Diaphorina citri psyllid: psy18173


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
RVLRRTRLADGLSLSQVTVPIGVLLVIFESRPDSLPQVAALALASANGLLLKGGKEAFHSNKALMDVVKEALASVGAQDAISLVSTREEISDLLSMEKHIDLIIPRGSSDLVRSIQQKSQHIPVLGHAEGICHVYVDKDADIRKAIKIARDSKCDYPAACNAMETLLIHEDHFQGSFFTDVCKMFRDEGVN
cccccCECcccCEEEEEEEccEEEEEEEcccccHHHHHHHHHHHHccEEEEcccHHHHHHHHHHHHHHHHHHHHccccccEEEcccHHHHHHHHcccccEEEEEccccHHHHHHHHHccccccEECcccccEEEEEcccccHHHHHHHHHcccccccccHHHHHHHHHccccccHHHHHHHHHHHHHcccc
***RRTRLADGLSLSQVTVPIGVLLVIFESRPDSLPQVAALALASANGLLLKGGKEAFHSNKALMDVVKEALASVGAQDAISLVSTREEISDLLSMEKHIDLIIPRGSSDLVRSIQQKSQHIPVLGHAEGICHVYVDKDADIRKAIKIARDSKCDYPAACNAMETLLIHEDHFQGSFFTDVCKMFRDEG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RVLRRTRLADGLSLSQVTVPIGVLLVIFESRPDSLPQVAALALASANGLLLKGGKEAFHSNKALMDVVKEALASVGAQDAISLVSTREEISDLLSMEKHIDLIIPRGSSDLVRSIQQKSQHIPVLGHAEGICHVYVDKDADIRKAIKIARDSKCDYPAACNAMETLLIHEDHFQGSFFTDVCKMFRDEGVN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gamma-glutamyl phosphate reductase Catalyzes the NADPH dependent reduction of L-gamma-glutamyl 5-phosphate into L-glutamate 5-semialdehyde and phosphate. The product spontaneously undergoes cyclization to form 1-pyrroline-5-carboxylate.confidentB8HYG3
Delta-1-pyrroline-5-carboxylate synthase confidentP54886
Gamma-glutamyl phosphate reductase Catalyzes the NADPH dependent reduction of L-gamma-glutamyl 5-phosphate into L-glutamate 5-semialdehyde and phosphate. The product spontaneously undergoes cyclization to form 1-pyrroline-5-carboxylate.confidentQ8YV15

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006592 [BP]ornithine biosynthetic processprobableGO:0006591, GO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0044283, GO:1901576, GO:0044710, GO:0044711, GO:0006520, GO:0071704, GO:1901605, GO:1901607, GO:0044238, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0008652, GO:1901564, GO:1901566, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0004350 [MF]glutamate-5-semialdehyde dehydrogenase activityprobableGO:0003824, GO:0016903, GO:0003674, GO:0016620, GO:0016491
GO:0006561 [BP]proline biosynthetic processprobableGO:0044283, GO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0009064, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0044711, GO:0006560, GO:0006520, GO:0071704, GO:1901605, GO:1901607, GO:0018130, GO:0044238, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0046483, GO:0008652, GO:1901564, GO:0006082, GO:1901566, GO:0046394, GO:0016053, GO:0044237, GO:0009084
GO:0019240 [BP]citrulline biosynthetic processprobableGO:0042398, GO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0044283, GO:1901576, GO:0044710, GO:0044711, GO:0006520, GO:0071704, GO:0006082, GO:1901605, GO:1901607, GO:0044238, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0008652, GO:1901564, GO:0006575, GO:1901566, GO:0046394, GO:0000052, GO:0016053, GO:0044237
GO:0016310 [BP]phosphorylationprobableGO:0009987, GO:0044237, GO:0006796, GO:0008150, GO:0008152, GO:0006793
GO:0006536 [BP]glutamate metabolic processprobableGO:0043648, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:0044238, GO:0044237, GO:0006520, GO:0019752, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0009064, GO:0043436, GO:1901605
GO:0004349 [MF]glutamate 5-kinase activityprobableGO:0019202, GO:0016772, GO:0016301, GO:0016774, GO:0003824, GO:0016740, GO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H5G, chain A
Confidence level:very confident
Coverage over the Query: 10-190
View the alignment between query and template
View the model in PyMOL