Query         psy18040
Match_columns 82
No_of_seqs    140 out of 761
Neff          8.0 
Searched_HMMs 46136
Date          Fri Aug 16 20:57:16 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy18040.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/18040hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR03230 lipo_lipase lipoprot  99.9 2.2E-24 4.9E-29  154.5   6.7   78    3-81    227-308 (442)
  2 PF00151 Lipase:  Lipase;  Inte  99.9 2.5E-23 5.4E-28  144.8   3.5   73    6-79    253-331 (331)
  3 cd00707 Pancreat_lipase_like P  99.8 1.6E-19 3.4E-24  122.7   6.3   67    7-75    208-275 (275)
  4 PHA00731 hypothetical protein   32.3      40 0.00087   19.7   1.8   17   65-81     13-29  (96)
  5 PF03223 V-ATPase_C:  V-ATPase   26.7      19 0.00042   26.0  -0.2   20   12-31    294-317 (371)
  6 PRK13736 conjugal transfer pro  25.1      82  0.0018   21.5   2.6   24   57-80     67-90  (245)
  7 KOG3952|consensus               23.2      41 0.00088   23.3   0.8   29    4-32     96-124 (304)
  8 PRK14746 RepA leader peptide T  23.0      44 0.00096   14.8   0.7   21   14-34      3-24  (26)
  9 KOG2909|consensus               22.1      31 0.00068   25.0   0.1   21   12-32    297-321 (381)
 10 PF08262 Lem_TRP:  Leucophaea m  21.0      45 0.00098   11.5   0.4    6   54-59      2-7   (10)
 11 cd01785 PDZ_GEF_RA Ubiquitin-l  20.3      51  0.0011   18.9   0.7   19   56-74     67-85  (85)

No 1  
>TIGR03230 lipo_lipase lipoprotein lipase. Members of this protein family are lipoprotein lipase (EC 3.1.1.34), a eukaryotic triacylglycerol lipase active in plasma and similar to pancreatic and hepatic triacylglycerol lipases (EC 3.1.1.3). It is also called clearing factor. It cleaves chylomicron and VLDL triacylglycerols; it also has phospholipase A-1 activity.
Probab=99.90  E-value=2.2e-24  Score=154.45  Aligned_cols=78  Identities=26%  Similarity=0.462  Sum_probs=69.4

Q ss_pred             ccCCceeecccc-HHHHHhhcCCC-CCceeeecCChhhhhcCCcccCCCCCCcccCCcccCCCC--CceeEEEecCCCCC
Q psy18040          3 SAKSLVEQASMK-TRKGESSILPR-CNFPALACESYEKYLEGNCFNCTDPTKCGNMGYYADKST--GRGTLYLLTRDEEP   78 (82)
Q Consensus         3 ~~~~~~~CsH~R-~~yf~ESI~~~-~~F~a~~C~s~~~~~~g~C~~c~~~~~~~~MG~~~~~~~--~~G~~yl~T~~~~P   78 (82)
                      ++.+.+.|||.| ++||+|||.++ ++|+|++|++|++|+.|.|.+|.. +.|+.|||++++.+  .+|+|||.|++++|
T Consensus       227 ~~~~~~~CsH~Ra~~~f~eSi~~~~~~f~a~~C~s~~~f~~g~C~~c~~-~~c~~mG~~~~~~~~~~~g~~yl~T~~~~P  305 (442)
T TIGR03230       227 NMDQLVKCSHERSIHLFIDSLLNEENPSMAYRCSSKEAFNKGLCLSCRK-NRCNKLGYEINKVRTKRSSKMYLKTREMMP  305 (442)
T ss_pred             ccCcCccchhHHHHHHHHHHhcccCCCeeeEECCCHHHHhcCCCCCCCC-CCCceeCccccccccCCceEEEEEeCCCCC
Confidence            345678999999 99999999764 899999999999999999999975 57999999999753  47999999999999


Q ss_pred             CCC
Q psy18040         79 FCG   81 (82)
Q Consensus        79 f~~   81 (82)
                      ||+
T Consensus       306 f~~  308 (442)
T TIGR03230       306 YKV  308 (442)
T ss_pred             ceE
Confidence            986


No 2  
>PF00151 Lipase:  Lipase;  InterPro: IPR013818 Triglyceride lipases (3.1.1.3 from EC) are lipolytic enzymes that hydrolyse ester linkages of triglycerides []. Lipases are widely distributed in animals, plants and prokaryotes. At least three tissue-specific isozymes exist in higher vertebrates, pancreatic, hepatic and gastric/lingual. These lipases are closely related to each other and to lipoprotein lipase (3.1.1.34 from EC), which hydrolyses triglycerides of chylomicrons and very low density lipoproteins (VLDL) []. The most conserved region in all these proteins is centred around a serine residue which has been shown [] to participate, with an histidine and an aspartic acid residue, in a charge relay system. Such a region is also present in lipases of prokaryotic origin and in lecithin-cholesterol acyltransferase (2.3.1.43 from EC) (LCAT) [], which catalyzes fatty acid transfer between phosphatidylcholine and cholesterol.; PDB: 1LPB_B 1LPA_B 1N8S_A 1GPL_A 1W52_X 2PVS_B 2OXE_B 1BU8_A 2PPL_A 1ETH_A ....
Probab=99.88  E-value=2.5e-23  Score=144.75  Aligned_cols=73  Identities=40%  Similarity=0.809  Sum_probs=54.7

Q ss_pred             Cceeecccc-HHHHHhhcCCCCCceeeecCChhhhhcCCcccCCCCCCcccCCcccCCCC-----CceeEEEecCCCCCC
Q psy18040          6 SLVEQASMK-TRKGESSILPRCNFPALACESYEKYLEGNCFNCTDPTKCGNMGYYADKST-----GRGTLYLLTRDEEPF   79 (82)
Q Consensus         6 ~~~~CsH~R-~~yf~ESI~~~~~F~a~~C~s~~~~~~g~C~~c~~~~~~~~MG~~~~~~~-----~~G~~yl~T~~~~Pf   79 (82)
                      +.+.|||.| |+||+|||.+++.|+|++|++|++|+.|.|..|.. ..++.||+++++.+     .+|+|||.|++++||
T Consensus       253 ~~~~CsH~ra~~~f~eSi~~~~~f~a~~C~s~~~~~~g~C~~c~~-~~~~~mG~~~~~~~~~~~~~~G~yyl~T~~~~Pf  331 (331)
T PF00151_consen  253 RFISCSHMRAVEYFAESINNPCNFPAVRCSSYDSFLAGKCDGCNN-NRCAVMGYHADKFKGKTSPARGIYYLETNAKSPF  331 (331)
T ss_dssp             SHHHHHHHHHHHHHHHHHHSTTTTB-EE-S-HHHHHTTTS-S--T-T---BSSGGGGGSTTTTSSSSEEEEE---SSST-
T ss_pred             ecchhhhHHHHHHHHHHhcCCCCceeEeCcCHHHHhhcccccCCC-CCCcCCCCCcccCCccccCCCeEEEEeeCCCCcC
Confidence            467899999 99999999999999999999999999999998865 68999999977654     689999999999998


No 3  
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes.  Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface.  A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation .  The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure.  A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site.
Probab=99.79  E-value=1.6e-19  Score=122.72  Aligned_cols=67  Identities=37%  Similarity=0.747  Sum_probs=59.9

Q ss_pred             ceeecccc-HHHHHhhcCCCCCceeeecCChhhhhcCCcccCCCCCCcccCCcccCCCCCceeEEEecCC
Q psy18040          7 LVEQASMK-TRKGESSILPRCNFPALACESYEKYLEGNCFNCTDPTKCGNMGYYADKSTGRGTLYLLTRD   75 (82)
Q Consensus         7 ~~~CsH~R-~~yf~ESI~~~~~F~a~~C~s~~~~~~g~C~~c~~~~~~~~MG~~~~~~~~~G~~yl~T~~   75 (82)
                      .+.|||.| ++||+|||.++++|+|++|++|++|+.+.|..|..  .+..||+++++...+|+|||.|++
T Consensus       208 ~~~CsH~ra~~~~~esi~~~~~f~a~~C~~~~~~~~~~C~~~~~--~~~~mG~~~~~~~~~G~~~~~T~~  275 (275)
T cd00707         208 FVACSHQRAVHYFAESILSPCGFVAYPCSSYDEFLAGKCFPCGS--GCVRMGYHADRFRREGKFYLKTNA  275 (275)
T ss_pred             ccccchHHHHHHHHHHccCCCCceeEeCCCHHHHhcCCCCCCCC--CCcccCCccCCCCCCceEEEEcCC
Confidence            47999999 99999999988999999999999999999987642  589999999987445999999985


No 4  
>PHA00731 hypothetical protein
Probab=32.28  E-value=40  Score=19.70  Aligned_cols=17  Identities=18%  Similarity=0.411  Sum_probs=14.2

Q ss_pred             CceeEEEecCCCCCCCC
Q psy18040         65 GRGTLYLLTRDEEPFCG   81 (82)
Q Consensus        65 ~~G~~yl~T~~~~Pf~~   81 (82)
                      +..+|||-|++..||..
T Consensus        13 QnSvffllT~grk~yg~   29 (96)
T PHA00731         13 QNSIFFLLTEGRKTYGK   29 (96)
T ss_pred             ccceEEEEecCcccccc
Confidence            45789999999999864


No 5  
>PF03223 V-ATPase_C:  V-ATPase subunit C;  InterPro: IPR004907 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) (3.6.3.14 from EC) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release []. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins []. This entry represents the C subunit that is part of the V1 complex, and is localised to the interface between the V1 and V0 complexes []. This subunit does not show any homology with F-ATPase subunits. The C subunit plays an essential role in controlling the assembly of V-ATPase, acting as a flexible stator that holds together the catalytic (V1) and membrane (V0) sectors of the enzyme []. The release of subunit C from the ATPase complex results in the dissociation of the V1 and V0 subcomplexes, which is an important mechanism in controlling V-ATPase activity in cells.  More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0015991 ATP hydrolysis coupled proton transport, 0033180 proton-transporting V-type ATPase, V1 domain; PDB: 1U7L_A.
Probab=26.68  E-value=19  Score=26.02  Aligned_cols=20  Identities=35%  Similarity=0.335  Sum_probs=15.1

Q ss_pred             ccc-HHHHHhhcCC---CCCceee
Q psy18040         12 SMK-TRKGESSILP---RCNFPAL   31 (82)
Q Consensus        12 H~R-~~yf~ESI~~---~~~F~a~   31 (82)
                      |.+ .+.|+|||+.   |..|.++
T Consensus       294 HlKalRvFVESVLRYGLP~~F~a~  317 (371)
T PF03223_consen  294 HLKALRVFVESVLRYGLPPNFQAF  317 (371)
T ss_dssp             HHHHHHHHHHHHHHH-SS--EEEE
T ss_pred             HHhhhhhhhhhhhhcCCCCCceEE
Confidence            889 9999999975   5567765


No 6  
>PRK13736 conjugal transfer protein TraK; Provisional
Probab=25.06  E-value=82  Score=21.46  Aligned_cols=24  Identities=25%  Similarity=0.458  Sum_probs=17.0

Q ss_pred             CcccCCCCCceeEEEecCCCCCCC
Q psy18040         57 GYYADKSTGRGTLYLLTRDEEPFC   80 (82)
Q Consensus        57 G~~~~~~~~~G~~yl~T~~~~Pf~   80 (82)
                      ++...+...+|..||.++...||.
T Consensus        67 ~~~~~~~~~~G~i~vs~~~~~pfT   90 (245)
T PRK13736         67 ALTNNEQTASGGVVLATVNKKPFT   90 (245)
T ss_pred             cccccCCCCCceEEEEecCCCCEE
Confidence            333334456899999999988884


No 7  
>KOG3952|consensus
Probab=23.20  E-value=41  Score=23.32  Aligned_cols=29  Identities=0%  Similarity=-0.140  Sum_probs=21.9

Q ss_pred             cCCceeeccccHHHHHhhcCCCCCceeee
Q psy18040          4 AKSLVEQASMKTRKGESSILPRCNFPALA   32 (82)
Q Consensus         4 ~~~~~~CsH~R~~yf~ESI~~~~~F~a~~   32 (82)
                      +..+..|+|.|+.+|+.--+...+|+++.
T Consensus        96 ~~~~~~~~~~~~~~~~~~PN~~~~~~~~~  124 (304)
T KOG3952|consen   96 MQTFMKCSHGRYAFWRDKPNDKKPVIVFM  124 (304)
T ss_pred             ccceeeeccccccceeeCCCCCCcEEEeh
Confidence            45677899999778887555557888876


No 8  
>PRK14746 RepA leader peptide Tap; Provisional
Probab=23.03  E-value=44  Score=14.79  Aligned_cols=21  Identities=24%  Similarity=0.390  Sum_probs=13.3

Q ss_pred             c-HHHHHhhcCCCCCceeeecC
Q psy18040         14 K-TRKGESSILPRCNFPALACE   34 (82)
Q Consensus        14 R-~~yf~ESI~~~~~F~a~~C~   34 (82)
                      | .+|+.-++.-+|.-.|.+|+
T Consensus         3 RK~Q~l~~~lLLpCniSAg~~d   24 (26)
T PRK14746          3 RKVQYLLRLLLLPCNISAGRCD   24 (26)
T ss_pred             HHHHHHHHHHHhcceecccccC
Confidence            5 66766666556766666654


No 9  
>KOG2909|consensus
Probab=22.07  E-value=31  Score=25.05  Aligned_cols=21  Identities=33%  Similarity=0.292  Sum_probs=16.0

Q ss_pred             ccc-HHHHHhhcCC---CCCceeee
Q psy18040         12 SMK-TRKGESSILP---RCNFPALA   32 (82)
Q Consensus        12 H~R-~~yf~ESI~~---~~~F~a~~   32 (82)
                      |.. .+.|+|||..   |-.|.++-
T Consensus       297 HiKaLRvfVESVlRYGLP~~F~a~~  321 (381)
T KOG2909|consen  297 HIKALRVFVESVLRYGLPPNFQAVL  321 (381)
T ss_pred             HHHHHHHHHHHHHHhcCCcchheee
Confidence            888 9999999975   45566543


No 10 
>PF08262 Lem_TRP:  Leucophaea maderae tachykinin-related peptide ;  InterPro: IPR013206 These peptides are designated Leucophaea maderae (Madeira cockroach) tachykinin-related peptides (Lem TRPs). Some were isolated from the midgut of L. maderae, whereas others appear to be brain specific. The Lem TRPs of the brain are myotropic and induce increases in the amplitude and frequency of spontaneous contractions and tonus of hindgut muscle in L. maderae []. They were also isolated from brain-corpora, cardiaca-corpora, allata-suboesophageal ganglion extracts of Locusta migratoria (Migratory locust). They stimulate visceral muscle contractions of the oviduct and the foregut of L. migratoria [].
Probab=21.03  E-value=45  Score=11.49  Aligned_cols=6  Identities=33%  Similarity=0.728  Sum_probs=3.7

Q ss_pred             ccCCcc
Q psy18040         54 GNMGYY   59 (82)
Q Consensus        54 ~~MG~~   59 (82)
                      +.||++
T Consensus         2 psmgf~    7 (10)
T PF08262_consen    2 PSMGFH    7 (10)
T ss_pred             Cccccc
Confidence            457765


No 11 
>cd01785 PDZ_GEF_RA Ubiquitin-like domain of PDZ_GEF_RA. PDZ_GEF_RA   PDZ-GEF  is a guanine nucleotide exchange factor (GEF) characterised by the presence of a PSD-95/DlgA/ZO-1 (PDZ) domain, a Ras-association (RA) domain and a region related to a cyclic nucleotide binding domain (RCBD).  RA-GEF exchanges nucleotides of both Rap1 and Rap2, but is also thought to mediate cAMP-induced Ras activation. The RA domain interacts with Rap1 and also contributes to the membrane localization of RA-GEF. This domain may function in a positive feedback loop.
Probab=20.32  E-value=51  Score=18.92  Aligned_cols=19  Identities=16%  Similarity=0.221  Sum_probs=12.1

Q ss_pred             CCcccCCCCCceeEEEecC
Q psy18040         56 MGYYADKSTGRGTLYLLTR   74 (82)
Q Consensus        56 MG~~~~~~~~~G~~yl~T~   74 (82)
                      |---+++-...|.|||+.|
T Consensus        67 l~~La~RI~Ln~RYYLKnN   85 (85)
T cd01785          67 LQNLAERIQLSSRYYLKNN   85 (85)
T ss_pred             HHHHHHhhcccceEEeccC
Confidence            3334444445799999875


Done!