BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy18105
         (333 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ENH|A Chain A, Crystal Structure Of Cgi121BUD32KAE1 COMPLEX
 pdb|3ENH|B Chain B, Crystal Structure Of Cgi121BUD32KAE1 COMPLEX
 pdb|3EN9|A Chain A, Structure Of The Methanococcus Jannaschii Kae1-Bud32
           Fusion Protein
 pdb|3EN9|B Chain B, Structure Of The Methanococcus Jannaschii Kae1-Bud32
           Fusion Protein
          Length = 540

 Score = 29.3 bits (64), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 8   VQAGKLNVNEDDPFELFVASTNIRY-TYYSETHKILGNTYGMCV 50
           ++ GKL    +DP  L+V+  N +   Y S+ +++ G T  + V
Sbjct: 116 IEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAV 159


>pdb|2VWB|A Chain A, Structure Of The Archaeal Kae1-Bud32 Fusion Protein
           Mj1130: A Model For The Eukaryotic Ekc-Keops Subcomplex
           Involved In Transcription And Telomere Homeostasis.
 pdb|2VWB|B Chain B, Structure Of The Archaeal Kae1-Bud32 Fusion Protein
           Mj1130: A Model For The Eukaryotic Ekc-Keops Subcomplex
           Involved In Transcription And Telomere Homeostasis
          Length = 535

 Score = 29.3 bits (64), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 8   VQAGKLNVNEDDPFELFVASTNIRY-TYYSETHKILGNTYGMCV 50
           ++ GKL    +DP  L+V+  N +   Y S+ +++ G T  + V
Sbjct: 111 IEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAV 154


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.133    0.374 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,868,570
Number of Sequences: 62578
Number of extensions: 266228
Number of successful extensions: 498
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 497
Number of HSP's gapped (non-prelim): 3
length of query: 333
length of database: 14,973,337
effective HSP length: 99
effective length of query: 234
effective length of database: 8,778,115
effective search space: 2054078910
effective search space used: 2054078910
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)