BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy18105
(333 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3ENH|A Chain A, Crystal Structure Of Cgi121BUD32KAE1 COMPLEX
pdb|3ENH|B Chain B, Crystal Structure Of Cgi121BUD32KAE1 COMPLEX
pdb|3EN9|A Chain A, Structure Of The Methanococcus Jannaschii Kae1-Bud32
Fusion Protein
pdb|3EN9|B Chain B, Structure Of The Methanococcus Jannaschii Kae1-Bud32
Fusion Protein
Length = 540
Score = 29.3 bits (64), Expect = 2.8, Method: Compositional matrix adjust.
Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
Query: 8 VQAGKLNVNEDDPFELFVASTNIRY-TYYSETHKILGNTYGMCV 50
++ GKL +DP L+V+ N + Y S+ +++ G T + V
Sbjct: 116 IEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAV 159
>pdb|2VWB|A Chain A, Structure Of The Archaeal Kae1-Bud32 Fusion Protein
Mj1130: A Model For The Eukaryotic Ekc-Keops Subcomplex
Involved In Transcription And Telomere Homeostasis.
pdb|2VWB|B Chain B, Structure Of The Archaeal Kae1-Bud32 Fusion Protein
Mj1130: A Model For The Eukaryotic Ekc-Keops Subcomplex
Involved In Transcription And Telomere Homeostasis
Length = 535
Score = 29.3 bits (64), Expect = 2.9, Method: Compositional matrix adjust.
Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
Query: 8 VQAGKLNVNEDDPFELFVASTNIRY-TYYSETHKILGNTYGMCV 50
++ GKL +DP L+V+ N + Y S+ +++ G T + V
Sbjct: 111 IEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAV 154
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.133 0.374
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,868,570
Number of Sequences: 62578
Number of extensions: 266228
Number of successful extensions: 498
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 497
Number of HSP's gapped (non-prelim): 3
length of query: 333
length of database: 14,973,337
effective HSP length: 99
effective length of query: 234
effective length of database: 8,778,115
effective search space: 2054078910
effective search space used: 2054078910
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)