Sum_probs=15.2

Q ss_pred             HHhcccCCCCCceeEecCCC
Q psy18027         34 YTLGIGDRHLENTLVCTKTG   53 (165)
Q Consensus        34 YiLgigDRH~~Nili~~~tG   53 (165)
                      +=+.--|.|++||||+ +||
T Consensus       157 ~~~~hrdl~~gnili~-k~~  175 (246)
T KOG2464|consen  157 LGFEHRDLHLGNILIK-KTG  175 (246)
T ss_pred             hcccccccCcCcEEEe-ccc
Confidence            3345679999999999 677


No 420
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=26.69  E-value=52  Score=26.16  Aligned_cols=26  Identities=23%  Similarity=0.256  Sum_probs=19.9

Q ss_pred             cCCCCCceeEecCCCc-------EEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGR-------CVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~-------v~hIDFg~~f~   65 (165)
                      +|-.|+|||++ .+|.       +--+|||....
T Consensus       129 ~dlkp~Nill~-~~~~~~~~~~~~~l~d~g~~~~  161 (262)
T cd05077         129 GNVCTKNILLA-REGIDGECGPFIKLSDPGIPIT  161 (262)
T ss_pred             CCCCcccEEEe-cCCccCCCCceeEeCCCCCCcc
Confidence            68889999998 4553       67789987643


No 421
>PF02958 EcKinase:  Ecdysteroid kinase;  InterPro: IPR004119 This family includes proteins of unknown function. All known members of this group are proteins from drosophila and Caenorhabditis elegans.
Probab=26.62  E-value=1.1e+02  Score=25.11  Aligned_cols=29  Identities=34%  Similarity=0.357  Sum_probs=22.4

Q ss_pred             HhcccCCCCCceeEecC-CC---cEEeeecccc
Q psy18027         35 TLGIGDRHLENTLVCTK-TG---RCVGIDFGYS   63 (165)
Q Consensus        35 iLgigDRH~~Nili~~~-tG---~v~hIDFg~~   63 (165)
                      +|-=||=|.+|||+... +|   .+.-|||-.+
T Consensus       216 vl~HGD~w~nNilf~~~~~g~~~~~~liDfQ~~  248 (294)
T PF02958_consen  216 VLCHGDFWTNNILFKYDDDGKPIDVVLIDFQLA  248 (294)
T ss_pred             EEEcCccCHHhEeEccccccccccceeeccccc
Confidence            55669999999999754 34   6899998544


No 422
>COG4499 Predicted membrane protein [Function unknown]
Probab=25.60  E-value=82  Score=28.72  Aligned_cols=34  Identities=24%  Similarity=-0.021  Sum_probs=19.9

Q ss_pred             HHHHHHHHHhcccCC-----CCCceeEecCCCcEEeeecc
Q psy18027         27 ACMCIAQYTLGIGDR-----HLENTLVCTKTGRCVGIDFG   61 (165)
Q Consensus        27 A~~sv~~YiLgigDR-----H~~Nili~~~tG~v~hIDFg   61 (165)
                      |.--+.+-.=.-.+|     ||+||+++ ..+..+-+-+|
T Consensus        91 a~~~I~~l~e~~~tr~~~~laPeNilf~-~~l~p~~vH~G  129 (434)
T COG4499          91 ALQNIATLSELNNTRYTFFLAPENILFD-GGLTPFFVHRG  129 (434)
T ss_pred             HHHHHHHHHHhhccceeEEecchheEEc-CCCceEEEecc
Confidence            444444433333444     89999999 55655555554


No 423
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=25.49  E-value=50  Score=26.31  Aligned_cols=26  Identities=27%  Similarity=0.256  Sum_probs=20.5

Q ss_pred             cCCCCCceeEecCCC---cEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTG---RCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG---~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ .+|   .+.-+|||....
T Consensus       140 ~dlkp~nil~~-~~~~~~~~kl~dfg~~~~  168 (277)
T cd05036         140 RDIAARNCLLT-CKGPGRVAKIADFGMARD  168 (277)
T ss_pred             cccchheEEEe-ccCCCcceEeccCccccc
Confidence            78889999998 444   477889997754


No 424
>PF14531 Kinase-like:  Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A.
Probab=25.26  E-value=50  Score=28.45  Aligned_cols=31  Identities=29%  Similarity=0.248  Sum_probs=22.9

Q ss_pred             ccCCCCCceeEecCCCcEEeeecccccccccC
Q psy18027         38 IGDRHLENTLVCTKTGRCVGIDFGYSFGVATQ   69 (165)
Q Consensus        38 igDRH~~Nili~~~tG~v~hIDFg~~f~~~~~   69 (165)
                      =||=.|+|++++ .+|.++--||+.+...++.
T Consensus       168 Hgdi~~~nfll~-~~G~v~Lg~F~~~~r~g~~  198 (288)
T PF14531_consen  168 HGDIKPENFLLD-QDGGVFLGDFSSLVRAGTR  198 (288)
T ss_dssp             EST-SGGGEEE--TTS-EEE--GGGEEETTEE
T ss_pred             ecccceeeEEEc-CCCCEEEcChHHHeecCce
Confidence            489999999999 7899999999999987773


No 425
>KOG0595|consensus
Probab=25.07  E-value=2.1e+02  Score=26.28  Aligned_cols=70  Identities=17%  Similarity=0.146  Sum_probs=46.5

Q ss_pred             HHHHHHHHHHHHHHHHHHhccc--CCCCCceeEecCCCc-----EEeeecccccccccCC-CCCCCCCCcccCHHHHH
Q psy18027         18 LRNNFVRSYACMCIAQYTLGIG--DRHLENTLVCTKTGR-----CVGIDFGYSFGVATQL-LPIPELMPFRLTPHILA   87 (165)
Q Consensus        18 ~r~~F~~SlA~~sv~~YiLgig--DRH~~Nili~~~tG~-----v~hIDFg~~f~~~~~~-l~~~E~vPFRLT~~~~~   87 (165)
                      .-+.|..++|+.-=+-+=-+|-  |--|+||||+...+.     +=-.|||+.=--.++. ...-=-.||=+-|++..
T Consensus       110 t~r~Fm~QLA~alq~L~~~~IiHRDLKPQNiLLs~~~~~~~~~~LKIADFGfAR~L~~~~~a~tlcGSplYMAPEV~~  187 (429)
T KOG0595|consen  110 TARHFMQQLASALQFLHENNIIHRDLKPQNILLSTTARNDTSPVLKIADFGFARFLQPGSMAETLCGSPLYMAPEVIM  187 (429)
T ss_pred             HHHHHHHHHHHHHHHHHHCCeeeccCCcceEEeccCCCCCCCceEEecccchhhhCCchhHHHHhhCCccccCHHHHH
Confidence            3478999999988888888885  557999999853232     3446999874333322 12222357888888764


No 426
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=24.69  E-value=1.7e+02  Score=23.23  Aligned_cols=26  Identities=35%  Similarity=0.280  Sum_probs=22.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|-.|+||+++ ++|++.-+|||....
T Consensus       128 ~dl~p~nil~~-~~~~~~l~d~gl~~~  153 (284)
T cd06620         128 RDIKPSNILVN-SRGQIKLCDFGVSGE  153 (284)
T ss_pred             cCCCHHHEEEC-CCCcEEEccCCcccc
Confidence            78899999999 799999999997643


No 427
>KOG0670|consensus
Probab=24.53  E-value=48  Score=31.80  Aligned_cols=39  Identities=23%  Similarity=0.269  Sum_probs=28.3

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccccccCCCCCCCCCCcccC
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLT   82 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFRLT   82 (165)
                      .|--|+|||++...--+=-+|||.+...+.     .|..|+=.+
T Consensus       560 aDIKPDNiLVNE~k~iLKLCDfGSA~~~~e-----neitPYLVS  598 (752)
T KOG0670|consen  560 ADIKPDNILVNESKNILKLCDFGSASFASE-----NEITPYLVS  598 (752)
T ss_pred             cccCccceEeccCcceeeeccCcccccccc-----ccccHHHHH
Confidence            588999999995555556789998876665     455665443


No 428
>PTZ00284 protein kinase; Provisional
Probab=24.39  E-value=72  Score=28.19  Aligned_cols=26  Identities=27%  Similarity=0.215  Sum_probs=20.0

Q ss_pred             cCCCCCceeEecCCC----------------cEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTG----------------RCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG----------------~v~hIDFg~~f~   65 (165)
                      +|=.|+|||++ ..|                ++--+|||.+..
T Consensus       256 rDlKP~NILl~-~~~~~~~~~~~~~~~~~~~~vkl~DfG~~~~  297 (467)
T PTZ00284        256 TDLKPENILME-TSDTVVDPVTNRALPPDPCRVRICDLGGCCD  297 (467)
T ss_pred             CCCCHHHEEEe-cCCcccccccccccCCCCceEEECCCCcccc
Confidence            68889999998 444                477789997654


No 429
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only]
Probab=23.86  E-value=82  Score=29.66  Aligned_cols=66  Identities=18%  Similarity=0.157  Sum_probs=40.8

Q ss_pred             HHHHHHHHHHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccccCCCC-CCCCCCcccCHHHHHh
Q psy18027         20 NNFVRSYACMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLLP-IPELMPFRLTPHILAV   88 (165)
Q Consensus        20 ~~F~~SlA~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l~-~~E~vPFRLT~~~~~~   88 (165)
                      +|.+.+.|..--.+|+  +||=+++|+|++ ++|+|.-||=-.+==+..+.+. -|=-+|==+.|+.+++
T Consensus       124 RnlA~aFA~lH~~Gh~--vGDVn~~~~lVs-d~~~V~LVdsDsfqi~~ng~~~~cpVg~~eftPPElQ~~  190 (637)
T COG4248         124 RNLASAFATLHEHGHV--VGDVNQNSFLVS-DDSKVVLVDSDSFQINANGTLHLCPVGVSEFTPPELQTL  190 (637)
T ss_pred             HHHHHHHHHHHhcCCc--ccccCccceeee-cCceEEEEcccceeeccCCceEecccCccccCCHHHhcc
Confidence            4566666666666665  679999999999 8999999975332211221221 1333344455777763


No 430
>PF07714 Pkinase_Tyr:  Protein tyrosine kinase Protein kinase; unclassified specificity. Tyrosine kinase, catalytic domain;  InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].  ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....
Probab=23.67  E-value=2.1e+02  Score=22.65  Aligned_cols=27  Identities=30%  Similarity=0.368  Sum_probs=22.5

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFGV   66 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~~   66 (165)
                      ||=++.||+++ .+|.+-=.|||.....
T Consensus       127 ~~l~~~nill~-~~~~~Kl~~f~~~~~~  153 (259)
T PF07714_consen  127 GNLSPSNILLD-SNGQVKLSDFGLSRPI  153 (259)
T ss_dssp             ST-SGGGEEEE-TTTEEEEESTTTGEET
T ss_pred             ccccccccccc-cccccccccccccccc
Confidence            68889999999 7999999999887654


No 431
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning]
Probab=22.82  E-value=62  Score=29.83  Aligned_cols=42  Identities=26%  Similarity=0.350  Sum_probs=28.2

Q ss_pred             HHHHHHHHHH-HHH--HHHhcccCCCCCceeEecCCCcEEeeecccc
Q psy18027         20 NNFVRSYACM-CIA--QYTLGIGDRHLENTLVCTKTGRCVGIDFGYS   63 (165)
Q Consensus        20 ~~F~~SlA~~-sv~--~YiLgigDRH~~Nili~~~tG~v~hIDFg~~   63 (165)
                      -.|..||+.. -++  -|=+-=.|-|.+||+|+  .|+|.-|||-.+
T Consensus       324 lsff~s~~sil~~lekkf~fehrnlt~~niLId--~GnvtLIDfkls  368 (488)
T COG5072         324 LSFFWSCISILDILEKKFPFEHRNLTLDNILID--EGNVTLIDFKLS  368 (488)
T ss_pred             HHHHHHHHHHHhhhhhcCCcccccccccceeee--cCceEEEEeeee
Confidence            3455665542 121  23344467799999998  899999999654


No 432
>COG1465 Predicted alternative 3-dehydroquinate synthase [Amino acid transport and metabolism]
Probab=22.73  E-value=52  Score=29.12  Aligned_cols=47  Identities=28%  Similarity=0.362  Sum_probs=32.0

Q ss_pred             hcccCCCCCceeEecCCCcEEeeecccccccccCCC----------CCCCCCCcccCHHHHHh
Q psy18027         36 LGIGDRHLENTLVCTKTGRCVGIDFGYSFGVATQLL----------PIPELMPFRLTPHILAV   88 (165)
Q Consensus        36 LgigDRH~~Nili~~~tG~v~hIDFg~~f~~~~~~l----------~~~E~vPFRLT~~~~~~   88 (165)
                      +|.|||    +.+|  |+.+.+++=|+.-|+....+          +....-|||....-+++
T Consensus       210 lG~gDR----VCVD--TcsLm~~gEGMLVGs~s~gmFlVhsEs~espYVAaRPFRVNAG~Vha  266 (376)
T COG1465         210 LGSGDR----VCVD--TCSLMTRGEGMLVGSQSRGMFLVHSESEESPYVAARPFRVNAGAVHA  266 (376)
T ss_pred             cCCCce----EEEe--eecccccCCceEeecccCcEEEEecccccCcccccCceeecccceeE
Confidence            688888    5665  89999999888777644322          23455688887655543


No 433
>KOG0614|consensus
Probab=22.65  E-value=48  Score=31.70  Aligned_cols=57  Identities=28%  Similarity=0.297  Sum_probs=36.1

Q ss_pred             ccCCCchHHHHHHH--HHHHHHHHHHHHH------HHh--cc--cCCCCCceeEecCCCcEEeeeccccc
Q psy18027          7 SVAKSPMNRVRLRN--NFVRSYACMCIAQ------YTL--GI--GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus         7 ~~~~~~~~~~~~r~--~F~~SlA~~sv~~------YiL--gi--gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +.|-..+-|-..|+  .|=...|-..++|      |+=  ||  .|--|+|+|++ .+|-+=-+||||+=
T Consensus       500 EaClGGElWTiLrdRg~Fdd~tarF~~acv~EAfeYLH~k~iIYRDLKPENllLd-~~Gy~KLVDFGFAK  568 (732)
T KOG0614|consen  500 EACLGGELWTILRDRGSFDDYTARFYVACVLEAFEYLHRKGIIYRDLKPENLLLD-NRGYLKLVDFGFAK  568 (732)
T ss_pred             HhhcCchhhhhhhhcCCcccchhhhhHHHHHHHHHHHHhcCceeccCChhheeec-cCCceEEeehhhHH
Confidence            34445555655554  3434444333333      332  22  58889999999 89999999999973


No 434
>KOG1167|consensus
Probab=22.64  E-value=47  Score=30.32  Aligned_cols=29  Identities=38%  Similarity=0.412  Sum_probs=25.8

Q ss_pred             hcc--cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         36 LGI--GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        36 Lgi--gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      .||  .|--|+|++.++.||+-+-+|||...
T Consensus       151 ~GIvHRDiKpsNFL~n~~t~rg~LvDFgLA~  181 (418)
T KOG1167|consen  151 NGIVHRDIKPSNFLYNRRTQRGVLVDFGLAQ  181 (418)
T ss_pred             cCccccCCCccccccccccCCceEEechhHH
Confidence            444  46789999999999999999999998


No 435
>KOG0659|consensus
Probab=21.87  E-value=95  Score=27.23  Aligned_cols=38  Identities=24%  Similarity=0.352  Sum_probs=30.4

Q ss_pred             HHHHHHHHhcccCCCCCceeEecCCCcEEeeecccccccc
Q psy18027         28 CMCIAQYTLGIGDRHLENTLVCTKTGRCVGIDFGYSFGVA   67 (165)
Q Consensus        28 ~~sv~~YiLgigDRH~~Nili~~~tG~v~hIDFg~~f~~~   67 (165)
                      +||=..+|++ .|--|+|+||+ .+|.+=-.|||..=.-+
T Consensus       115 ~y~H~~~IlH-RDlKPnNLLis-~~g~lKiADFGLAr~f~  152 (318)
T KOG0659|consen  115 AYCHSKWILH-RDLKPNNLLIS-SDGQLKIADFGLARFFG  152 (318)
T ss_pred             HHHHhhhhhc-ccCCccceEEc-CCCcEEeecccchhccC
Confidence            4566667777 78899999999 89999999999764333


No 436
>PF15232 DUF4585:  Domain of unknown function (DUF4585)
Probab=21.51  E-value=86  Score=21.93  Aligned_cols=19  Identities=16%  Similarity=0.179  Sum_probs=16.8

Q ss_pred             CCCceeEecCCCcEEeeec
Q psy18027         42 HLENTLVCTKTGRCVGIDF   60 (165)
Q Consensus        42 H~~Nili~~~tG~v~hIDF   60 (165)
                      +..++|+|.+||+.+-+|-
T Consensus         6 tqrKvL~DP~SG~Yy~vd~   24 (75)
T PF15232_consen    6 TQRKVLQDPESGQYYVVDA   24 (75)
T ss_pred             cCccEeecCCCCCEEEEec
Confidence            4568999999999999996


No 437
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt
Probab=21.46  E-value=3.5e+02  Score=21.49  Aligned_cols=25  Identities=32%  Similarity=0.353  Sum_probs=18.3

Q ss_pred             cCCCCCceeEecCCC-------cEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTG-------RCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG-------~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ +.|       .+--.|||...
T Consensus       141 ~dlkp~Nill~-~~~~~~~~~~~~kl~d~g~~~  172 (274)
T cd05076         141 GNVCAKNILLA-RLGLAEGTSPFIKLSDPGVSF  172 (274)
T ss_pred             CCCCcccEEEe-ccCcccCccceeeecCCcccc
Confidence            68889999998 333       35667998754


No 438
>PLN02756 S-methyl-5-thioribose kinase
Probab=21.26  E-value=66  Score=29.29  Aligned_cols=27  Identities=30%  Similarity=0.370  Sum_probs=19.9

Q ss_pred             hcccCCCCCceeEecCCCcEEeeeccccc
Q psy18027         36 LGIGDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        36 LgigDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      |==||=|++|||++ .+| ..-||--++|
T Consensus       232 L~HGDl~~g~i~~~-~~~-~~~id~ef~~  258 (418)
T PLN02756        232 LVHGDLHTGSVMVT-PDS-TQVIDPEFAF  258 (418)
T ss_pred             eeecCCCCCcEEEc-CCC-ceEecchhhc
Confidence            44599999999998 343 6667776555


No 439
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity 
Probab=21.16  E-value=3.7e+02  Score=20.90  Aligned_cols=28  Identities=25%  Similarity=0.211  Sum_probs=20.0

Q ss_pred             cCCCCCceeEecCCCc--------EEeeecccccccc
Q psy18027         39 GDRHLENTLVCTKTGR--------CVGIDFGYSFGVA   67 (165)
Q Consensus        39 gDRH~~Nili~~~tG~--------v~hIDFg~~f~~~   67 (165)
                      +|=.|+||+++ .+|.        +--+|||......
T Consensus       124 ~dlkp~nili~-~~~~~~~~~~~~~~l~d~g~~~~~~  159 (258)
T cd05078         124 GNVCAKNVLLI-REEDRKTGNPPFIKLSDPGISITVL  159 (258)
T ss_pred             CCCccceEEEe-cccccccCCCceEEecccccccccC
Confidence            67789999998 4544        4567888765443


No 440
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=20.91  E-value=1.8e+02  Score=23.95  Aligned_cols=26  Identities=8%  Similarity=0.079  Sum_probs=21.9

Q ss_pred             cCCCCCceeEecCCCcEEeeecccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSFG   65 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f~   65 (165)
                      +|=.|+||+++ .+|.+--.||+.+..
T Consensus       125 rDlkp~Nill~-~~~~~~~~~~~~~~~  150 (328)
T cd08226         125 RNIKASHILIS-GDGLVSLSGLSHLYS  150 (328)
T ss_pred             CCCCHHHEEEe-CCCcEEEechHHHhh
Confidence            78899999999 788888889876653


No 441
>PRK05618 50S ribosomal protein L25/general stress protein Ctc; Reviewed
Probab=20.88  E-value=64  Score=26.02  Aligned_cols=31  Identities=10%  Similarity=0.019  Sum_probs=20.4

Q ss_pred             EecCCCcEEeeecccccccccCCCCCCCCCCcccC
Q psy18027         48 VCTKTGRCVGIDFGYSFGVATQLLPIPELMPFRLT   82 (165)
Q Consensus        48 i~~~tG~v~hIDFg~~f~~~~~~l~~~E~vPFRLT   82 (165)
                      .+.-++++.|+||--+=.+.+    +.=.||..++
T Consensus        81 ~~pv~~~i~HvDF~~v~~~~~----v~v~VPv~~~  111 (197)
T PRK05618         81 RHPVKDFILHVDFLRVDAGEK----VKVEVPVHFV  111 (197)
T ss_pred             eccCCCCEEeEEEEEeCCCCE----EEEEeeEEEE
Confidence            377899999999954433322    2224677776


No 442
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It 
Probab=20.42  E-value=61  Score=25.72  Aligned_cols=25  Identities=16%  Similarity=-0.036  Sum_probs=22.1

Q ss_pred             cCCCCCceeEecCCCcEEeeeccccc
Q psy18027         39 GDRHLENTLVCTKTGRCVGIDFGYSF   64 (165)
Q Consensus        39 gDRH~~Nili~~~tG~v~hIDFg~~f   64 (165)
                      +|-.|+||+++ +++.+.=+|||..-
T Consensus       141 ~di~p~nil~~-~~~~~kl~d~g~~~  165 (280)
T cd05043         141 KDIAARNCVID-EELQVKITDNALSR  165 (280)
T ss_pred             cccCHhhEEEc-CCCcEEECCCCCcc
Confidence            78999999998 78999999999763


No 443
>KOG1165|consensus
Probab=20.28  E-value=79  Score=28.73  Aligned_cols=28  Identities=29%  Similarity=0.393  Sum_probs=19.5

Q ss_pred             ccCCCCCceeEec---CCCcEEe-eecccccc
Q psy18027         38 IGDRHLENTLVCT---KTGRCVG-IDFGYSFG   65 (165)
Q Consensus        38 igDRH~~Nili~~---~tG~v~h-IDFg~~f~   65 (165)
                      -.|--|||+||.+   ++-+++| ||||.+=.
T Consensus       147 YRDIKPdNFLIGrp~~k~~n~IhiiDFGmAK~  178 (449)
T KOG1165|consen  147 YRDIKPDNFLIGRPGTKDANVIHIIDFGMAKE  178 (449)
T ss_pred             ecccCccceeecCCCCCCCceEEEEeccchhh
Confidence            3566799999953   3345555 79998754


Done!