Diaphorina citri psyllid: psy18185

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MSAYKSDKLRKEINKVVNKYIDQGIAELVPGVLFIDEVHMLDLETFTYLHRALESAIAPIVIFATNRGRCLVRGTDDIISPHGIPLDLLDRLLIIRTTPYNQKDMEAIIKLRANTEGHVLDDEALVTLSEIGTRSTLRYVVQLLTPAALTAKTNGRTAISKQDILEVSTLFLDAKSSARILTENKDKFMR
ccccccHHHHHHHHHHHHHHHHcccEEEcccEEEEEccccccHHHHHHHHHHHccccccEEEEEEccccEEEccccccccccccccccccccEEECcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHcc
***YKSDKLRKEINKVVNKYIDQGIAELVPGVLFIDEVHMLDLETFTYLHRALESAIAPIVIFATNRGRCLVRGTDDIISPHGIPLDLLDRLLIIRTTPYNQKDMEAIIKLRANTEGHVLDDEALVTLSEIGTRSTLRYVVQLLTPAALTAKTNGRTAISKQDILEVSTLFLDAKSSARILTENKDKFMR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAYKSDKLRKEINKVVNKYIDQGIAELVPGVLFIDEVHMLDLETFTYLHRALESAIAPIVIFATNRGRCLVRGTDDIISPHGIPLDLLDRLLIIRTTPYNQKDMEAIIKLRANTEGHVLDDEALVTLSEIGTRSTLRYVVQLLTPAALTAKTNGRTAISKQDILEVSTLFLDAKSSARILTENKDKFMR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RuvB-like helicase 1 Proposed core component of the chromatin remodeling Ino80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.confidentQ29AK9
RuvB-like helicase 1 Proposed core component of the chromatin remodeling Ino80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.confidentQ9VH07
RuvB-like helicase 1 DNA helicase which participates in several chromatin remodeling complexes, including the SWR1 and the INO80 complexes. The SWR1 complex mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. The INO80 complex remodels chromatin by shifting nucleosomes and is involved in DNA repair. Also involved in pre-rRNA processing.confidentQ4WPW8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031011 [CC]Ino80 complexprobableGO:0033202, GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0070603, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0097346, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005488 [MF]bindingprobableGO:0003674
GO:0043140 [MF]ATP-dependent 3'-5' DNA helicase activityprobableGO:0008094, GO:0016818, GO:0016462, GO:0008026, GO:0042623, GO:0004003, GO:0016787, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003674, GO:0016887, GO:0003678, GO:0043138, GO:0003824
GO:0070209 [CC]ASTRA complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0043486 [BP]histone exchangeprobableGO:0034728, GO:0071824, GO:0044699, GO:0009987, GO:0051276, GO:0006338, GO:0006325, GO:0043044, GO:0016043, GO:0043933, GO:0044763, GO:0071840, GO:0006996, GO:0008150, GO:0016568
GO:0071339 [CC]MLL1 complexprobableGO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422, GO:0044665
GO:0043967 [BP]histone H4 acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0018394, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0016568, GO:0016569
GO:0043968 [BP]histone H2A acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0018394, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0016568, GO:0016569
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0032501 [BP]multicellular organismal processprobableGO:0008150
GO:0032508 [BP]DNA duplex unwindingprobableGO:0071103, GO:0032392, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0000812 [CC]Swr1 complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0070603, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0097346, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0035060 [CC]brahma complexprobableGO:0043234, GO:0005575, GO:0070603, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0032991, GO:0090544, GO:0043227, GO:0043226, GO:0044422
GO:0035267 [CC]NuA4 histone acetyltransferase complexprobableGO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0043189, GO:0005654, GO:0044451, GO:0043231, GO:0043234, GO:0032991, GO:0000123, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0065003 [BP]macromolecular complex assemblyprobableGO:0022607, GO:0043933, GO:0016043, GO:0044085, GO:0008150, GO:0071840
GO:0030529 [CC]ribonucleoprotein complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.12DNA helicase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2C9O, chain A
Confidence level:very confident
Coverage over the Query: 7-183
View the alignment between query and template
View the model in PyMOL