Diaphorina citri psyllid: psy1812


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MQVHSILQRGPRVFIFMRYADNGDLLDHIKRAGPVAESNARTWFSQMLAGLEYLHREITNHTPFTAHLPSKNIAHRDLKCENILMTKRFNVKIADFGFARYCVDKEGRRVLSRTYCGSAAYAAPEVISGNPYNPKLADIWSLGVITFIMLNAAMPFDDSNLKQLFKEQTSNILSHQVKVKDILSHQVKVKDILSHQVKVKDILSHQVKVKDILSHQVKLKDILSHQVKVKDILSHQVKNLVGQILEPDITKRIRLDAIKAHDWLRYKSMVRRKVLPGQKLVHSNLSVKQTPKTAFTARERHPLA
ccCEEEEECccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEECccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc
MQVHSILQRGPRVFIFMRYADNGDLLDHIKRAGPVAESNARTWFSQMLAGLEYLHREITNHTPFTAHLPSKNIAHRDLKCENILMTKRFNVKIADFGFARYCVDKEGRRVLSRTYCGSAAYAAPEVISGNPYNPKLADIWSLGVITFIMLNAAMPFDDSNLKQLFKEQTSNILSHQVKVKDILSHQVKVKDILSHQVKVKDILSHQVKVKDILSHQVKLKDILSHQVKVKDILSHQVKNLVGQILEPDITKRIRLDAIKAHDWLRYKSMVRRKVLP****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVHSILQRGPRVFIFMRYADNGDLLDHIKRAGPVAESNARTWFSQMLAGLEYLHREITNHTPFTAHLPSKNIAHRDLKCENILMTKRFNVKIADFGFARYCVDKEGRRVLSRTYCGSAAYAAPEVISGNPYNPKLADIWSLGVITFIMLNAAMPFDDSNLKQLFKEQTSNILSHQVKVKDILSHQVKVKDILSHQVKVKDILSHQVKVKDILSHQVKLKDILSHQVKVKDILSHQVKNLVGQILEPDITKRIRLDAIKAHDWLRYKSMVRRKVLPGQKLVHSNLSVKQTPKTAFTARERHPLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0005935 [CC]cellular bud neckprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0010604 [BP]positive regulation of macromolecule metabolic processprobableGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0000131 [CC]incipient cellular bud siteprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0009894 [BP]regulation of catabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0032153 [CC]cell division siteprobableGO:0005575, GO:0044464, GO:0005623
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0005815 [CC]microtubule organizing centerprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0009719 [BP]response to endogenous stimulusprobableGO:0050896, GO:0008150
GO:0005940 [CC]septin ringprobableGO:0005856, GO:0005737, GO:0043228, GO:0005575, GO:0043232, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0032156, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0044424, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0009651 [BP]response to salt stressprobableGO:0008150, GO:0009628, GO:0006950, GO:0006970, GO:0050896
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OZ6, chain A
Confidence level:very confident
Coverage over the Query: 1-55,70-274
View the alignment between query and template
View the model in PyMOL
Template: 3QFV, chain A
Confidence level:probable
Coverage over the Query: 3-56,71-260,286-296
View the alignment between query and template
View the model in PyMOL