Diaphorina citri psyllid: psy18066

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----
MFSTFARYVKILSIKNPVLTKTFVSASVGGVLFGVYLHNRHQWPLINVILPSIDAAQRIDIDYKPPSLRSQFNFVADVLENVEKSVVNIELVIPYYRQTMSNGSGFIATDDGLIITNAHVVSGKPGAQIIVTLPDGSKHKGAVEALDVECDLAIIRCNFPNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKDKDRTITHKKYIGITMLTLNEKLIEQLRRDRHIPYDLTHGVLIWRVMYNSPAYLAGLHQEDIIIELNKKPCHSAKDIYAALEVVRLVNFQFSHFKHSFLVESELK
cccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHccccEEEEEEcccccccccccccEEEEccccEEEEcccccccccccEEEEEcccccEEEEEEEcccccccEEEEEEcccccccEEEcccccccccccEEEEEcccccccccEEEEEEccccccccccccccccccEEccccccccccccccccccccEEEEEcEEccccCEEEEcHHHHHHHHHHHHHcccccccccccEEEEEEEEccHHHHHHHccccccccccccEEEEEEEccccHHHHcccccccEEEEEccCEcccHHHHHHHHHcccEEEEEEEECccEEEEEEEEc
***TFARYVKILSIKNPVLTKTFVSASVGGVLFGVYLHNRHQWPLINVILPSIDAAQRIDIDYKPPSLRSQFNFVADVLENVEKSVVNIELVIPYYRQTMSNGSGFIATDDGLIITNAHVVSGKPGAQIIVTLPDGSKHKGAVEALDVECDLAIIRCNFPNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKDKDRTITHKKYIGITMLTLNEKLIEQLRRDRHIPYDLTHGVLIWRVMYNSPAYLAGLHQEDIIIELNKKPCHSAKDIYAALEVVRLVNFQFSHFKHSFLVESELK
xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSTFARYVKILSIKNPVLTKTFVSASVGGVLFGVYLHNRHQWPLINVILPSIDAAQRIDIDYKPPSLRSQFNFVADVLENVEKSVVNIELVIPYYRQTMSNGSGFIATDDGLIITNAHVVSGKPGAQIIVTLPDGSKHKGAVEALDVECDLAIIRCNFPNNYPALKLGKAADIRNGEFVIAMGSPLTLNNTNTFGIISNKQRSSETLGLNKTINYIQTDAAITFGNSGGPLVNLDGEVIGINSMKVTAGISFAIPIDYAIEFLTNYKRKDKDRTITHKKYIGITMLTLNEKLIEQLRRDRHIPYDLTHGVLIWRVMYNSPAYLAGLHQEDIIIELNKKPCHSAKDIYAALEVVRLVNFQFSHFKHSFLVESELK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine protease HTRA2, mitochondrial Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Cleaves THAP5 and promotes its degradation during apoptosis.confidentQ9JIY5
Serine protease HTRA2, mitochondrial Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Can antagonize antiapoptotic activity of th by directly inducing the degradation of th.confidentQ297U2
Serine protease HTRA2, mitochondrial Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Can antagonize antiapoptotic activity of th by directly inducing the degradation of th.confidentQ9VFJ3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0004252 [MF]serine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0009898 [CC]internal side of plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0007005 [BP]mitochondrion organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0048072 [BP]compound eye pigmentationprobableGO:0032502, GO:0048069, GO:0043473, GO:0048066, GO:0008150, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030288 [CC]outer membrane-bounded periplasmic spaceprobableGO:0005623, GO:0044462, GO:0044464, GO:0030313, GO:0031975, GO:0005575, GO:0071944, GO:0042597, GO:0030312
GO:0044267 [BP]cellular protein metabolic processprobableGO:0044238, GO:0044260, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0044436 [CC]thylakoid partprobableGO:0009579, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0071575 [CC]integral to external side of plasma membraneprobableGO:0009897, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031233, GO:0031226, GO:0009986, GO:0031224
GO:0009405 [BP]pathogenesisprobableGO:0008150, GO:0051704
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0009534 [CC]chloroplast thylakoidprobableGO:0009579, GO:0005737, GO:0031984, GO:0005575, GO:0043231, GO:0044464, GO:0031976, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0009536, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0071218 [BP]cellular response to misfolded proteinprobableGO:0051716, GO:0070887, GO:0006950, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0035967, GO:0035966, GO:0044763, GO:0033554, GO:0042221, GO:0051788, GO:0010033, GO:0044699
GO:0043280 [BP]positive regulation of cysteine-type endopeptidase activity involved in apoptotic processprobableGO:0019222, GO:2001056, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0043085, GO:0051345, GO:2000116, GO:0043067, GO:0065007, GO:0044699, GO:0044093, GO:0043281, GO:0065009, GO:0010259, GO:0009987, GO:0052547, GO:0052548, GO:0006915, GO:0050794, GO:0012501, GO:0044763, GO:0010950, GO:0010952, GO:0051336, GO:0050790, GO:0008150
GO:0030163 [BP]protein catabolic processprobableGO:0044238, GO:1901575, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0009056, GO:0009057
GO:0030514 [BP]negative regulation of BMP signaling pathwayprobableGO:0090092, GO:0009968, GO:0090101, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523, GO:0030510
GO:0030512 [BP]negative regulation of transforming growth factor beta receptor signaling pathwayprobableGO:0090287, GO:0009968, GO:0090101, GO:0009966, GO:0048583, GO:0048585, GO:0017015, GO:0090288, GO:0050794, GO:0090092, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0035631 [CC]CD40 receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0010942 [BP]positive regulation of cell deathprobableGO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0010941, GO:0050789, GO:0048522
GO:0048749 [BP]compound eye developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.21.-Serine endopeptidases.probable
3.4.21.108HtrA2 peptidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NUM, chain A
Confidence level:very confident
Coverage over the Query: 65-201,215-269
View the alignment between query and template
View the model in PyMOL