RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy18063
         (79 letters)



>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), AGC (Protein Kinases A, G and C) family,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The AGC family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and Phosphoinositide 3-Kinase (PI3K). Members of
           this family include cAMP-dependent Protein Kinase (PKA),
           cGMP-dependent Protein Kinase (PKG), Protein Kinase C
           (PKC), Protein Kinase B (PKB), G protein-coupled
           Receptor Kinase (GRK), Serum- and Glucocorticoid-induced
           Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase
           (p70S6K or S6K), among others. AGC kinases share an
           activation mechanism based on the phosphorylation of up
           to three sites: the activation loop (A-loop), the
           hydrophobic motif (HM) and the turn motif.
           Phosphorylation at the A-loop is required of most AGC
           kinases, which results in a disorder-to-order transition
           of the A-loop. The ordered conformation results in the
           access of substrates and ATP to the active site. A
           subset of AGC kinases with C-terminal extensions
           containing the HM also requires phosphorylation at this
           site. Phosphorylation at the HM allows the C-terminal
           extension to form an ordered structure that packs into
           the hydrophobic pocket of the catalytic domain, which
           then reconfigures the kinase into an active bi-lobed
           state. In addition, growth factor-activated AGC kinases
           such as PKB, p70S6K, RSK, MSK, PKC, and SGK, require
           phosphorylation at the turn motif (also called tail or
           zipper site), located N-terminal to the HM at the
           C-terminal extension. AGC kinases regulate many cellular
           processes including division, growth, survival,
           metabolism, motility, and differentiation. Many are
           implicated in the development of various human diseases.
          Length = 250

 Score = 45.6 bits (109), Expect = 2e-07
 Identities = 14/48 (29%), Positives = 22/48 (45%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
           SLG + YE+  G PPF       +   +    + FP  +S   +DL+ 
Sbjct: 178 SLGVLLYEMLTGKPPFYAEDRKEIYEKILKDPLRFPEFLSPEARDLIS 225


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
           domain.  Phosphotransferases. Serine or
           threonine-specific kinase subfamily.
          Length = 254

 Score = 39.8 bits (94), Expect = 2e-05
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 4/52 (7%)

Query: 32  SLGCIAYEIHMGHPPF----KTVSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
           SLG I YE+  G PPF    + + +   I   K         +S   KDL++
Sbjct: 181 SLGVILYELLTGKPPFPGDDQLLELFKKIGKPKPPFPPPEWDISPEAKDLIR 232


>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine
           Kinase, cAMP-dependent protein kinase.  Serine/Threonine
           Kinases (STKs), cAMP-dependent protein kinase (PKA)
           subfamily, catalytic (c) subunit. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PKA
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This subfamily is composed of the
           cAMP-dependent proteins kinases, PKA and PRKX. The
           inactive PKA holoenzyme is a heterotetramer composed of
           two phosphorylated and active catalytic (C) subunits
           with a dimer of regulatory (R) subunits. Activation is
           achieved through the binding of the important second
           messenger cAMP to the R subunits, which leads to the
           dissociation of PKA into the R dimer and two active C
           subunits. PKA is present ubiquitously in cells and
           interacts with many different downstream targets. It
           plays a role in the regulation of diverse processes such
           as growth, development, memory, metabolism, gene
           expression, immunity, and lipolysis.
          Length = 290

 Score = 37.9 bits (89), Expect = 1e-04
 Identities = 17/53 (32%), Positives = 28/53 (52%)

Query: 27  SVIIGSLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
           +V   +LG + YE+  G+PPF   + + +   +    V FPS  S   KDL++
Sbjct: 178 AVDWWALGILIYEMLAGYPPFFDDNPIQIYEKILEGKVRFPSFFSPDAKDLIR 230


>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 2.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek2 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek2
           subfamily includes Aspergillus nidulans NIMA kinase, the
           founding member of the Nek family, which was identified
           in a screen for cell cycle mutants prevented from
           entering mitosis. NIMA is essential for mitotic entry
           and progression through mitosis, and its degradation is
           essential for mitotic exit. NIMA is involved in nuclear
           membrane fission. Vertebrate Nek2 is a cell
           cycle-regulated STK, localized in centrosomes and
           kinetochores, that regulates centrosome splitting at the
           G2/M phase. It also interacts with other mitotic kinases
           such as Polo-like kinase 1 and may play a role in
           spindle checkpoint. An increase in the expression of the
           human NEK2 gene is strongly associated with the
           progression of non-Hodgkin lymphoma.
          Length = 265

 Score = 36.8 bits (86), Expect = 3e-04
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 30  IGSLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDV-TFPSQVSETYKDLVK 79
           I SLGC+ YE+    PPF   + L L   +K       P + S    +++K
Sbjct: 193 IWSLGCLIYELCALSPPFTARNQLQLASKIKEGKFRRIPYRYSSELNEVIK 243


>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein
           Serine/Threonine Kinase, beta-adrenergic receptor
           kinase.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily,
           beta-adrenergic receptor kinase (beta-ARK) group,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The GRK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. GRKs
           phosphorylate and regulate G protein-coupled receptors
           (GPCRs), the largest superfamily of cell surface
           receptors which regulate some part of nearly all
           physiological functions. Phosphorylated GPCRs bind to
           arrestins, which prevents further G protein signaling
           despite the presence of activating ligand. There are
           seven types of GRKs, named GRK1 to GRK7. The beta-ARK
           group is composed of GRK2, GRK3, and similar proteins.
           GRK2 and GRK3 are both widely expressed in many tissues,
           although GRK2 is present at higher levels. They contain
           an N-terminal RGS homology (RH) domain, a central
           catalytic domain, and C-terminal pleckstrin homology
           (PH) domain that mediates PIP2 and G protein
           betagamma-subunit translocation to the membrane. GRK2
           (also called beta-ARK or beta-ARK1) is important in
           regulating several cardiac receptor responses. It plays
           a role in cardiac development and in hypertension.
           Deletion of GRK2 in mice results in embryonic lethality,
           caused by hypoplasia of the ventricular myocardium. GRK2
           also plays important roles in the liver (as a regulator
           of portal blood pressure), in immune cells, and in the
           nervous system. Altered GRK2 expression has been
           reported in several disorders including major
           depression, schizophrenia, bipolar disorder, and
           Parkinsonism.
          Length = 278

 Score = 35.7 bits (82), Expect = 8e-04
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 32  SLGCIAYEIHMGHPPF---KTVSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
           SLGC+ +++  GH PF   KT     + R+  T  V  P   S   + L++
Sbjct: 181 SLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLE 231


>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine
           Kinase, G protein-coupled Receptor Kinase.
           Serine/Threonine Kinases (STKs), G protein-coupled
           Receptor Kinase (GRK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The GRK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. GRKs phosphorylate and
           regulate G protein-coupled receptors (GPCRs), the
           largest superfamily of cell surface receptors, which
           regulate some part of nearly all physiological
           functions. Phosphorylated GPCRs bind to arrestins, which
           prevents further G protein signaling despite the
           presence of activating ligand. GRKs contain a central
           catalytic domain, flanked by N- and C-terminal
           extensions. The N-terminus contains an RGS (regulator of
           G protein signaling) homology (RH) domain and several
           motifs. The C-terminus diverges among different groups
           of GRKs. There are seven types of GRKs, named GRK1 to
           GRK7. They are subdivided into three main groups: visual
           (GRK1/7); beta-adrenergic receptor kinases (GRK2/3); and
           GRK4-like (GRK4/5/6). Expression of GRK2/3/5/6 is
           widespread while GRK1/4/7 show a limited tissue
           distribution. The substrate spectrum of the widely
           expressed GRKs partially overlaps. GRKs play important
           roles in the cardiovascular, immune, respiratory,
           skeletal, and nervous systems.
          Length = 277

 Score = 35.6 bits (82), Expect = 9e-04
 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 4/50 (8%)

Query: 32  SLGCIAYEIHMGHPPFK----TVSILHLIRLLKTQDVTFPSQVSETYKDL 77
           +LGC  YE+  G  PF+     V    L R      V +P + S   KDL
Sbjct: 179 ALGCTLYEMIAGRSPFRQRKEKVEKEELKRRTLEMAVEYPDKFSPEAKDL 228


>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Phosphoinositide-dependent
           kinase 1.  Serine/Threonine Kinases (STKs),
           Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PDK1
           carries an N-terminal catalytic domain and a C-terminal
           pleckstrin homology (PH) domain that binds
           phosphoinositides. It phosphorylates the activation loop
           of AGC kinases that are regulated by PI3K such as PKB,
           SGK, and PKC, among others, and is crucial for their
           activation. Thus, it contributes in regulating many
           processes including metabolism, growth, proliferation,
           and survival. PDK1 also has the ability to
           autophosphorylate and is constitutively active in
           mammalian cells. PDK1 is essential for normal embryo
           development and is important in regulating cell volume.
          Length = 280

 Score = 34.5 bits (80), Expect = 0.002
 Identities = 14/48 (29%), Positives = 25/48 (52%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
           +LGCI Y++  G PPF+  +     + +   + +FP       KDL++
Sbjct: 207 ALGCIIYQMLTGKPPFRGSNEYLTFQKILKLEYSFPPNFPPDAKDLIE 254


>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Citron Rho-interacting kinase. 
           Serine/Threonine Kinases (STKs), Citron Rho-interacting
           kinase (CRIK) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The CRIK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CRIK is also called citron kinase. It contains
           a catalytic domain, a central coiled-coil domain, and a
           C-terminal region containing a Rho-binding domain (RBD),
           a zinc finger, and a pleckstrin homology (PH) domain, in
           addition to other motifs. CRIK, an effector of the small
           GTPase Rho, plays an important function during
           cytokinesis and affects its contractile process.
           CRIK-deficient mice show severe ataxia and epilepsy as a
           result of abnormal cytokinesis and massive apoptosis in
           neuronal precursors. A Down syndrome critical region
           protein TTC3 interacts with CRIK and inhibits
           CRIK-dependent neuronal differentiation and neurite
           extension.
          Length = 330

 Score = 34.0 bits (78), Expect = 0.003
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 14/57 (24%)

Query: 32  SLGCIAYEIHMGHPPF------KTVS-ILHLIRLLKTQDVTFPS--QVSETYKDLVK 79
           SLG IAYE+  G  PF      KT + I++  R LK     FP   +VS  + DL++
Sbjct: 194 SLGVIAYEMIYGRSPFHEGTSAKTYNNIMNFQRFLK-----FPEDPKVSSDFLDLIQ 245


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine
           Kinase, Never In Mitosis gene A-related kinase.
           Serine/Threonine Kinases (STKs), Never In Mitosis gene A
           (NIMA)-related kinase (Nek) family, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek family is
           composed of 11 different mammalian members (Nek1-11)
           with similarity to the catalytic domain of Aspergillus
           nidulans NIMA kinase, the founding member of the Nek
           family which was identified in a screen for cell cycle
           mutants that were prevented from entering mitosis. Neks
           contain a conserved N-terminal catalytic domain and a
           more divergent C-terminal regulatory region of various
           sizes and structures. They are involved in the
           regulation of downstream processes following the
           activation of Cdc2, and many of their functions are cell
           cycle-related. They play critical roles in microtubule
           dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 34.0 bits (79), Expect = 0.003
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 30  IGSLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVT-FPSQVSETYKDLVK 79
           I SLGC+ YE+     PF+  ++L L   +        PSQ S   ++LV 
Sbjct: 186 IWSLGCVLYELCTLKHPFEGENLLELALKILKGQYPPIPSQYSSELRNLVS 236


>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related
           kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related
           (NDR) kinase subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The NDR subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. NDR kinase contains an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Like many
           other AGC kinases, NDR kinase requires phosphorylation
           at two sites, the activation loop (A-loop) and the
           hydrophobic motif (HM), for activity. NDR kinases
           regulate mitosis, cell growth, embryonic development,
           and neurological processes. They are also required for
           proper centrosome duplication. Higher eukaryotes contain
           two NDR isoforms, NDR1 and NDR2. This subfamily also
           contains fungal NDR-like kinases.
          Length = 364

 Score = 33.9 bits (78), Expect = 0.003
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 6/53 (11%)

Query: 32  SLGCIAYEIHMGHPPF---KTVSILHLIRLLKTQDVTFPSQV--SETYKDLVK 79
           SLG I YE+ +G+PPF           I   K + + FP +V  S   KDL+K
Sbjct: 224 SLGVIMYEMLVGYPPFCSDNPQETYRKIINWK-ETLQFPDEVPLSPEAKDLIK 275


>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated
           serine/threonine kinase-like proteins.  Serine/Threonine
           Kinases (STKs), Microtubule-associated serine/threonine
           (MAST) kinase subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAST kinase subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The MAST kinase subfamily
           includes MAST kinases, MAST-like (MASTL) kinases, and
           fungal kinases with similarity to Saccharomyces
           cerevisiae Rim15 and Schizosaccharomyces pombe cek1.
           MAST kinases contain an N-terminal domain of unknown
           function, a central catalytic domain, and a C-terminal
           PDZ domain that mediates protein-protein interactions.
           MASTL kinases carry only a catalytic domain which
           contains a long insert relative to other kinases. The
           fungal kinases in this subfamily harbor other domains in
           addition to a central catalytic domain, which also
           contains an insert relative to MAST kinases like MASTL.
           Rim15 contains a C-terminal signal receiver (REC) domain
           while cek1 contains an N-terminal PAS domain. MAST
           kinases are cytoskeletal associated kinases of unknown
           function that are also expressed at neuromuscular
           junctions and postsynaptic densities. The fungal
           proteins Rim15 and cek1 are involved in the regulation
           of meiosis and mitosis, respectively.
          Length = 265

 Score = 33.0 bits (76), Expect = 0.007
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPS--QVSETYKDLVK 79
           SLGCI YE  +G PPF   +   + + +    + +P   +VS+   DL+ 
Sbjct: 186 SLGCILYEFLVGIPPFHGETPEEIFQNILNGKIEWPEDVEVSDEAIDLIS 235


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 33.0 bits (76), Expect = 0.007
 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 32  SLGCIAYEIHMGHPPF---KTVSILHLIRLLKTQDVTFPSQ----VSETYKDLVK 79
           SLG I YE+  G PPF     +  L LIR +    + F        SE  KDL+K
Sbjct: 184 SLGVILYELLTGKPPFSGENILDQLQLIRRILGPPLEFDEPKWSSGSEEAKDLIK 238


>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. 
           Serine/Threonine Kinases (STKs), NDR kinase subfamily,
           NDR2 isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The NDR
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. NDR kinase contains an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Like many
           other AGC kinases, NDR kinase requires phosphorylation
           at two sites, the activation loop (A-loop) and the
           hydrophobic motif (HM), for activity. Higher eukaryotes
           contain two NDR isoforms, NDR1 and NDR2. Both isoforms
           play a role in proper centrosome duplication. In
           addition, NDR2 plays a role in regulating neuronal
           growth and differentiation, as well as in facilitating
           neurite outgrowth. It is also implicated in fear
           conditioning as it contributes to the coupling of
           neuronal morphological changes with fear-memory
           consolidation. NDR2 is also referred to as STK38-like.
          Length = 360

 Score = 33.1 bits (75), Expect = 0.008
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKT--QDVTFPSQV--SETYKDLV 78
           SLG I YE+ +G+PPF + +     R +    + + FP +V  SE  KDL+
Sbjct: 221 SLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLI 271


>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. 
           Serine/Threonine Kinases (STKs), NDR kinase subfamily,
           NDR1 isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The NDR
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. NDR kinase contains an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Like many
           other AGC kinases, NDR kinase requires phosphorylation
           at two sites, the activation loop (A-loop) and the
           hydrophobic motif (HM), for activity. Higher eukaryotes
           contain two NDR isoforms, NDR1 and NDR2. Both isoforms
           play a role in proper centrosome duplication. NDR1 is
           highly expressed in thymus, muscle, lung and spleen. It
           is not an essential protein because mice deficient of
           NDR1 remain viable and fertile. However, these mice
           develop T-cell lymphomas and appear to be hypersenstive
           to carcinogenic treatment. NDR1 appears to act as a
           tumor suppressor. NDR1 is also called STK38.
          Length = 363

 Score = 32.7 bits (74), Expect = 0.009
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKT--QDVTFPSQV--SETYKDLV 78
           SLG I YE+ +G+PPF + +     + +    + + FP +V  SE  KDL+
Sbjct: 221 SLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLIFPPEVPISEKAKDLI 271


>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein
           Serine/Threonine Kinase, cGMP-dependent protein kinase. 
           Serine/Threonine Kinases (STKs), cGMP-dependent protein
           kinase (cGK or PKG) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The cGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Mammals have two cGK isoforms
           from different genes, cGKI and cGKII. cGKI exists as two
           splice variants, cGKI-alpha and cGKI-beta. cGK consists
           of an N-terminal regulatory domain containing a
           dimerization and an autoinhibitory pseudosubstrate
           region, two cGMP-binding domains, and a C-terminal
           catalytic domain. Binding of cGMP to both binding sites
           releases the inhibition of the catalytic center by the
           pseudosubstrate region, allowing autophosphorylation and
           activation of the kinase. cGKI is a  soluble protein
           expressed in all smooth muscles, platelets, cerebellum,
           and kidney. It is also expressed at lower concentrations
           in other tissues. cGKII is a membrane-bound protein that
           is most abundantly expressed in the intestine. It is
           also present in the brain nuclei, adrenal cortex,
           kidney, lung, and prostate. cGKI is involved in the
           regulation of smooth muscle tone, smooth cell
           proliferation, and platelet activation. cGKII plays a
           role in the regulation of secretion, such as renin
           secretion by the kidney and aldosterone secretion by the
           adrenal. It also regulates bone growth and the circadian
           rhythm.
          Length = 262

 Score = 32.2 bits (74), Expect = 0.011
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 6/59 (10%)

Query: 26  TSVIIGSLGCIAYEIHMGHPPFKT-----VSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
            SV   SLG + YE+  G PPF       + I + I L     + FP+ + +  KDL+K
Sbjct: 171 FSVDYWSLGILLYELLTGRPPFGEDDEDPMEIYNDI-LKGNGKLEFPNYIDKAAKDLIK 228


>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit;
           Provisional.
          Length = 329

 Score = 32.1 bits (73), Expect = 0.013
 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 3/63 (4%)

Query: 17  QRNWHKRAVTSVIIGSLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKD 76
           Q   H +AV      ++G + YE   G+PPF   +   +   +    + FP+      +D
Sbjct: 188 QSKGHGKAVD---WWTMGVLLYEFIAGYPPFFDDTPFRIYEKILAGRLKFPNWFDGRARD 244

Query: 77  LVK 79
           LVK
Sbjct: 245 LVK 247


>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase
           1-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Yeast protein kinase 1
           (YPK1)-like subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The YPK1-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           fungal proteins with similarity to the AGC STKs,
           Saccharomyces cerevisiae YPK1 and Schizosaccharomyces
           pombe Gad8p. YPK1 is required for cell growth and acts
           as a downstream kinase in the sphingolipid-mediated
           signaling pathway of yeast. It also plays a role in
           efficient endocytosis and in the maintenance of cell
           wall integrity. Gad8p is a downstream target of Tor1p,
           the fission yeast homolog of mTOR. It plays a role in
           cell growth and sexual development.
          Length = 312

 Score = 31.8 bits (72), Expect = 0.021
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLV 78
           +LG + YE+  G PPF   ++  + R +  + + FP       KDL+
Sbjct: 178 TLGVLLYEMLTGLPPFYDENVNEMYRKILQEPLRFPDGFDRDAKDLL 224


>gnl|CDD|203321 pfam05733, Tenui_N, Tenuivirus/Phlebovirus nucleocapsid protein.
           This family consists of several Tenuivirus and
           Phlebovirus nucleocapsid proteins. These are ssRNA
           viruses.
          Length = 224

 Score = 30.8 bits (70), Expect = 0.039
 Identities = 18/72 (25%), Positives = 25/72 (34%), Gaps = 14/72 (19%)

Query: 21  HKRAVTSVIIGSLGCIAYEIHMGHPPF-------------KTVSILHLIRLLKTQDVTFP 67
            K AVT   + + G   Y   M HP F               +   HL+ LL+      P
Sbjct: 125 AKLAVTGSDMDTSGP-DYPRWMMHPQFAGLIDPTLPKNSNNALFDAHLLYLLQFSKKINP 183

Query: 68  SQVSETYKDLVK 79
               +   D+VK
Sbjct: 184 KLRKKEKGDMVK 195


>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B gamma.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, gamma (or Akt3) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-gamma is
           predominantly expressed in neuronal tissues. Mice
           deficient in PKB-gamma show a reduction in brain weight
           due to the decreases in cell size and cell number.
           PKB-gamma has also been shown to be upregulated in
           estrogen-deficient breast cancer cells,
           androgen-independent prostate cancer cells, and primary
           ovarian tumors. It acts as a key mediator in the genesis
           of ovarian cancer.
          Length = 328

 Score = 30.8 bits (69), Expect = 0.040
 Identities = 15/46 (32%), Positives = 22/46 (47%)

Query: 33  LGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLV 78
           LG + YE+  G  PF       L  L+  +D+ FP  +S   K L+
Sbjct: 181 LGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSADAKSLL 226


>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase C.  Serine/Threonine Kinases
           (STKs), Protein Kinase C (PKC) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, classical PKCs depend on
           calcium, DAG (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. Novel PKCs are
           calcium-independent, but require DAG and PS for
           activity, while atypical PKCs only require PS. PKCs
           phosphorylate and modify the activities of a wide
           variety of cellular proteins including receptors,
           enzymes, cytoskeletal proteins, transcription factors,
           and other kinases. They play a central role in signal
           transduction pathways that regulate cell migration and
           polarity, proliferation, differentiation, and apoptosis.
           Also included in this subfamily are the PKC-like
           proteins, called PKNs.
          Length = 318

 Score = 30.4 bits (69), Expect = 0.052
 Identities = 13/48 (27%), Positives = 25/48 (52%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
           +LG + YE+  G  PF+      L + +   +V +P  +S+  K ++K
Sbjct: 181 ALGVLLYEMLAGQSPFEGDDEDELFQSILEDEVRYPRWLSKEAKSILK 228


>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of
           Phototropin-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Phototropin-like
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           phototropin-like subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Included in this subfamily
           are plant phototropins and predominantly uncharacterized
           fungal STKs whose catalytic domains resemble the
           phototropin kinase domain. One protein from Neurospora
           crassa is called nrc-2. Phototropins are blue-light
           receptors that control responses such as phototropism,
           stromatal opening, and chloroplast movement in order to
           optimize the photosynthetic efficiency of plants. They
           are light-activated STKs that contain an N-terminal
           photosensory domain and a C-terminal catalytic domain.
           The N-terminal domain contains two LOV (Light, Oxygen or
           Voltage) domains that binds FMN. Photoexcitation of the
           LOV domains results in autophosphorylation at multiple
           sites and activation of the catalytic domain. Neurospora
           crassa nrc-2 plays a role in growth and development by
           controlling entry into the conidiation program.
          Length = 316

 Score = 29.9 bits (68), Expect = 0.073
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQ--VSETYKDLVK 79
           +LG + YE+  G  PFK  +       +  ++VTFP    VS + +DL++
Sbjct: 217 TLGILLYEMLYGTTPFKGSNRDETFSNILKKEVTFPGSPPVSSSARDLIR 266


>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, STK25 or Yeast
           Sps1/Ste20-related kinase 1.  Serine/threonine kinases
           (STKs), STK25 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The STK25 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. STK25 is also called Ste20/oxidant stress
           response kinase 1 (SOK1) or yeast Sps1/Ste20-related
           kinase 1 (YSK1). STK25 is localized in the Golgi
           apparatus through its interaction with the Golgi matrix
           protein GM130. It may play a role in the regulation of
           cell migration and polarization. STK25 binds and
           phosphorylates CCM3 (cerebral cavernous malformation 3),
           also called PCD10 (programmed cell death 10), and may
           play a role in apoptosis. Human STK25 is a candidate
           gene responsible for pseudopseudohypoparathyroidism
           (PPHP), a disease that shares features with the Albright
           hereditary osteodystrophy (AHO) phenotype.
          Length = 277

 Score = 30.0 bits (67), Expect = 0.077
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 7/54 (12%)

Query: 30  IGSLGCIAYEIHMGHPPFKTVSILHLIRLL----KTQDVTFPSQVSETYKDLVK 79
           I SLG  A E+  G PP    S LH +R+L    K    T   Q S+ +K+ V+
Sbjct: 184 IWSLGITAIELAKGEPPN---SDLHPMRVLFLIPKNSPPTLEGQYSKPFKEFVE 234


>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and
           Dbf2p-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), ROCK- and NDR-like
           subfamily, fungal Sid2p- and Dbf2p-like proteins,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Sid2p- and
           Dbf2p-like group is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This group contains fungal kinases including
           Schizosaccharomyces pombe Sid2p and Saccharomyces
           cerevisiae Dbf2p. Group members show similarity to NDR
           kinases in that they contain an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Sid2p plays a
           crucial role in the septum initiation network (SIN) and
           in the initiation of cytokinesis. Dbf2p is important in
           regulating the mitotic exit network (MEN) and in
           cytokinesis.
          Length = 333

 Score = 29.7 bits (67), Expect = 0.093
 Identities = 10/16 (62%), Positives = 11/16 (68%)

Query: 32  SLGCIAYEIHMGHPPF 47
           SLGC+ YE   G PPF
Sbjct: 183 SLGCMLYEFLCGFPPF 198


>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 3.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK3
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK3 (also known as beta-adrenergic
           receptor kinase 2) is widely expressed in many tissues.
           GRK3-deficient mice show a lack of olfactory receptor
           desensitization and altered regulation of the M2
           muscarinic airway. GRK3 is involved in modulating the
           cholinergic response of airway smooth muscles. It also
           plays a role in dopamine receptor regulation. GRK3
           promoter polymorphisms may be associated with bipolar
           disorder.
          Length = 279

 Score = 29.6 bits (66), Expect = 0.11
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 32  SLGCIAYEIHMGHPPF---KTVSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
           SLGC+ +++  GH PF   KT     + R+  T +V  P   S   K L++
Sbjct: 181 SLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDSFSPELKSLLE 231


>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR
           kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Rho-associated
           coiled-coil containing protein kinase (ROCK) and Nuclear
           Dbf2-Related (NDR)-like kinase subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK- and NDR-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include ROCK and
           ROCK-like proteins such as DMPK, MRCK, and CRIK, as well
           as NDR and NDR-like proteins such as LATS, CBK1 and
           Sid2p. ROCK and CRIK are effectors of the small GTPase
           Rho, while MRCK is an effector of the small GTPase
           Cdc42. NDR and NDR-like kinases contain an N-terminal
           regulatory (NTR) domain and an insert within the
           catalytic domain that contains an auto-inhibitory
           sequence. Proteins in this subfamily are involved in
           regulating many cellular functions including
           contraction, motility, division, proliferation,
           apoptosis, morphogenesis, and cytokinesis.
          Length = 350

 Score = 29.2 bits (66), Expect = 0.17
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 8/53 (15%)

Query: 32  SLGCIAYEIHMGHPPF--KTVSI--LHLIRLLKTQDVTFPSQ--VSETYKDLV 78
           SLG I YE+  G PPF   T+      +I   ++  + FP    VS    DL+
Sbjct: 215 SLGVILYEMLYGFPPFYSDTLQETYNKIINWKES--LRFPPDPPVSPEAIDLI 265


>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), cAMP-dependent protein kinase (PKA) subfamily,
           PRKX-like kinases, catalytic (c) subunit. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PKA
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include human PRKX (X
           chromosome-encoded protein kinase), Drosophila DC2, and
           similar proteins. PRKX is present in many tissues
           including fetal and adult brain, kidney, and lung. The
           PRKX gene is located in the Xp22.3 subregion and has a
           homolog called PRKY on the Y chromosome. An abnormal
           interchange between PRKX aand PRKY leads to the sex
           reversal disorder of XX males and XY females. PRKX is
           implicated in granulocyte/macrophage lineage
           differentiation, renal cell epithelial migration, and
           tubular morphogenesis in the developing kidney.
          Length = 291

 Score = 28.9 bits (65), Expect = 0.18
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 3/63 (4%)

Query: 17  QRNWHKRAVTSVIIGSLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKD 76
           Q   H +AV      +LG + YE+ +G+PPF   +   +   +    + FP  +    KD
Sbjct: 171 QSKGHNKAVD---WWALGILIYEMLVGYPPFFDDNPFGIYEKILAGKLEFPRHLDLYAKD 227

Query: 77  LVK 79
           L+K
Sbjct: 228 LIK 230


>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy
           protein kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Myotonic Dystrophy
           protein kinase (DMPK)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The DMPK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The DMPK-like subfamily is composed of DMPK
           and DMPK-related cell division control protein 42
           (Cdc42) binding kinase (MRCK). Three isoforms of MRCK
           are known, named alpha, beta and gamma. The DMPK gene is
           implicated in myotonic dystrophy 1 (DM1), an inherited
           multisystemic disorder with symptoms that include muscle
           hyperexcitability, progressive muscle weakness and
           wasting, cataract development, testicular atrophy, and
           cardiac conduction defects. The genetic basis for DM1 is
           the mutational expansion of a CTG repeat in the 3'-UTR
           of DMPK. DMPK is expressed in skeletal and cardiac
           muscles, and in central nervous tissues. The functional
           role of DMPK is not fully understood. It may play a role
           in the signal transduction and homeostasis of calcium.
           MRCK is activated via interaction with the small GTPase
           Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent
           cell motility. MRCKgamma is expressed in heart and
           skeletal muscles, unlike MRCKalpha and MRCKbeta, which
           are expressed ubiquitously.
          Length = 331

 Score = 29.0 bits (65), Expect = 0.18
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 5/53 (9%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLI-RLLKTQD-VTFPSQ---VSETYKDLVK 79
           SLG   YE+  G  PF   S++    +++  ++   FP     VSE  KDL++
Sbjct: 193 SLGVCMYEMLYGETPFYAESLVETYGKIMNHKEHFQFPPDVTDVSEEAKDLIR 245


>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 3.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 3, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK3 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK3 is
           highly expressed in the brain. It is implicated in
           neuronal plasticity, synapse formation, dendritic spine
           morphogenesis, cell cycle progression, neuronal
           migration, and apoptosis. Inactivating mutations in the
           PAK3 gene cause X-linked non-syndromic mental
           retardation, the severity of which depends on the site
           of the mutation.
          Length = 297

 Score = 28.9 bits (64), Expect = 0.19
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 28  VIIGSLGCIAYEIHMGHPPF---KTVSILHLIRLLKTQDVTFPSQVSETYKDLV 78
           V I SLG +A E+  G PP+     +  L+LI    T ++  P ++S  ++D +
Sbjct: 196 VDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFL 249


>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 4.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK4
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK4 has a limited tissue distribution. It
           is mainly found in the testis, but is also present in
           the cerebellum and kidney. It is expressed as multiple
           splice variants with different domain architectures. It
           is post-translationally palmitoylated and localized in
           the membrane. GRK4 polymorphisms are associated with
           hypertension and salt sensitivity, as they cause
           hyperphosphorylation, desensitization, and
           internalization of the dopamine 1 (D1) receptor while
           increasing the expression of the angiotensin II type 1
           receptor. GRK4 plays a crucial role in the D1 receptor
           regulation of sodium excretion and blood pressure.
          Length = 285

 Score = 28.8 bits (64), Expect = 0.19
 Identities = 17/80 (21%), Positives = 32/80 (40%), Gaps = 14/80 (17%)

Query: 4   LAQHAVTSVEYCYQRNWHKRAVTSVIIGSLGCIAYEIHMGHPPFKT----VSILHLIRLL 59
           +A   + + +Y +  +W            LGC+ YE+  G  PF+     V    + R +
Sbjct: 168 MAPEVINNEKYTFSPDWW----------GLGCLIYEMIQGQSPFRKRKERVKREEVDRRV 217

Query: 60  KTQDVTFPSQVSETYKDLVK 79
           K     +  + SE  K + +
Sbjct: 218 KEDQEEYSEKFSEDAKSICR 237


>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C theta.
           Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), theta isoform, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta
           is selectively expressed in T-cells and plays an
           important and non-redundant role in several aspects of
           T-cell biology. Although T-cells also express other PKC
           isoforms, PKC-theta is unique in that upon antigen
           stimulation, it is translocated to the plasma membrane
           at the immunological synapse, where it mediates signals
           essential for T-cell activation. It is essential for
           TCR-induced proliferation, cytokine production, T-cell
           survival, and the differentiation and effector function
           of T-helper (Th) cells, particularly Th2 and Th17.
           PKC-theta is being developed as a therapeutic target for
           Th2-mediated allergic inflammation and Th17-mediated
           autoimmune diseases.
          Length = 316

 Score = 28.8 bits (64), Expect = 0.20
 Identities = 14/53 (26%), Positives = 26/53 (49%)

Query: 26  TSVIIGSLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLV 78
           TSV   S G + YE+ +G  PF       L + ++  +  +P  ++   KD++
Sbjct: 175 TSVDWWSFGVLLYEMLIGQSPFHGHDEEELFQSIRMDNPCYPRWLTREAKDIL 227


>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 1.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 1, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK1 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK1 is
           important in the regulation of many cellular processes
           including cytoskeletal dynamics, cell motility, growth,
           and proliferation. Although PAK1 has been regarded
           mainly as a cytosolic protein, recent reports indicate
           that PAK1 also exists in significant amounts in the
           nucleus, where it is involved in transcription
           modulation and in cell cycle regulatory events. PAK1 is
           also involved in transformation and tumorigenesis. Its
           overexpression, hyperactivation and increased nuclear
           accumulation is correlated to breast cancer invasiveness
           and progression. Nuclear accumulation is also linked to
           tamoxifen resistance in breast cancer cells.
          Length = 296

 Score = 28.9 bits (64), Expect = 0.21
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 28  VIIGSLGCIAYEIHMGHPPF---KTVSILHLIRLLKTQDVTFPSQVSETYKDLV 78
           V I SLG +A E+  G PP+     +  L+LI    T ++  P ++S  ++D +
Sbjct: 197 VDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFL 250


>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like
           Protein Serine/Threonine Kinases.  Serine/Threonine
           Kinases (STKs), Microtubule-associated serine/threonine
           (MAST) kinase subfamily, fungal Rim15-like kinases,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAST kinase
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include Saccharomyces
           cerevisiae Rim15, Schizosaccharomyces pombe cek1, and
           similar fungal proteins. They contain a central
           catalytic domain, which contains an insert relative to
           MAST kinases. In addition, Rim15 contains a C-terminal
           signal receiver (REC) domain while cek1 contains an
           N-terminal PAS domain. Rim15 (or Rim15p) functions as a
           regulator of meiosis. It acts as a downstream effector
           of PKA and regulates entry into stationary phase (G0).
           Thus, it plays a crucial role in regulating yeast
           proliferation, differentiation, and aging. Cek1 may
           facilitate progression of mitotic anaphase.
          Length = 260

 Score = 28.6 bits (64), Expect = 0.22
 Identities = 9/16 (56%), Positives = 12/16 (75%)

Query: 32  SLGCIAYEIHMGHPPF 47
           SLGC+ +E   G+PPF
Sbjct: 178 SLGCVIFEFLFGYPPF 193


>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 3.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek3 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek3 is primarily
           localized in the cytoplasm and shows no cell
           cycle-dependent changes in its activity. It is present
           in the axons of neurons and affects morphogenesis and
           polarity through its regulation of microtubule
           acetylation. Nek3 modulates the signaling of the
           prolactin receptor through its activation of Vav2 and
           contributes to prolactin-mediated motility of breast
           cancer cells.
          Length = 255

 Score = 28.8 bits (64), Expect = 0.24
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 30  IGSLGCIAYEIHMGHPPFKTVSILHLI-RLLKTQDVTFPSQVSETYKDLVK 79
           I SLGCI YE+     PF+  S  +LI ++ +      PS  S   + L+K
Sbjct: 183 IWSLGCILYELCTLKHPFQANSWKNLILKVCQGSYKPLPSHYSYELRSLIK 233


>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 2.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 2, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK2 belongs to group I. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). PAK2 plays a
           role in pro-apoptotic signaling. It is cleaved and
           activated by caspases leading to morphological changes
           during apoptosis. PAK2 is also activated in response to
           a variety of stresses including DNA damage,
           hyperosmolarity, serum starvation, and contact
           inhibition, and may play a role in coordinating the
           stress response. PAK2 also contributes to cancer cell
           invasion through a mechanism distinct from that of PAK1.
          Length = 296

 Score = 28.5 bits (63), Expect = 0.26
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 28  VIIGSLGCIAYEIHMGHPPF---KTVSILHLIRLLKTQDVTFPSQVSETYKDLV 78
           V I SLG +A E+  G PP+     +  L+LI    T ++  P ++S  ++D +
Sbjct: 196 VDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFL 249


>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family.  Emg1 and Nop14 are novel
           proteins whose interaction is required for the
           maturation of the 18S rRNA and for 40S ribosome
           production.
          Length = 809

 Score = 28.4 bits (64), Expect = 0.26
 Identities = 10/36 (27%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 44  HPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
            PPF+ ++  +LIR L +   ++P  +SE ++ +++
Sbjct: 459 PPPFELLN--NLIRHLHSLAQSYPEALSEAFRAVIR 492


>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C eta.
           Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), eta isoform, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta
           is predominantly expressed in squamous epithelia, where
           it plays a crucial role in the signaling of cell-type
           specific differentiation. It is also expressed in pro-B
           cells and early-stage thymocytes, and acts as a key
           regulator in early B-cell development. PKC-eta increases
           glioblastoma multiforme (GBM) proliferation and
           resistance to radiation, and is being developed as a
           therapeutic target for the management of GBM.
          Length = 320

 Score = 28.3 bits (63), Expect = 0.29
 Identities = 13/48 (27%), Positives = 27/48 (56%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
           ++G + YE+  GH PF+  +   L   +   +V +P+ +S+   D++K
Sbjct: 181 AMGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLSQDAVDILK 228


>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yank1.  Serine/Threonine
           Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Yank1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily
           contains uncharacterized STKs with similarity to the
           human protein designated Yank1 or STK32A.
          Length = 258

 Score = 28.4 bits (64), Expect = 0.29
 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 3/51 (5%)

Query: 32  SLGCIAYEIHMGHPPFKTVS---ILHLIRLLKTQDVTFPSQVSETYKDLVK 79
           SLG  AYE   G  P++  S      +    +T DV +P+  S    D + 
Sbjct: 184 SLGVTAYECLRGKRPYRGHSRTIRDQIRAKQETADVLYPATWSTEAIDAIN 234


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-Activated Protein
           Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
           mitogen-activated protein kinase (MAPK) kinase kinase
           (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called
           MAP/ERK kinase kinases (MEKKs) in some cases. They
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           This subfamily is composed of the Apoptosis
           Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or
           MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant
           and fungal MAPKKKs. Also included in this subfamily are
           the cell division control proteins Schizosaccharomyces
           pombe Cdc7 and Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 28.3 bits (64), Expect = 0.31
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 3/50 (6%)

Query: 30  IGSLGCIAYEIHMGHPPF--KTVSILHLIRLLKTQDVT-FPSQVSETYKD 76
           I SLGC   E+  G PP+      +  L ++  + +    P  +SE  KD
Sbjct: 186 IWSLGCTVIEMATGKPPWSELGNPMAALYKIGSSGEPPEIPEHLSEEAKD 235


>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional.
          Length = 267

 Score = 28.3 bits (64), Expect = 0.34
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 4/51 (7%)

Query: 33  LGCIAYEIHMGHPPFKTVS--ILHLIRLLKTQ--DVTFPSQVSETYKDLVK 79
           +G + YE+  G  PFK      L L  LLK Q   + F   VS+   D V+
Sbjct: 192 VGVLTYELLTGKHPFKEDEDEELDLESLLKRQQKKLPFIKNVSKNANDFVQ 242


>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B alpha.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, alpha (or Akt1) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-alpha is
           predominantly expressed in endothelial cells. It is
           critical for the regulation of angiogenesis and the
           maintenance of vascular integrity. It also plays a role
           in adipocyte differentiation. Mice deficient in
           PKB-alpha exhibit perinatal morbidity, growth
           retardation, reduction in body weight accompanied by
           reduced sizes of multiple organs, and enhanced apoptosis
           in some cell types. PKB-alpha activity has been reported
           to be frequently elevated in breast and prostate
           cancers. In some cancer cells, PKB-alpha may act as a
           suppressor of metastasis.
          Length = 325

 Score = 28.1 bits (62), Expect = 0.35
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 33  LGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLV 78
           LG + YE+  G  PF       L  L+  +++ FP  +S   K L+
Sbjct: 182 LGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLSPEAKSLL 227


>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the
           Serine/Threonine Kinase, p38gamma Mitogen-Activated
           Protein Kinase.  Serine/Threonine Kinases (STKs),
           p38gamma subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           p38gamma subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. p38 kinases are mitogen-activated protein
           kinases (MAPKs), serving as important mediators of
           cellular responses to extracellular signals. They are
           activated by the MAPK kinases MKK3 and MKK6, which in
           turn are activated by upstream MAPK kinase kinases
           including TAK1, ASK1, and MLK3, in response to cellular
           stresses or inflammatory cytokines. Vertebrates contain
           four isoforms of p38, named alpha, beta, gamma, and
           delta. p38gamma, also called MAPK12, is predominantly
           expressed in skeletal muscle. Unlike p38alpha and
           p38beta, p38gamma is insensitive to pyridinylimidazoles.
           It displays an antagonizing function compared to
           p38alpha. p38gamma inhibits, while p38alpha stimulates,
           c-Jun phosphorylation and AP-1 mediated transcription.
           p38gamma also plays a role in the signaling between Ras
           and the estrogen receptor and has been implicated to
           increase cell invasion and breast cancer progression. In
           Xenopus, p38gamma is critical in the meiotic maturation
           of oocytes.
          Length = 343

 Score = 28.0 bits (62), Expect = 0.38
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 19  NWHKRAVTSVIIGSLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVT 65
           NW      +V I S+GCI  E+  G P FK     HL +L++   VT
Sbjct: 189 NW-MHYTQTVDIWSVGCIMAEMLTGKPLFKGHD--HLDQLMEIMKVT 232


>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein
           Serine/Threonine Kinase, DMPK-related cell division
           control protein 42 binding kinase alpha.
           Serine/Threonine Kinases (STKs), DMPK-like subfamily,
           DMPK-related cell division control protein 42 (Cdc42)
           binding kinase (MRCK) alpha isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The DMPK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MRCK is activated via interaction with the
           small GTPase Cdc42. MRCK/Cdc42 signaling mediates
           myosin-dependent cell motility. MRCKalpha is expressed
           ubiquitously in many tissues. It plays a role in the
           regulation of peripheral actin reorganization and
           neurite outgrowth. It may also play a role in the
           transferrin iron uptake pathway.
          Length = 332

 Score = 28.1 bits (62), Expect = 0.40
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 5/53 (9%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLI-RLLKTQD-VTFPSQ---VSETYKDLVK 79
           SLG   YE+  G  PF   S++    +++  ++   FP+Q   VSE  KDL++
Sbjct: 193 SLGVCMYEMLYGETPFYAESLVETYGKIMNHKERFQFPAQVTDVSEDAKDLIR 245


>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like
           protein kinase 3-like Protein Serine/Threonine Kinases. 
           Serine/threonine kinases (STKs), mammalian Ste20-like
           protein kinase 3 (MST3)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST3-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST3, MST4,
           STK25, Schizosaccharomyces pombe Nak1 and Sid1,
           Saccharomyces cerevisiae sporulation-specific protein 1
           (SPS1), and related proteins. Nak1 is required by
           fission yeast for polarizing the tips of actin
           cytoskeleton and is involved in cell growth, cell
           separation, cell morphology and cell-cycle progression.
           Sid1 is a component in the septation initiation network
           (SIN) signaling pathway, and plays a role in
           cytokinesis. SPS1 plays a role in regulating proteins
           required for spore wall formation. MST4 plays a role in
           mitogen-activated protein kinase (MAPK) signaling during
           cytoskeletal rearrangement, morphogenesis, and
           apoptosis. MST3 phosphorylates the STK NDR and may play
           a role in cell cycle progression and cell morphology.
           STK25 may play a role in the regulation of cell
           migration and polarization.
          Length = 274

 Score = 27.6 bits (62), Expect = 0.48
 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 3/30 (10%)

Query: 30  IGSLGCIAYEIHMGHPPFKTVSILHLIRLL 59
           I SLG  A E+  G PP    S LH +R+L
Sbjct: 181 IWSLGITAIELAKGEPPL---SDLHPMRVL 207


>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
           protein Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase (CDK)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKs are partly
           regulated by their subcellular localization, which
           defines substrate phosphorylation and the resulting
           specific function. CDK1, CDK2, CDK4, and CDK6 have
           well-defined functions in the cell cycle, such as the
           regulation of the early G1 phase by CDK4 or CDK6, the
           G1/S phase transition by CDK2, or the entry of mitosis
           by CDK1. They also exhibit overlapping cyclin
           specificity and functions in certain conditions.
           Knockout mice with a single CDK deleted remain viable
           with specific phenotypes, showing that some CDKs can
           compensate for each other. For example, CDK4 can
           compensate for the loss of CDK6, however, double
           knockout mice with both CDK4 and CDK6 deleted die in
           utero. CDK8 and CDK9 are mainly involved in
           transcription while CDK5 is implicated in neuronal
           function. CDK7 plays essential roles in both the cell
           cycle as a CDK-Activating Kinase (CAK) and in
           transcription as a component of the general
           transcription factor TFIIH.
          Length = 282

 Score = 27.8 bits (63), Expect = 0.49
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 26  TSVIIGSLGCIAYEIHMGHPPFKTVSILHLI 56
           T+V I S+GCI  E+  G P F   S +  +
Sbjct: 178 TAVDIWSVGCIFAEMITGKPLFPGDSEIDQL 208


>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 3.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK3 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK3 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates the MAPK kinase MEK5 (or
           MKK5), which in turn phosphorylates and activates
           extracellular signal-regulated kinase 5 (ERK5). The ERK5
           cascade plays roles in promoting cell proliferation,
           differentiation, neuronal survival, and neuroprotection.
           MEKK3 plays an essential role in embryonic angiogenesis
           and early heart development. In addition, MEKK3 is
           involved in interleukin-1 receptor and Toll-like
           receptor 4 signaling. It is also a specific regulator of
           the proinflammatory cytokines IL-6 and GM-CSF in some
           immune cells. MEKK3 also regulates calcineurin, which
           plays a critical role in T cell activation, apoptosis,
           skeletal myocyte differentiation, and cardiac
           hypertrophy.
          Length = 266

 Score = 27.7 bits (61), Expect = 0.55
 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 2/50 (4%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVT--FPSQVSETYKDLVK 79
           SLGC   E+    PP+     +  I  + TQ      PS +SE  +D + 
Sbjct: 194 SLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHARDFLG 243


>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 6.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK6
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK6 is widely expressed in many tissues.
           t is expressed as multiple splice variants with
           different domain architectures. It is
           post-translationally palmitoylated and localized in the
           membrane. GRK6 plays important roles in the regulation
           of dopamine, M3 muscarinic, opioid, and chemokine
           receptor signaling. It also plays maladaptive roles in
           addiction and Parkinson's disease. GRK6-deficient mice
           exhibit altered dopamine receptor regulation, decreased
           lymphocyte chemotaxis, and increased acute inflammation
           and neutrophil chemotaxis.
          Length = 285

 Score = 27.7 bits (61), Expect = 0.56
 Identities = 19/80 (23%), Positives = 32/80 (40%), Gaps = 14/80 (17%)

Query: 4   LAQHAVTSVEYCYQRNWHKRAVTSVIIGSLGCIAYEIHMGHPPF----KTVSILHLIRLL 59
           +A   V +  Y +  +W           +LGC+ YE+  G  PF    K +    + RL+
Sbjct: 168 MAPEVVKNERYTFSPDWW----------ALGCLLYEMIAGQSPFQQRKKKIKREEVERLV 217

Query: 60  KTQDVTFPSQVSETYKDLVK 79
           K     +  + S   + L K
Sbjct: 218 KEVQEEYSEKFSPDARSLCK 237


>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine
           Kinase, PCTAIRE-3 kinase.  Serine/Threonine Kinases
           (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PCTAIRE-3 subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. PCTAIRE-3 shares sequence
           similarity with Cyclin-Dependent Kinases (CDKs), which
           belong to a large family of STKs that are regulated by
           their cognate cyclins. Together, CDKs and cyclins are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. PCTAIRE-3 shows a
           restricted pattern of expression and is present in
           brain, kidney, and intestine. It is elevated in
           Alzheimer's disease (AD) and has been shown to associate
           with paired helical filaments (PHFs) and stimulate Tau
           phosphorylation. As AD progresses, phosphorylated Tau
           aggregates and forms PHFs, which leads to the formation
           of neurofibrillary tangles (NFTs). In human glioma
           cells, PCTAIRE-3 induces cell cycle arrest and cell
           death.
          Length = 288

 Score = 27.7 bits (61), Expect = 0.60
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 4/40 (10%)

Query: 26  TSVIIGSLGCIAYEIHMGHPPFKTVSI---LHLI-RLLKT 61
           T + +  +GCI YE+  G P F   ++   LHLI RLL T
Sbjct: 183 TPIDMWGVGCILYEMATGRPMFPGSTVKEELHLIFRLLGT 222


>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein
           Serine/Threonine Kinase, Group I p21-activated kinase.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) subfamily, Group I, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PAK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs are
           implicated in the regulation of many cellular processes
           including growth factor receptor-mediated proliferation,
           cell polarity, cell motility, cell death and survival,
           and actin cytoskeleton organization. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs, also called conventional PAKs, include
           PAK1, PAK2, and PAK3. Group I PAKs contain a PBD
           (p21-binding domain) overlapping with an AID
           (autoinhibitory domain), a C-terminal catalytic domain,
           SH3 binding sites and a non-classical SH3 binding site
           for PIX (PAK-interacting exchange factor). They interact
           with the SH3 domain containing proteins Nck, Grb2 and
           PIX. Binding of group I PAKs to activated GTPases leads
           to conformational changes that destabilize the AID,
           allowing autophosphorylation and full activation of the
           kinase domain. Known group I PAK substrates include
           MLCK, Bad, Raf, MEK1, LIMK, Merlin, Vimentin, Myc,
           Stat5a, and Aurora A, among others.
          Length = 293

 Score = 27.6 bits (61), Expect = 0.65
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 28  VIIGSLGCIAYEIHMGHPPF---KTVSILHLIRLLKTQDVTFPSQVSETYKDLV 78
           V I SLG +A E+  G PP+     +  L+LI    T ++  P ++S  ++D +
Sbjct: 196 VDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFL 249


>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C epsilon.
            Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), epsilon isoform, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta.
           PKC-epsilon has been shown to behave as an oncoprotein.
           Its overexpression contributes to neoplastic
           transformation depending on the cell type. It
           contributes to oncogenesis by inducing disordered cell
           growth and inhibiting cell death. It also plays a role
           in tumor invasion and metastasis. PKC-epsilon has also
           been found to confer cardioprotection against ischemia
           and reperfusion-mediated damage. Other cellular
           functions include the regulation of gene expression,
           cell adhesion, and cell motility.
          Length = 321

 Score = 27.5 bits (61), Expect = 0.66
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 14/60 (23%)

Query: 27  SVIIGSLGCIAYEIHMGHPPFKT-------VSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
           SV   +LG + YE+  G PPF+         SILH        DV +P  +S+    ++K
Sbjct: 176 SVDWWALGVLMYEMMAGQPPFEADNEDDLFESILH-------DDVLYPVWLSKEAVSILK 228


>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C.
           Serine/Threonine Kinases (STKs), Classical (or
           Conventional) Protein Kinase C (cPKC) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. cPKCs contain a
           calcium-binding C2 region in their regulatory domain.
           There are four cPKC isoforms, named alpha, betaI,
           betaII, and gamma. cPKCs are potent kinases for
           histones, myelin basic protein, and protamine. PKC-gamma
           is mainly expressed in neuronal tissues. It plays a role
           in protection from ischemia.
          Length = 324

 Score = 27.4 bits (61), Expect = 0.66
 Identities = 12/48 (25%), Positives = 23/48 (47%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
           + G + YE+  G PPF       L + +   +V++P  +S+    + K
Sbjct: 186 AFGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICK 233


>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
           Kinase, p21-activated kinase.  Serine/threonine kinases
           (STKs), p21-activated kinase (PAK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PAK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PAKs are Rho
           family GTPase-regulated kinases that serve as important
           mediators in the function of Cdc42 (cell division cycle
           42) and Rac. PAKs are implicated in the regulation of
           many cellular processes including growth factor
           receptor-mediated proliferation, cell polarity, cell
           motility, cell death and survival, and actin
           cytoskeleton organization. PAK deregulation is
           associated with tumor development. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs contain a PBD (p21-binding domain)
           overlapping with an AID (autoinhibitory domain), a
           C-terminal catalytic domain, SH3 binding sites and a
           non-classical SH3 binding site for PIX (PAK-interacting
           exchange factor). Group II PAKs contain a PBD and a
           catalytic domain, but lack other motifs found in group I
           PAKs. Since group II PAKs do not contain an obvious AID,
           they may be regulated differently from group I PAKs.
           Group I PAKs interact with the SH3 containing proteins
           Nck, Grb2 and PIX; no such binding has been demonstrated
           for group II PAKs.
          Length = 286

 Score = 27.2 bits (61), Expect = 0.77
 Identities = 16/57 (28%), Positives = 23/57 (40%), Gaps = 3/57 (5%)

Query: 26  TSVIIGSLGCIAYEIHMGHPP---FKTVSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
             V I SLG +  E+  G PP      +  L LI       +  P + S  +KD + 
Sbjct: 195 PKVDIWSLGIMCIEMAEGEPPYLREPPLRALFLITTKGIPPLKNPEKWSPEFKDFLN 251


>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B beta.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, beta (or Akt2) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-beta is the
           predominant PKB isoform expressed in insulin-responsive
           tissues. It plays a critical role in the regulation of
           glucose homeostasis. It is also implicated in muscle
           cell differentiation. Mice deficient in PKB-beta display
           normal growth weights but exhibit severe insulin
           resistance and diabetes, accompanied by lipoatrophy and
           B-cell failure.
          Length = 323

 Score = 27.3 bits (60), Expect = 0.80
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 33  LGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLV 78
           LG + YE+  G  PF       L  L+  +++ FP  +S   K L+
Sbjct: 181 LGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLL 226


>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein
           Serine/Threonine Kinase, DMPK-related cell division
           control protein 42 binding kinase beta.
           Serine/Threonine Kinases (STKs), DMPK-like subfamily,
           DMPK-related cell division control protein 42 (Cdc42)
           binding kinase (MRCK) beta isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The DMPK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MRCK is activated via interaction with the
           small GTPase Cdc42. MRCK/Cdc42 signaling mediates
           myosin-dependent cell motility. MRCKbeta is expressed
           ubiquitously in many tissues.
          Length = 331

 Score = 26.9 bits (59), Expect = 0.94
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 5/53 (9%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKTQD--VTFPSQ---VSETYKDLVK 79
           SLG   YE+  G  PF   S++     +   +    FPS    VSE  KDL++
Sbjct: 193 SLGVCMYEMLYGETPFYAESLVETYGKIMNHEERFQFPSHITDVSEEAKDLIQ 245


>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein
           Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2
           and similar domains.  Serine/Threonine Kinases (STKs),
           Chlamydomonas reinhardtii FA2-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Chlamydomonas
           reinhardtii FA2-like subfamily belongs to the
           (NIMA)-related kinase (Nek) family. The Nek family
           includes seven different Chlamydomonas Neks (CNKs 1-6
           and Fa2). This subfamily includes FA2 and CNK4.  The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase.  Chlamydomonas reinhardtii FA2 was discovered
           in a genetic screen for deflagellation-defective
           mutants. It is essential for
           basal-body/centriole-associated microtubule severing,
           and plays a role in cell cycle progression. No cellular
           function has yet been ascribed to CNK4.
          Length = 256

 Score = 26.7 bits (59), Expect = 1.0
 Identities = 9/28 (32%), Positives = 13/28 (46%)

Query: 30  IGSLGCIAYEIHMGHPPFKTVSILHLIR 57
           + +LG + YE   G  PF   +   LI 
Sbjct: 184 VWALGVVLYECCTGKHPFDANNQGALIL 211


>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional.
          Length = 440

 Score = 26.9 bits (59), Expect = 1.1
 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 26  TSVIIGSLGCIAYEIHMGHPPFK-TVSILHLIRLLK 60
           T + + SLGCI  E+ +G+P F    S+  L+R+++
Sbjct: 250 THIDLWSLGCIIAEMILGYPIFSGQSSVDQLVRIIQ 285


>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein
           Serine/Threonine Kinase, 70 kDa ribosomal protein S6
           kinase.  Serine/Threonine Kinases (STKs), 70 kDa
           ribosomal protein S6 kinase (p70S6K) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The p70S6K subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. p70S6K (or S6K)
           contains only one catalytic kinase domain, unlike p90
           ribosomal S6 kinases (RSKs). It acts as a downstream
           effector of the STK mTOR (mammalian Target of Rapamycin)
           and plays a role in the regulation of the translation
           machinery during protein synthesis. p70S6K also plays a
           pivotal role in regulating cell size and glucose
           homeostasis. Its targets include S6, the translation
           initiation factor eIF3, and the insulin receptor
           substrate IRS-1, among others. Mammals contain two
           isoforms of p70S6K, named S6K1 and S6K2 (or S6K-beta).
          Length = 323

 Score = 26.7 bits (59), Expect = 1.2
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 15/69 (21%)

Query: 17  QRNWHKRAVTSVIIGSLGCIAYEIHMGHPPF------KTVSILHLIRLLKTQDVTFPSQV 70
            R+ H +AV      SLG + Y++  G PPF      KT+      ++LK + +  P  +
Sbjct: 173 MRSGHGKAVD---WWSLGALMYDMLTGAPPFTAENRKKTID-----KILKGK-LNLPPYL 223

Query: 71  SETYKDLVK 79
           +   +DL+K
Sbjct: 224 TPEARDLLK 232


>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine
           Kinase, Fungal Cyclin-Dependent protein Kinase Pho85.
           Serine/Threonine Kinases (STKs), Pho85 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Pho85 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Pho85 is a
           multifunctional Cyclin-Dependent protein Kinase (CDK) in
           yeast. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. Pho85 is regulated
           by 10 different cyclins (Pcls) and plays a role in G1
           progression, cell polarity, phosphate and glycogen
           metabolism, gene expression, and in signaling changes in
           the environment. It is not essential for yeast viability
           and is the functional homolog of mammalian CDK5, which
           plays a role in central nervous system development.
          Length = 284

 Score = 26.7 bits (59), Expect = 1.3
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 5/48 (10%)

Query: 26  TSVIIGSLGCIAYEIHMGHPPFKTVS----ILHLIRLLKT-QDVTFPS 68
           TS+ I S+GCI  E+  G P F   +    +L + R++ T  + T+P 
Sbjct: 180 TSIDIWSVGCIMAEMITGRPLFPGTNNEDQLLKIFRIMGTPTESTWPG 227


>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine
           Kinase, PCTAIRE-2 kinase.  Serine/Threonine Kinases
           (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PCTAIRE-2 subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. PCTAIRE-2 shares sequence
           similarity with Cyclin-Dependent Kinases (CDKs), which
           belong to a large family of STKs that are regulated by
           their cognate cyclins. Together, CDKs and cyclins are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. PCTAIRE-2 is
           specifically expressed in neurons in the central nervous
           system, mainly in terminally differentiated neurons. It
           associates with Trap (Tudor repeat associator with
           PCTAIRE-2) and could play a role in regulating
           mitochondrial function in neurons.
          Length = 309

 Score = 26.5 bits (58), Expect = 1.3
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 4/40 (10%)

Query: 26  TSVIIGSLGCIAYEIHMGHPPFKTVSI---LHLI-RLLKT 61
           T + +  +GCI +E+  G P F   ++   LHLI RLL T
Sbjct: 184 TQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGT 223


>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled
           Receptor Kinase 4-like Protein Serine/Threonine Kinases.
            Serine/Threonine Kinases (STKs), G protein-coupled
           Receptor Kinase (GRK) subfamily, GRK4-like group,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The GRK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. GRKs
           phosphorylate and regulate G protein-coupled receptors
           (GPCRs), the largest superfamily of cell surface
           receptors which regulate some part of nearly all
           physiological functions. Phosphorylated GPCRs bind to
           arrestins, which prevents further G protein signaling
           despite the presence of activating ligand. There are
           seven types of GRKs, named GRK1 to GRK7. Members of the
           GRK4-like group include GRK4, GRK5, GRK6, and similar
           GRKs. GRKs in this group contain an N-terminal RGS
           homology (RH) domain and a catalytic domain, but lack a
           G protein betagamma-subunit binding domain. They are
           localized to the plasma membrane through
           post-translational lipid modification or direct binding
           to PIP2.
          Length = 285

 Score = 26.3 bits (58), Expect = 1.4
 Identities = 8/16 (50%), Positives = 11/16 (68%)

Query: 33  LGCIAYEIHMGHPPFK 48
           LGC+ YE+  G  PF+
Sbjct: 187 LGCLIYEMIEGKSPFR 202


>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C
           beta.  Serine/Threonine Kinases (STKs), Classical
           Protein Kinase C (cPKC) subfamily, beta isoforms,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. There are four
           cPKC isoforms, named alpha, betaI, betaII, and gamma.
           The PKC beta isoforms (I and II), generated by
           alternative splicing of a single gene, are
           preferentially activated by hyperglycemia-induced DAG in
           retinal tissues. This is implicated in diabetic
           microangiopathy such as ischemia, neovascularization,
           and abnormal vasodilator function. PKC-beta also plays
           an important role in VEGF signaling. In addition,
           glucose regulates proliferation in retinal endothelial
           cells via PKC-betaI. PKC-beta is also being explored as
           a therapeutic target in cancer. It contributes to tumor
           formation and is involved in the tumor host mechanisms
           of inflammation and angiogenesis.
          Length = 323

 Score = 26.5 bits (58), Expect = 1.5
 Identities = 10/41 (24%), Positives = 20/41 (48%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSE 72
           + G + YE+  G  PF+      L + +   +V +P  +S+
Sbjct: 186 AFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSK 226


>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 10.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 10 (Nek10)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Nek10 subfamily is one of a family of 11 different Neks
           (Nek1-11) that are involved in cell cycle control. The
           Nek family is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. No function has yet been ascribed to Nek10.
           The gene encoding Nek10 is a putative causative gene for
           breast cancer; it is located within a breast cancer
           susceptibility loci on chromosome 3p24.
          Length = 269

 Score = 26.3 bits (58), Expect = 1.6
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 30  IGSLGCIAYEIHMGHPPFKTVSILHL 55
           + + GCI Y++    PPF + ++L L
Sbjct: 196 VWAFGCILYQMCTLQPPFYSTNMLSL 221


>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional.
          Length = 478

 Score = 26.5 bits (58), Expect = 1.6
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 22  KRAVTSVIIGSLGCIAYEIHMGHPPFKTVSILHLI-RLLKTQDVTFPSQVSETYKDLV 78
           KR      + SLG I YE+   H PFK  S   ++ ++L  +   FP  VS   K L+
Sbjct: 246 KRYSKKADMWSLGVILYELLTLHRPFKGPSQREIMQQVLYGKYDPFPCPVSSGMKALL 303


>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen and stress-activated
           kinase.  Serine/Threonine Kinases (STKs), Mitogen and
           stress-activated kinase (MSK) subfamily, N-terminal
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MSK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MSKs contain an
           N-terminal kinase domain (NTD) from the AGC family and a
           C-terminal kinase domain (CTD) from the CAMK family,
           similar to 90 kDa ribosomal protein S6 kinases (RSKs).
           MSKs are activated by two major signaling cascades, the
           Ras-MAPK and p38 stress kinase pathways, in response to
           various stimuli such as growth factors, hormones,
           neurotransmitters, cellular stress, and pro-inflammatory
           cytokines. This triggers phosphorylation in the
           activation loop (A-loop) of the CTD of MSK. The active
           CTD phosphorylates the hydrophobic motif (HM) in the
           C-terminal extension of NTD, which facilitates the
           phosphorylation of the A-loop and activates the NTD,
           which in turn phosphorylates downstream targets. MSKs
           are predominantly nuclear proteins. They are widely
           expressed in many tissues including heart, brain, lung,
           liver, kidney, and pancreas. There are two isoforms of
           MSK, called MSK1 and MSK2.
          Length = 288

 Score = 26.3 bits (58), Expect = 1.7
 Identities = 13/51 (25%), Positives = 21/51 (41%), Gaps = 4/51 (7%)

Query: 32  SLGCIAYEIHMGHPPFKT----VSILHLIRLLKTQDVTFPSQVSETYKDLV 78
           SLG + +E+  G  PF       S   + R +      FP  +S   +D +
Sbjct: 193 SLGVLTFELLTGASPFTVDGEQNSQSEISRRILKSKPPFPKTMSAEARDFI 243


>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control
           protein 7-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs),  (Cdc7)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Cdc7-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include
           Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae
           Cdc15, Arabidopsis thaliana mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK) epsilon, and
           related proteins. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Fission yeast Cdc7
           is essential for cell division by playing a key role in
           the initiation of septum formation and cytokinesis.
           Budding yeast Cdc15 functions to coordinate mitotic exit
           with cytokinesis. Arabidopsis MAPKKK epsilon is required
           for pollen development in the plasma membrane.
          Length = 254

 Score = 26.1 bits (58), Expect = 1.8
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 5/50 (10%)

Query: 30  IGSLGCIAYEIHMGHPPF---KTVSILHLIRLLKTQDVTFPSQVSETYKD 76
           I SLGC   E+  G+PP+     ++ L   R+++      P  +S   KD
Sbjct: 182 IWSLGCTVIELLTGNPPYYDLNPMAALF--RIVQDDHPPLPEGISPELKD 229


>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein
           Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,
            and similar domains.  Serine/Threonine Kinases (STKs),
           Chlamydomonas reinhardtii Never In Mitosis gene A
           (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Chlamydomonas
           reinhardtii CNK2-like subfamily belongs to the
           (NIMA)-related kinase (Nek) family. The Nek family
           includes seven different Chlamydomonas Neks (CNKs 1-6
           and Fa2). This subfamily includes CNK1, and -2.  The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase.  Chlamydomonas reinhardtii CNK2 has both
           cilliary and cell cycle functions. It influences
           flagellar length through promoting flagellar
           disassembly, and it regulates cell size, through
           influencing the size threshold at which cells commit to
           mitosis.
          Length = 256

 Score = 26.3 bits (58), Expect = 1.9
 Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 20  WHKRAVTSVI-IGSLGCIAYEIHMGHPPFKTVSILHL-IRLLKTQDVTFPSQVSETYKDL 77
           W  R  +    I SLGC+ YE+    PPF+  S+  L  ++ + +    P   S+  ++ 
Sbjct: 173 WKGRPYSYKSDIWSLGCLLYEMATFAPPFEARSMQDLRYKVQRGKYPPIPPIYSQDLQNF 232

Query: 78  VK 79
           ++
Sbjct: 233 IR 234


>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine
           Kinase, Plant B-type Cyclin-Dependent protein Kinase.
           Serine/Threonine Kinases (STKs), Plant B-type
           Cyclin-Dependent protein Kinase (CdkB) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CdkB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. The plant-specific B-type CDKs are expressed
           from the late S to the M phase of the cell cycle. They
           are characterized by the cyclin binding motif
           PPT[A/T]LRE. They play a role in controlling mitosis and
           integrating developmental pathways, such as stomata and
           leaf development. CdkB has been shown to associate with
           both cyclin B, which controls G2/M transition, and
           cyclin D, which acts as a mediator in linking
           extracellular signals to the cell cycle.
          Length = 295

 Score = 25.9 bits (57), Expect = 1.9
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 4/40 (10%)

Query: 26  TSVIIGSLGCIAYEIHMGHPPFKTVS----ILHLIRLLKT 61
           T V I S+GCI  E+    P F   S    +LH+ +LL T
Sbjct: 191 TPVDIWSVGCIFAEMSRKQPLFPGDSELQQLLHIFKLLGT 230


>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like
           Protein Serine/Threonine Kinases.  Serine/threonine
           kinases (STKs), Nak1 subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The Nak1 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae
           Kic1p (kinase that interacts with Cdc31p) and related
           proteins. Nak1 (also known as N-rich kinase 1), is
           required by fission yeast for polarizing the tips of
           actin cytoskeleton and is involved in cell growth, cell
           separation, cell morphology and cell-cycle progression.
           Kic1p is required by budding yeast for cell integrity
           and morphogenesis. Kic1p interacts with Cdc31p, the
           yeast homologue of centrin, and phosphorylates
           substrates in a Cdc31p-dependent manner.
          Length = 277

 Score = 26.2 bits (58), Expect = 1.9
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 30  IGSLGCIAYEIHMGHPPFKTVSILHLIRLL 59
           I SLG   YE+  G+PP+  V     + L+
Sbjct: 185 IWSLGITIYEMATGNPPYSDVDAFRAMMLI 214


>gnl|CDD|182505 PRK10508, PRK10508, hypothetical protein; Provisional.
          Length = 333

 Score = 25.9 bits (57), Expect = 2.0
 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 12/51 (23%)

Query: 2  LLLAQHAVTSVEYCYQRNW----HK-----RAVTSVIIGSLGCIAYEIHMG 43
          L LA+ A    +  Y R W    H       A TSV+IG L      +H+G
Sbjct: 30 LDLARLAE---KRGYHRYWLAEHHNMTGIASAATSVLIGYLAANTTTLHLG 77


>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional.
          Length = 1021

 Score = 25.9 bits (56), Expect = 2.3
 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 32  SLGCIAYEIHMGHPPF-KTVSILHLIRLLK 60
           +LGCI YE+  G  PF K  +   LI  LK
Sbjct: 228 ALGCIIYELCSGKTPFHKANNFSQLISELK 257


>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
           Serine/Threonine Kinases, Mammalian Ste20-like protein
           kinase 1 and 2.  Serine/threonine kinases (STKs),
           mammalian Ste20-like protein kinase 1 (MST1) and MST2
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MST1/2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST1, MST2, and
           related proteins including Drosophila Hippo and
           Dictyostelium discoideum Krs1 (kinase responsive to
           stress 1). MST1/2 and Hippo are involved in a conserved
           pathway that governs cell contact inhibition, organ size
           control, and tumor development. MST1 activates the
           mitogen-activated protein kinases (MAPKs) p38 and c-Jun
           N-terminal kinase (JNK) through MKK7 (a MAPK kinase) and
           MEKK1 (a MAPK kinase kinase) by acting as a MAPK kinase
           kinase kinase (MAPKKKK). Activation of JNK by MST1 leads
           to caspase activation and apoptosis. MST1 has also been
           implicated in cell proliferation and differentiation.
           Krs1 may regulate cell growth arrest and apoptosis in
           response to cellular stress.
          Length = 256

 Score = 25.7 bits (57), Expect = 2.5
 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 30  IGSLGCIAYEIHMGHPPFKTVSILHLIRLLKT---QDVTFPSQVSETYKDLVK 79
           I SLG  A E+  G PP+  +  +  I ++       ++ P + S  + D VK
Sbjct: 182 IWSLGITAIEMAEGKPPYSDIHPMRAIFMIPNKPPPTLSDPEKWSPEFNDFVK 234


>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 5.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek5 subfamily is
           one of a family of 11 different Neks (Nek1-11). The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Neks are involved in the regulation of
           downstream processes following the activation of Cdc2,
           and many of their functions are cell cycle-related. They
           play critical roles in microtubule dynamics during
           ciliogenesis and mitosis. The specific function of Nek5
           is unknown.
          Length = 257

 Score = 25.7 bits (56), Expect = 2.5
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 4/46 (8%)

Query: 11  SVEYCYQRNWHKRAVTSVIIGSLGCIAYEIHMGHPPFKTVSILHLI 56
           S E C  R ++ +      I SLGC+ YE+     PF+  ++  L+
Sbjct: 170 SPEICQNRPYNNKT----DIWSLGCVLYELCTLKHPFEGNNLHQLV 211


>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C
           alpha.  Serine/Threonine Kinases (STKs), Classical
           Protein Kinase C (cPKC) subfamily, alpha isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. There are four
           cPKC isoforms, named alpha, betaI, betaII, and gamma.
           PKC-alpha is expressed in many tissues and is associated
           with cell proliferation, apoptosis, and cell motility.
           It plays a role in the signaling of the growth factors
           PDGF, VEGF, EGF, and FGF. Abnormal levels of PKC-alpha
           have been detected in many transformed cell lines and
           several human tumors. In addition, PKC-alpha is required
           for HER2 dependent breast cancer invasion.
          Length = 323

 Score = 25.7 bits (56), Expect = 2.7
 Identities = 11/39 (28%), Positives = 20/39 (51%)

Query: 34  GCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSE 72
           G + YE+  G PPF       L + +   +V++P  +S+
Sbjct: 188 GVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSK 226


>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine
           Kinase, PCTAIRE-1 kinase.  Serine/Threonine Kinases
           (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PCTAIRE-1 subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. PCTAIRE-1 shares sequence
           similarity with Cyclin-Dependent Kinases (CDKs), which
           belong to a large family of STKs that are regulated by
           their cognate cyclins. Together, CDKs and cyclins are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. PCTAIRE-1 is
           expressed ubiquitously and is localized in the
           cytoplasm. Its kinase activity is cell cycle dependent
           and peaks at the S and G2 phases. PCTAIRE-1 is highly
           expressed in the brain and may play a role in regulating
           neurite outgrowth. It can also associate with Trap
           (Tudor repeat associator with PCTAIRE-2), a
           physiological partner of PCTAIRE-2; with p11, a small
           dimeric protein with similarity to S100; and with 14-3-3
           proteins, mediators of phosphorylation-dependent
           interactions in many different proteins.
          Length = 301

 Score = 25.7 bits (56), Expect = 2.8
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 5/51 (9%)

Query: 26  TSVIIGSLGCIAYEIHMGHPPFKTVSI---LHLI-RLLKT-QDVTFPSQVS 71
           T + +  +GCI YE+  G P F   ++   LH I R+L T  + T+P  +S
Sbjct: 184 TQIDMWGVGCIFYEMSTGRPLFPGSTVEEQLHFIFRILGTPTEETWPGILS 234


>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal
           Byr2-like MAP Kinase Kinase Kinases.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase (MAPKKK) subfamily, fungal Byr2-like
           proteins, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include the MAPKKKs
           Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae
           and Cryptococcus neoformans Ste11, and related proteins.
           They contain an N-terminal SAM (sterile alpha-motif)
           domain, which mediates protein-protein interaction, and
           a C-terminal catalytic domain. MAPKKKs phosphorylate and
           activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which
           in turn phosphorylate and activate MAPKs during
           signaling cascades that are important in mediating
           cellular responses to extracellular signals. Fission
           yeast Byr2 is regulated by Ras1. It responds to
           pheromone signaling and controls mating through the MAPK
           pathway. Budding yeast Ste11 functions in MAPK cascades
           that regulate mating, high osmolarity glycerol, and
           filamentous growth responses.
          Length = 267

 Score = 25.6 bits (56), Expect = 2.8
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 30  IGSLGCIAYEIHMGHPPFKTVSILHLI-RLLKTQDVTFPSQVSETYKDLVK 79
           I SLGC+  E+  G  PF   + L  I ++ +      PS +S    D ++
Sbjct: 195 IWSLGCLVVEMLTGKHPFPDCTQLQAIFKIGENASPEIPSNISSEAIDFLE 245


>gnl|CDD|188920 cd09521, SAM_ASZ1, SAM domain of ASZ1 subfamily.  SAM (sterile
          alpha motif) domain of ASZ1 (Ankyrin, SAM, leucine
          Zipper) also known as GASZ (Germ cell-specific Ankyrin,
          SAM, leucine Zipper) subfamily is a potential
          protein-protein interaction domain. Proteins of this
          group are involved in the repression of transposable
          elements during spermatogenesis, oogenesis, and
          preimplantation embryogenesis. They support synthesis
          of PIWI-interacting RNA via association with some PIWI
          proteins, such as MILI and MIWI. This association is
          required for initiation and maintenance of
          retrotransposon repression during the meiosis. In mice
          lacking ASZ1, DNA damage and delayed germ cell
          maturation was observed due to retrotransposons
          releasing from their repressed state.
          Length = 64

 Score = 24.6 bits (54), Expect = 2.8
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 54 HLIRLLKTQDVTFPSQVSETYKDLVK 79
          HL  L K  DVTF   +  T +DL K
Sbjct: 19 HLTPLFKEHDVTFSQLLKMTEEDLEK 44


>gnl|CDD|190706 pfam03662, Glyco_hydro_79n, Glycosyl hydrolase family 79,
           N-terminal domain.  Family of endo-beta-N-glucuronidase,
           or heparanase. Heparan sulfate proteoglycans (HSPGs)
           play a key role in the self- assembly, insolubility and
           barrier properties of basement membranes and
           extracellular matrices. Hence, cleavage of heparan
           sulfate (HS) affects the integrity and functional state
           of tissues and thereby fundamental normal and
           pathological phenomena involving cell migration and
           response to changes in the extracellular
           micro-environment. Heparanase degrades HS at specific
           intra-chain sites. The enzyme is synthesised as a latent
           approximately 65 kDa protein that is processed at the
           N-terminus into a highly active approximately 50 kDa
           form. Experimental evidence suggests that heparanase may
           facilitate both tumour cell invasion and
           neovascularization, both critical steps in cancer
           progression. The enzyme is also involved in cell
           migration associated with inflammation and autoimmunity.
          Length = 320

 Score = 25.4 bits (56), Expect = 3.0
 Identities = 8/24 (33%), Positives = 13/24 (54%), Gaps = 2/24 (8%)

Query: 54  HLIRLLKTQDVTFPSQVSETYKDL 77
           HLI   K  D ++    ++T+ DL
Sbjct: 255 HLIE--KILDPSYLDGEAKTFSDL 276


>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function
           prediction only / Signal transduction mechanisms /
           Transcription / DNA replication, recombination, and
           repair].
          Length = 384

 Score = 25.9 bits (55), Expect = 3.0
 Identities = 10/30 (33%), Positives = 12/30 (40%)

Query: 30  IGSLGCIAYEIHMGHPPFKTVSILHLIRLL 59
           I SLG   YE+  G PPF+           
Sbjct: 194 IWSLGITLYELLTGLPPFEGEKNSSATSQT 223


>gnl|CDD|204425 pfam10262, Rdx, Rdx family.  This entry is an approximately 100
          residue region of selenoprotein-T, conserved from
          plants to humans. The protein binds to
          UDP-glucose:glycoprotein glucosyltransferase (UGTR),
          the endoplasmic reticulum (ER)-resident protein, which
          is known to be involved in the quality control of
          protein folding. Selenium (Se) plays an essential role
          in cell survival and most of the effects of Se are
          probably mediated by selenoproteins, including
          selenoprotein T. However, despite its binding to UGTR
          and that its mRNA is up-regulated in extended asphyxia,
          the function of the protein and hence of this region of
          it is unknown. Selenoprotein W contains selenium as
          selenocysteine in the primary protein structure and
          levels of this selenoprotein are affected by selenium.
          Length = 76

 Score = 24.5 bits (54), Expect = 3.2
 Identities = 7/14 (50%), Positives = 8/14 (57%)

Query: 12 VEYCYQRNWHKRAV 25
          +EYC Q  W  RA 
Sbjct: 5  IEYCTQCGWLLRAA 18


>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor 1.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, LATS1 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The LATS subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. LATS functions as a tumor
           suppressor and is implicated in cell cycle regulation.
           Inactivation of LATS1 in mice results in the development
           of various tumors, including sarcomas and ovarian
           cancer. Promoter methylation, loss of heterozygosity,
           and missense mutations targeting the LATS1 gene have
           also been found in human sarcomas and ovarian cancers.
           In addition, decreased expression of LATS1 is associated
           with an aggressive phenotype and poor prognosis. LATS1
           induces G2 arrest and promotes cytokinesis. It may be a
           component of the mitotic exit network in higher
           eukaryotes.
          Length = 382

 Score = 25.3 bits (55), Expect = 3.2
 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 4/51 (7%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILH----LIRLLKTQDVTFPSQVSETYKDLV 78
           S+G I YE+ +G PPF   + L     +I    +  +   +++S    DL+
Sbjct: 233 SVGVILYEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLI 283


>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 6.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek6 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek6 is required
           for the transition from metaphase to anaphase. It also
           plays important roles in mitotic spindle formation and
           cytokinesis.  Activated by Nek9 during mitosis, Nek6
           phosphorylates Eg5, a kinesin that is important for
           spindle bipolarity. Nek6 localizes to spindle
           microtubules during metaphase and anaphase, and to the
           midbody during cytokinesis.
          Length = 267

 Score = 25.4 bits (55), Expect = 3.4
 Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 4/53 (7%)

Query: 30  IGSLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFP----SQVSETYKDLV 78
           I SLGC+ YE+     PF    +       K +   +P       SE  ++LV
Sbjct: 189 IWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPTEHYSEKLRELV 241


>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine
           Kinase, Apoptosis signal-regulating kinase.
           Serine/threonine kinases (STKs), Apoptosis
           signal-regulating kinase (ASK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ASK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Subfamily members
           are mitogen-activated protein kinase (MAPK) kinase
           kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1,
           ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. ASK1 (also called
           MAPKKK5) functions in the c-Jun N-terminal kinase (JNK)
           and p38 MAPK signaling pathways by directly activating
           their respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. It
           plays important roles in cytokine and stress responses,
           as well as in reactive oxygen species (ROS)-mediated
           cellular responses. ASK1 is implicated in various
           diseases mediated by oxidative stress including
           inschemic heart disease, hypertension, vessel injury,
           brain ischemia, Fanconi anemia, asthma, and pulmonary
           edema, among others. ASK2 (also called MAPKKK6)
           functions only in a heteromeric complex with ASK1, and
           can activate ASK1 by direct phosphorylation. The
           function of MAPKKK15 is still unknown.
          Length = 268

 Score = 25.2 bits (55), Expect = 4.2
 Identities = 10/18 (55%), Positives = 11/18 (61%)

Query: 30  IGSLGCIAYEIHMGHPPF 47
           I SLGC   E+  G PPF
Sbjct: 194 IWSLGCTIVEMATGKPPF 211


>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic
           subunit; Provisional.
          Length = 340

 Score = 25.3 bits (55), Expect = 4.3
 Identities = 15/48 (31%), Positives = 23/48 (47%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYKDLVK 79
           +LG   YEI +G PPF     L + + +    + FP  +    K L+K
Sbjct: 213 TLGIFIYEILVGCPPFYANEPLLIYQKILEGIIYFPKFLDNNCKHLMK 260


>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase
           4.  Serine/threonine kinases (STKs), yeast
           Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The YSK4 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. YSK4 is a
           putative MAPKKK, whose mammalian gene has been isolated.
           MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals.
          Length = 265

 Score = 24.9 bits (54), Expect = 4.8
 Identities = 8/21 (38%), Positives = 13/21 (61%)

Query: 30  IGSLGCIAYEIHMGHPPFKTV 50
           I S+GC  +E+  G PP  ++
Sbjct: 191 IWSIGCTVFEMATGKPPLASM 211


>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the
           Serine/Threonine Kinases, TDY Mitogen-Activated Protein
           Kinases from Plants.  Serine/Threonine Kinases (STKs),
           Plant TDY Mitogen-Activated Protein Kinase (MAPK)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The TDY
           MAPK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKs are important mediators of cellular
           responses to extracellular signals. In plants, MAPKs are
           associated with physiological, developmental, hormonal,
           and stress responses. Some plants show numerous gene
           duplications of MAPKs. Arabidopsis thaliana harbors at
           least 20 MAPKs, named AtMPK1-20. Oryza sativa contains
           at least 17 MAPKs. There are two subtypes of plant MAPKs
           based on the conserved phosphorylation motif present in
           the activation loop, TEY and TDY. Arabidopsis thaliana
           contains more TEY-type MAPKs than TDY-type, whereas the
           reverse is true for Oryza sativa. This subfamily
           represents the TDY subtype and is composed of Group D
           plant MAPKs including Arabidopsis thaliana MPK18
           (AtMPK18), Oryza sativa Blast- and Wound-induced MAPK1
           (OsBWMK1), OsWJUMK1 (Wound- and JA-Uninducible MAPK1),
           Zea mays MPK6, and the Medicago sativa TDY1 gene
           product. OsBWMK1 enhances resistance to pathogenic
           infections. It mediates stress-activated defense
           responses by activating a transcription factor that
           affects the expression of stress-related genes. AtMPK18
           is involved in microtubule-related functions.
          Length = 338

 Score = 25.1 bits (55), Expect = 4.8
 Identities = 11/30 (36%), Positives = 18/30 (60%)

Query: 30  IGSLGCIAYEIHMGHPPFKTVSILHLIRLL 59
           I S+GCI  E+  G P F   +++H + L+
Sbjct: 191 IWSIGCIFAEVLTGKPLFPGKNVVHQLDLI 220


>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear
           Dbf2-Related kinase-like Protein Serine/Threonine
           Kinases.  Serine/Threonine Kinases (STKs), NDR kinase
           subfamily, fungal NDR-like proteins, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The NDR subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This group is
           composed of fungal NDR-like proteins including
           Saccharomyces cerevisiae CBK1 (or CBK1p),
           Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago
           maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like
           NDR kinase, group members contain an N-terminal
           regulatory (NTR) domain and an insert within the
           catalytic domain that contains an auto-inhibitory
           sequence. CBK1 is an essential component in the RAM
           (regulation of Ace2p activity and cellular
           morphogenesis) network. CBK1 and Orb6 play similar roles
           in coordinating cell morphology with cell cycle
           progression. Ukc1 is involved in morphogenesis,
           pathogenicity, and pigment formation. Cot1 plays a role
           in polar tip extension.
          Length = 377

 Score = 24.8 bits (54), Expect = 5.0
 Identities = 9/16 (56%), Positives = 11/16 (68%)

Query: 32  SLGCIAYEIHMGHPPF 47
           SLG I +E  +G PPF
Sbjct: 233 SLGAIMFECLIGWPPF 248


>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 1-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 1 (CDK1)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. This subfamily is composed of CDK1 from higher
           eukaryotes, plants, and yeasts, as well as CDK2 and
           CDK3. CDK1 is also called Cell division control protein
           2 (Cdc2) or p34 protein kinase, and is regulated by
           cyclins A, B, and E. The CDK1/cyclin A complex controls
           G2 phase entry and progression while the CDK1/cyclin B
           complex is critical for G2 to M phase transition. CDK2
           is regulated by cyclin E or cyclin A. Upon activation by
           cyclin E, it phosphorylates the retinoblastoma (pRb)
           protein which activates E2F mediated transcription and
           allows cells to move into S phase. The CDK2/cyclin A
           complex plays a role in regulating DNA replication.
           Studies in knockout mice revealed that CDK1 can
           compensate for the loss of the cdk2 gene as it can also
           bind cyclin E and drive G1 to S phase transition. CDK3
           is regulated by cyclin C and it phosphorylates pRB
           specifically during the G0/G1 transition. This
           phosphorylation is required for cells to exit G0
           efficiently and enter the G1 phase.
          Length = 283

 Score = 25.0 bits (55), Expect = 5.0
 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 4/42 (9%)

Query: 26  TSVIIGSLGCIAYEIHMGHPPFKTVS----ILHLIRLLKTQD 63
           T V I S+GCI  E+    P F   S    +  + R L T D
Sbjct: 179 TPVDIWSIGCIFAEMVNRRPLFPGDSEIDQLFRIFRTLGTPD 220


>gnl|CDD|225198 COG2316, COG2316, Predicted hydrolase (HD superfamily) [General
           function prediction only].
          Length = 212

 Score = 24.9 bits (54), Expect = 5.8
 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 5/55 (9%)

Query: 4   LAQH--AVTSVEYCYQRNWHKRAVTSVIIGSLGCIAYEIHMGHP---PFKTVSIL 53
           L +H  AV +V     R W +      + G L    YE+  G P       V IL
Sbjct: 48  LQKHCLAVEAVMRWLAREWGEDEEKWAVTGLLHDFDYELTQGDPEEHGLWGVEIL 102


>gnl|CDD|234838 PRK00784, PRK00784, cobyric acid synthase; Provisional.
          Length = 488

 Score = 24.7 bits (55), Expect = 6.1
 Identities = 6/6 (100%), Positives = 6/6 (100%)

Query: 38  YEIHMG 43
           YEIHMG
Sbjct: 390 YEIHMG 395


>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           LATS subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. LATS was originally identified in Drosophila
           using a screen for genes whose inactivation led to
           overproliferation of cells. In tetrapods, there are two
           LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in
           mice results in the development of various tumors,
           including sarcomas and ovarian cancer. LATS functions as
           a tumor suppressor and is implicated in cell cycle
           regulation.
          Length = 376

 Score = 24.8 bits (54), Expect = 6.2
 Identities = 9/16 (56%), Positives = 12/16 (75%)

Query: 32  SLGCIAYEIHMGHPPF 47
           S+G I YE+ +G PPF
Sbjct: 229 SVGVILYEMLVGQPPF 244


>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein
           Serine/Threonine Kinases, Never In Mitosis gene
           A-related kinase 6 and 7.  Serine/Threonine Kinases
           (STKs), Never In Mitosis gene A (NIMA)-related kinase 6
           (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The Nek6/7 subfamily is part of a family of 11 different
           Neks (Nek1-11) that are involved in cell cycle control.
           The Nek family is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Nek6 and Nek7 are the shortest Neks,
           consisting only of the catalytic domain and a very short
           N-terminal extension. They show distinct expression
           patterns and both appear to be downstream substrates of
           Nek9. They are required for mitotic spindle formation
           and cytokinesis. They may also be regulators of the p70
           ribosomal S6 kinase.
          Length = 267

 Score = 24.7 bits (54), Expect = 6.2
 Identities = 9/19 (47%), Positives = 11/19 (57%)

Query: 30  IGSLGCIAYEIHMGHPPFK 48
           I SLGC+ YE+     PF 
Sbjct: 189 IWSLGCLLYEMAALQSPFY 207


>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 5.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 5, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK5 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK5 is mainly expressed in the brain. It
           is not required for viability, but together with PAK6,
           it is required for normal levels of locomotion and
           activity, and for learning and memory. PAK5 cooperates
           with Inca (induced in neural crest by AP2) in the
           regulation of cell adhesion and cytoskeletal
           organization in the embryo and in neural crest cells
           during craniofacial development. PAK5 may also play a
           role in controlling the signaling of Raf-1, an effector
           of Ras, at the mitochondria.
          Length = 292

 Score = 24.6 bits (53), Expect = 6.7
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 26  TSVIIGSLGCIAYEIHMGHPPFKTVSILHLIRLLKTQDVTFPSQVSETYK 75
           T V I SLG +  E+  G PP+     L  +R ++      P +V +++K
Sbjct: 197 TEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRD---NLPPRVKDSHK 243


>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), CMGC family, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CMGC family is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The CMGC family consists of Cyclin-Dependent
           protein Kinases (CDKs), Mitogen-activated protein
           kinases (MAPKs) such as Extracellular signal-regulated
           kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38,
           and similar proteins. CDKs belong to a large subfamily
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. MAPKs
           serve as important mediators of cellular responses to
           extracellular signals. They control critical cellular
           functions including differentiation, proliferation,
           migration, and apoptosis. They are also implicated in
           the pathogenesis of many diseases including multiple
           types of cancer, stroke, diabetes, and chronic
           inflammation.
          Length = 283

 Score = 24.6 bits (54), Expect = 6.7
 Identities = 14/40 (35%), Positives = 18/40 (45%), Gaps = 4/40 (10%)

Query: 26  TSVIIGSLGCIAYEIHMGHPPFKTVS----ILHLIRLLKT 61
           T V I S+GCI  E+    P F   S    +  + R L T
Sbjct: 178 TPVDIWSVGCIFAELLSRRPLFPGKSEIDQLFKIFRTLGT 217


>gnl|CDD|215968 pfam00520, Ion_trans, Ion transport protein.  This family
          contains Sodium, Potassium, Calcium ion channels. This
          family is 6 transmembrane helices in which the last two
          helices flank a loop which determines ion selectivity.
          In some sub-families (e.g. Na channels) the domain is
          repeated four times, whereas in others (e.g. K
          channels) the protein forms as a tetramer in the
          membrane. A bacterial structure of the protein is known
          for the last two helices but is not the Pfam family due
          to it lacking the first four helices.
          Length = 194

 Score = 24.6 bits (54), Expect = 7.1
 Identities = 7/36 (19%), Positives = 16/36 (44%)

Query: 25 VTSVIIGSLGCIAYEIHMGHPPFKTVSILHLIRLLK 60
             V+   +  I + +       + + +L L+RLL+
Sbjct: 37 FLVVLPSLVSLILFLLGEDSGLLRVLRLLRLLRLLR 72


>gnl|CDD|233988 TIGR02734, crtI_fam, phytoene desaturase.  Phytoene is converted to
           lycopene by desaturation at four (two symmetrical pairs
           of) sites. This is achieved by two enzymes (crtP and
           crtQ) in cyanobacteria (Gloeobacter being an exception)
           and plants, but by a single enzyme in most other
           bacteria and in fungi. This single enzyme is called the
           bacterial-type phytoene desaturase, or CrtI. Most
           members of this family, part of the larger Pfam family
           pfam01593, which also contains amino oxidases, are CrtI
           itself; it is likely that all members act on either
           phytoene or on related compounds such as
           dehydrosqualene, for carotenoid biosynthesis
           [Biosynthesis of cofactors, prosthetic groups, and
           carriers, Other].
          Length = 502

 Score = 24.6 bits (54), Expect = 7.3
 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%)

Query: 43  GHPPFKTVSILHLIRLLKTQD-VTFP 67
           G  PF+T SI  LI  L+ +  V FP
Sbjct: 189 GGNPFRTPSIYALISALEREWGVWFP 214


>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen and stress-activated
           kinase 1.  Serine/Threonine Kinases (STKs), Mitogen and
           stress-activated kinase (MSK) subfamily, MSK1,
           N-terminal catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The MSK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MSKs contain an N-terminal kinase domain (NTD)
           from the AGC family and a C-terminal kinase domain (CTD)
           from the CAMK family, similar to 90 kDa ribosomal
           protein S6 kinases (RSKs). MSKs are activated by two
           major signaling cascades, the Ras-MAPK and p38 stress
           kinase pathways, which trigger phosphorylation in the
           activation loop (A-loop) of the CTD of MSK. The active
           CTD phosphorylates the hydrophobic motif (HM) of NTD,
           which facilitates the phosphorylation of the A-loop and
           activates the NTD, which in turn phosphorylates
           downstream targets. MSK1 plays a role in the regulation
           of translational control and transcriptional activation.
           It phosphorylates the transcription factors, CREB and
           NFkappaB. It also phosphorylates the nucleosomal
           proteins H3 and HMG-14. Increased phosphorylation of
           MEK1 is associated with the development of cerebral
           ischemic/hypoxic preconditioning.
          Length = 290

 Score = 24.6 bits (53), Expect = 7.4
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 6/53 (11%)

Query: 32  SLGCIAYEIHMGHPPFKTV-----SILHLIRLLKTQDVTFPSQVSETYKDLVK 79
           S+G + YE+  G  PF TV     S   + R +   +  +P ++S   KD+++
Sbjct: 193 SMGVLMYELLTGASPF-TVDGEKNSQAEISRRILKSEPPYPQEMSALAKDIIQ 244


>gnl|CDD|183434 PRK12318, PRK12318, methionine aminopeptidase; Provisional.
          Length = 291

 Score = 24.4 bits (53), Expect = 7.4
 Identities = 14/48 (29%), Positives = 19/48 (39%), Gaps = 11/48 (22%)

Query: 5   AQHAVTSVEY-CYQRNWHKRAVTSVIIGSLGCIAYEIHMGHPPF-KTV 50
           A+  VT+ E     R  HK             I   ++ G PPF KT+
Sbjct: 70  AKEGVTTNELDELSRELHKEY---------NAIPAPLNYGSPPFPKTI 108


>gnl|CDD|212093 cd11555, SLC-NCS1sbd_u1, uncharacterized
           nucleobase-cation-symport-1 (NCS1) transporter
           subfamily; solute-binding domain.  NCS1s are essential
           components of salvage pathways for nucleobases and
           related metabolites; their known substrates include
           allantoin, uracil, thiamine, and nicotinamide riboside.
           NCS1s belong to a superfamily which also contains the
           solute carrier 5 family sodium/glucose transporters
           (SLC5s), and solute carrier 6 family neurotransmitter
           transporters (SLC6s).
          Length = 459

 Score = 24.4 bits (54), Expect = 8.4
 Identities = 6/20 (30%), Positives = 12/20 (60%)

Query: 14  YCYQRNWHKRAVTSVIIGSL 33
           Y Y+  W+ +AV ++I  + 
Sbjct: 404 YWYRNGWNPKAVAALIPAAA 423


>gnl|CDD|212054 cd11485, SLC-NCS1sbd_YbbW-like, uncharacterized
           nucleobase-cation-symport-1 (NCS1) transporter
           subfamily, YbbW-like; solute-binding domain.  NCS1s are
           essential components of salvage pathways for nucleobases
           and related metabolites; their known substrates include
           allantoin, uracil, thiamine, and nicotinamide riboside.
           This subfamily includes the putative allantoin
           transporter Escherichia coli YbbW (also known as GlxB2).
           NCS1s belong to a superfamily which also contains the
           solute carrier 5 family sodium/glucose transporters
           (SLC5s), and solute carrier 6 family neurotransmitter
           transporters (SLC6s).
          Length = 459

 Score = 24.1 bits (53), Expect = 8.7
 Identities = 7/25 (28%), Positives = 12/25 (48%)

Query: 13  EYCYQRNWHKRAVTSVIIGSLGCIA 37
            Y Y   W+ RA+ +  +G L  + 
Sbjct: 402 RYWYSNGWNWRALIAFAVGVLPNLP 426


>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine
           Kinase, Mitogen-Activated Protein Kinase 15.
           Serine/Threonine Kinases (STKs), Mitogen-Activated
           Protein Kinase 15 (MAPK15) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAPK15 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MAPKs are
           important mediators of cellular responses to
           extracellular signals. Human MAPK15 is also called
           Extracellular signal Regulated Kinase 8 (ERK8) while the
           rat protein is called ERK7. ERK7 and ERK8 display both
           similar and different biochemical properties. They
           autophosphorylate and activate themselves and do not
           require upstream activating kinases. ERK7 is
           constitutively active and is not affected by
           extracellular stimuli whereas ERK8 shows low basal
           activity and is activated by DNA-damaging agents. ERK7
           and ERK8 also have different substrate profiles. Genome
           analysis shows that they are orthologs with similar gene
           structures. ERK7 and ERK 8 may be involved in the
           signaling of some nuclear receptor transcription
           factors. ERK7 regulates hormone-dependent degradation of
           estrogen receptor alpha while ERK8 down-regulates the
           transcriptional co-activation androgen and
           glucocorticoid receptors.
          Length = 337

 Score = 24.1 bits (53), Expect = 9.7
 Identities = 10/27 (37%), Positives = 15/27 (55%)

Query: 32  SLGCIAYEIHMGHPPFKTVSILHLIRL 58
           S+GCI  E+ +G P F   S L+ +  
Sbjct: 198 SVGCILGEMLLGKPLFPGTSTLNQLEK 224


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.325    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0818    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,735,897
Number of extensions: 273961
Number of successful extensions: 474
Number of sequences better than 10.0: 1
Number of HSP's gapped: 468
Number of HSP's successfully gapped: 104
Length of query: 79
Length of database: 10,937,602
Length adjustment: 48
Effective length of query: 31
Effective length of database: 8,808,610
Effective search space: 273066910
Effective search space used: 273066910
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (24.0 bits)