Diaphorina citri psyllid: psy18060


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------55
MEKSNGALEKYQKICLIGEGSFGKVFKAIHLDLKKTVALKIISKSGRSGKELSSLKQECEIQKHLAHPNIIKFIASHETLNEFVLITEFAHMSLSKLGEPWFHNHCQPVKMEKSNGALEKYQKICLIGEGSFGKVFKAIHLDLKKTVALKIISKSGRSGKELSSLKQECEIQKHLAHPNIIKFIASHETLNEFVLITEFAHMSLSNLLEQRKKLSETICVQILSNLISALYYLHSNRVLHRDLKPQNVLLNKDGVAMLCDFGFARSMAVGTHMLTSIKGTPLYMAPELIAERPYDHTADLWSLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLVKGLLEKDASQRLSWPELLHHPLVKDNLSSEIESQNNQDCIGFDYCDKRRGSRKSITTIVESDSDENEEWVMFLRTCLHKLLAGSDSDTASCERSFILMLITSLRCQSCVVLGLITHILVVLIMKHEDSAHLRECLFVFYYYYFSDSEDDMYSDADLSSDDDEDKIYDEDLVLSHSSYSTYLKKKAKREAYRNDIDDEDEYS
ccccccccccEEEccccccccccEEEEEEEcccccEEEEEEEcccccccHHHHHHHHHHHHHHccccccccHHEEEEEcccEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHccccccEEEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHHHcccccccEEEEEEEEccEEEEEEEccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccccHHHHHHHHHHccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccccHHccccccccccccHHHHHHHHHHHHHHHHcccccccccc
*****GA*EKYQKICLIGEGSFGKVFKAIHLDLKKTVALKIIS***************CEIQKHLAHPNIIKFIASHETLNEFVLITEFAHMSLSKLG***F***********SNGALEKYQKICLIGEGSFGKVFKAIHLDLKKTVALKIIS**************ECEIQKHLAHPNIIKFIASHETLNEFVLITEFAHMSLSNLLEQRKKLSETICVQILSNLISALYYLHSNRVLHRDLKPQNVLLNKDGVAMLCDFGFARSMAVGTHMLTSIKGTPLYMAPELIAERPYDHTADLWSLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLVKGLLEKDASQRLSWPELLHHPLVKDN**********QDCIGFDYCDKR******ITTIV*******EEWVMFLRTCLHKLLAGSDSDTASCERSFILMLITSLRCQSCVVLGLITHILVVLIMKHEDSAHLRECLFVFYYYYFSDS*************************L*HSSY************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKSNGALEKYQKICLIGEGSFGKVFKAIHLDLKKTVALKIISKSGRSGKELSSLKQECEIQKHLAHPNIIKFIASHETLNEFVLITEFAHMSLSKLGEPWFHNHCQPVKMEKSNGALEKYQKICLIGEGSFGKVFKAIHLDLKKTVALKIISKSGRSGKELSSLKQECEIQKHLAHPNIIKFIASHETLNEFVLITEFAHMSLSNLLEQRKKLSETICVQILSNLISALYYLHSNRVLHRDLKPQNVLLNKDGVAMLCDFGFARSMAVGTHMLTSIKGTPLYMAPELIAERPYDHTADLWSLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLVKGLLEKDASQRLSWPELLHHPLVKDNLSSEIESQNNQDCIGFDYCDKRRGSRKSITTIVESDSDENEEWVMFLRTCLHKLLAGSDSDTASCERSFILMLITSLRCQSCVVLGLITHILVVLIMKHEDSAHLRECLFVFYYYYFSDSEDDMYSDADLSSDDDEDKIYDEDLVLSHSSYSTYLKKKAKREAYRNDIDDEDEYS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase 36 Serine/threonine protein kinase which plays an important role in the sonic hedgehog (Shh) pathway by regulating the activity of GLI transcription factors. Controls the activity of the transcriptional regulators GLI1, GLI2 and GLI3 by opposing the effect of SUFU and promoting their nuclear localization. GLI2 requires an additional function of STK36 to become transcriptionally active, but the enzyme does not need to possess an active kinase catalytic site for this to occur. Required for postnatal development, possibly by regulating the homeostasis of cerebral spinal fluid or ciliary function. Essential for construction of the central pair apparatus of motile cilia.confidentQ5RAJ5
Serine/threonine-protein kinase 36 Serine/threonine protein kinase which plays an important role in the sonic hedgehog (Shh) pathway by regulating the activity of GLI transcription factors. Controls the activity of the transcriptional regulators GLI1, GLI2 and GLI3 by opposing the effect of SUFU and promoting their nuclear localization. GLI2 requires an additional function of STK36 to become transcriptionally active, but the enzyme does not need to possess an active kinase catalytic site for this to occur. Required for postnatal development, possibly by regulating the homeostasis of cerebral spinal fluid or ciliary function. Essential for construction of the central pair apparatus of motile cilia.confidentQ9NRP7
Serine/threonine-protein kinase fused Probable serine/threonine-protein kinase; maternally required for correct patterning in the posterior part of each embryonic metamere. May be involved in control of cell division during metamorphosis and ovarian development. May interact with costal-2.confidentP23647

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035175 [MF]histone kinase activity (H3-S10 specific)probableGO:0003824, GO:0016773, GO:0016772, GO:0035174, GO:0016301, GO:0035173, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0030295 [MF]protein kinase activator activityprobableGO:0019207, GO:0019887, GO:0030234, GO:0019209, GO:0003674, GO:0008047
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007049 [BP]cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0032880 [BP]regulation of protein localizationprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0000775 [CC]chromosome, centromeric regionprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0042384 [BP]cilium assemblyprobableGO:0022607, GO:0030030, GO:0030031, GO:0010927, GO:0009653, GO:0044699, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0060271, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0032990, GO:0006996, GO:0048858, GO:0048856, GO:0044085, GO:0008150, GO:0044782
GO:0071902 [BP]positive regulation of protein serine/threonine kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0045860, GO:0071900, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0005876 [CC]spindle microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0000794 [CC]condensed nuclear chromosomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0051233 [CC]spindle midzoneprobableGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0007228 [BP]positive regulation of hh target transcription factor activityprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0023052, GO:0007165, GO:0007166, GO:0035556, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0019219, GO:0065007, GO:0044093, GO:0065009, GO:0010468, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0007154, GO:0044700, GO:0051091, GO:0051090, GO:0007227, GO:0007224, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0044763
GO:0043987 [BP]histone H3-S10 phosphorylationprobableGO:0018105, GO:0016310, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0016570, GO:0016572, GO:0006468, GO:0009987, GO:0006464, GO:0035404, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0018209, GO:0051276, GO:0019538, GO:0043412, GO:0044237, GO:0043170, GO:0006796, GO:0006793, GO:0044763, GO:0016568, GO:0016569
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0004683 [MF]calmodulin-dependent protein kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0007243 [BP]intracellular protein kinase cascadeprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0000922 [CC]spindle poleprobableGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0045880 [BP]positive regulation of smoothened signaling pathwayprobableGO:0008589, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0031647 [BP]regulation of protein stabilityprobableGO:0019222, GO:0060255, GO:0010608, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ACX, chain A
Confidence level:very confident
Coverage over the Query: 112-381
View the alignment between query and template
View the model in PyMOL
Template: 3H4J, chain B
Confidence level:very confident
Coverage over the Query: 4-96
View the alignment between query and template
View the model in PyMOL
Template: 3A60, chain A
Confidence level:confident
Coverage over the Query: 119-266,280-381
View the alignment between query and template
View the model in PyMOL