Query         psy18227
Match_columns 211
No_of_seqs    136 out of 374
Neff          6.2 
Searched_HMMs 46136
Date          Fri Aug 16 16:57:16 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy18227.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/18227hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02862 DDHD:  DDHD domain;  I 100.0 2.1E-48 4.6E-53  331.3  10.8  186    2-190     4-227 (227)
  2 KOG2308|consensus              100.0 1.8E-39 3.9E-44  311.7   7.7  191    2-196   513-735 (741)
  3 cd06885 PX_SNX17_31 The phosph  42.3      21 0.00046   26.8   2.2   29  159-187    75-103 (104)
  4 cd07284 PX_SNX7 The phosphoino  25.2      54  0.0012   25.2   2.0   24  161-184    90-113 (116)
  5 cd06865 PX_SNX_like The phosph  23.1      57  0.0012   25.0   1.8   24  161-184    94-117 (120)
  6 cd06860 PX_SNX7_30_like The ph  22.3      66  0.0014   24.5   2.0   25  160-184    89-113 (116)
  7 cd06864 PX_SNX4 The phosphoino  21.8      61  0.0013   25.3   1.7   26  160-185   102-127 (129)
  8 cd06859 PX_SNX1_2_like The pho  21.7      58  0.0012   24.3   1.5   26  159-184    86-111 (114)
  9 cd07281 PX_SNX1 The phosphoino  20.9      54  0.0012   25.2   1.2   28  159-186    96-123 (124)
 10 cd06897 PX_SNARE The phosphoin  18.5      90   0.002   23.0   2.0   26  159-184    78-105 (108)

No 1  
>PF02862 DDHD:  DDHD domain;  InterPro: IPR004177 The DDHD domain is 180 residues long and contains four conserved residues that may form a metal binding site. The domain is named after these four residues. This pattern of conservation of metal binding residues is often seen in phosphoesterase domains. This domain is found in retinal degeneration B proteins, as well as a family of probable phospholipases.; GO: 0046872 metal ion binding
Probab=100.00  E-value=2.1e-48  Score=331.30  Aligned_cols=186  Identities=33%  Similarity=0.525  Sum_probs=117.5

Q ss_pred             CCceEEEecChHHHHHHhcCCCCCC---------CCCCCCccccccccccccCCCcccccccccccccccCcCceeeccc
Q psy18227          2 WLDNLFCLGSPLAVFLALRVPRGHH---------GNHLFPPSLCSRLYNVFHPSDPIAYRLEPLVMKNYFRIAPVSIHSY   72 (211)
Q Consensus         2 ~V~~lF~~GSPlg~fl~~r~~~~~~---------~~~~~~~~~c~~~yNIfhp~DPvAyRlEPli~~~~~~~~p~~ip~~   72 (211)
                      +|++|||||||||+||++|+.....         ....++.+.|.++||||||+|||||||||||+++|+.++|+.||++
T Consensus         4 ~v~~lF~~GSPlg~fl~lr~~~~~~~~~~~~~~~~~~~~~~p~~~~~yNifhp~DPvAyRlEPli~~~~~~~~P~~ip~~   83 (227)
T PF02862_consen    4 KVDNLFLVGSPLGLFLTLRGAQIGARSASEYVTDEGSFYPCPACRRIYNIFHPYDPVAYRLEPLIDPRYADIKPVSIPRF   83 (227)
T ss_pred             CcCeEEEeCCCHHHHHHHhCccccccccccccccccccccCCccccceeeeecCChHHHhHHHHHhhhhccCCCeecccc
Confidence            6999999999999999999987542         2345667789999999999999999999999999999999999999


Q ss_pred             CCCCCCccCCCC--cccccCCCCCCC--CCCCCC-CCCCCCCCcccccc---cccccC-CcCC--------CCCCCC---
Q psy18227         73 NASSKPLYCDMP--LEFIIPSPSPSE--TSPPPL-LENPPPPQEKSWKK---WSLSFV-KPAV--------GPGSKS---  132 (211)
Q Consensus        73 ~~~~~~~~~~~~--~~~~~~~~~~~~--~~~~~~-~~~~~~~~~~~~~~---~~~~~~-~~~~--------~~s~~~---  132 (211)
                      +++...++....  ..+.........  ..+... ..+..........-   ...... ....        ......   
T Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~as~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  163 (227)
T PF02862_consen   84 KGGKLGHYESKKSISNIGSAISQNLSSTTSSLKNGFASSLRNSSSSLSSNDSESSDSSDSSQSSSSSDSSASSNSESSTS  163 (227)
T ss_pred             cccCcccccccchhhHHHHhhhhhcccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            997654432111  011100000000  000000 00000000000000   000000 0000        000000   


Q ss_pred             ---CCCCC---C--CCCCCCCCCceeEEeecCCCchHH-HHHHHhhhhhhcccchhhHHHHHHHhcC
Q psy18227        133 ---NAQTQ---P--ESPYEGLEHRLDYALKDTYGGTTR-GYLSAMTSHTAYWNNYDCAYFILTRLFP  190 (211)
Q Consensus       133 ---~~~~~---~--e~~~ln~~~RIDY~Lqe~~~~~~e-~ylsal~sH~sYW~s~D~a~FIL~el~~  190 (211)
                         .....   .  ....+|+++||||+||+   +.+| +||+||+||+|||+|+|||+|||+|||+
T Consensus       164 ~~~~~~~~~~~~~~~~~~l~~~~RiDy~Lq~---~~~~~~yl~~l~sH~sYW~s~Dva~Fil~~l~~  227 (227)
T PF02862_consen  164 NTESNEDSSSDAEKKLSKLNGNGRIDYVLQE---GVLENSYLSALTSHFSYWESKDVALFILKQLYR  227 (227)
T ss_pred             ccccccccchhhHHHHHhhcCCCccceecCC---CcccHHHHHHHHHHHHHcCCHHHHHHHHHHHhC
Confidence               00000   0  11458999999999999   8999 9999999999999999999999999986


No 2  
>KOG2308|consensus
Probab=100.00  E-value=1.8e-39  Score=311.70  Aligned_cols=191  Identities=31%  Similarity=0.507  Sum_probs=123.2

Q ss_pred             CCceEEEecChHHHHHHhcCCCCCCCC-CCCCccccccccccccCCCcccccccccccccccCcCceeecccCCCCCCcc
Q psy18227          2 WLDNLFCLGSPLAVFLALRVPRGHHGN-HLFPPSLCSRLYNVFHPSDPIAYRLEPLVMKNYFRIAPVSIHSYNASSKPLY   80 (211)
Q Consensus         2 ~V~~lF~~GSPlg~fl~~r~~~~~~~~-~~~~~~~c~~~yNIfhp~DPvAyRlEPli~~~~~~~~p~~ip~~~~~~~~~~   80 (211)
                      +|++||++|||||+||++||....+.. ...+.+.|++|||||||+|||||||||||+++|+.++|+.|||++++++.++
T Consensus       513 kV~~fFalGSPlgvFltlrG~d~~~~~~~~~~~p~C~~fyNIfHP~DPVAYRlEPlV~ke~~~i~Pv~Iph~r~~~~L~~  592 (741)
T KOG2308|consen  513 KVDNFFALGSPLGVFLTLRGIDSYNELSRIVSRPACKRFYNIFHPTDPVAYRLEPLVVKEMAHIRPVKIPHHRGSKRLHS  592 (741)
T ss_pred             chhheeeecCchhhhheecccccccccccccccccccchhhcCCCCCchheecccccchhhcccCceeccccCCccchhh
Confidence            699999999999999999998665322 2356678999999999999999999999999999999999999999987653


Q ss_pred             CCCCc--ccccCCCCCCCCCCCCCCCCCC---CCCc--ccccccccccCCcCCC----CCCC--CCCCCCC---------
Q psy18227         81 CDMPL--EFIIPSPSPSETSPPPLLENPP---PPQE--KSWKKWSLSFVKPAVG----PGSK--SNAQTQP---------  138 (211)
Q Consensus        81 ~~~~~--~~~~~~~~~~~~~~~~~~~~~~---~~~~--~~~~~~~~~~~~~~~~----~s~~--~~~~~~~---------  138 (211)
                      .....  .+..-.+.. .++++.+..+..   .+.+  ...+.+...+.....|    .+..  .+..+++         
T Consensus       593 ~~~~~~~~~~a~~~~~-~~~~~ks~~~~~~~~~s~~~~~~e~e~~~es~~~~~g~~~~~~~~~~~k~~~~~~~~a~~~~~  671 (741)
T KOG2308|consen  593 ELKEFLEDIGADLKQS-FNDGLKSLQSNKNSLESATVVSKENETTAESEDRSTGETADNSAVAAKKAVKKPDGTASDPRM  671 (741)
T ss_pred             hhccchhhhhhhcccc-cccchhccccccccccccccccccchhhhhhhcccccccccchhhhhhhhhcCCcccccChhh
Confidence            22111  110000000 011111100000   0000  0000000000000000    0000  0000000         


Q ss_pred             -----CCCCCCCCCceeEEeecCCCchHH----HHHHHhhhhhhcccchhhHHHHHHHhcCCCCCCC
Q psy18227        139 -----ESPYEGLEHRLDYALKDTYGGTTR----GYLSAMTSHTAYWNNYDCAYFILTRLFPTLELSS  196 (211)
Q Consensus       139 -----e~~~ln~~~RIDY~Lqe~~~~~~e----~ylsal~sH~sYW~s~D~a~FIL~el~~~~~~s~  196 (211)
                           ....+|.++|+||++|+   +++|    +||+|++||++||.++|+|.|||+|+|+..+++.
T Consensus       672 ~~~~~~lg~Ln~~~r~d~~~~e---~~~e~~~~eylsa~sshs~yW~s~d~a~fl~~e~y~~~~~s~  735 (741)
T KOG2308|consen  672 TPSDLRLGFLNATSRLDYVFQE---APIESSNLEYLSALSSHSEYWSSEDLALFLLTELYRSFGISN  735 (741)
T ss_pred             ccccchhhhhcccccccccccc---cchhhhhHHHHhhhcccccceecchhHHHHHHHHHHhccccc
Confidence                 11348899999999999   5555    8999999999999999999999999999999776


No 3  
>cd06885 PX_SNX17_31 The phosphoinositide binding Phox Homology domain of Sorting Nexins 17 and 31. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Members of this subfamily include sorting nexin 17 (SNX17), SNX31, and similar proteins. They contain an N-terminal PX domain followed by a truncated FERM (4.1, ezrin, radixin, and moesin) domain and a unique C-terminal region. SNXs make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. SNX17 is known to regulate the trafficking and processing of a number of proteins. It binds some me
Probab=42.25  E-value=21  Score=26.78  Aligned_cols=29  Identities=21%  Similarity=0.165  Sum_probs=25.1

Q ss_pred             chHHHHHHHhhhhhhcccchhhHHHHHHH
Q psy18227        159 GTTRGYLSAMTSHTAYWNNYDCAYFILTR  187 (211)
Q Consensus       159 ~~~e~ylsal~sH~sYW~s~D~a~FIL~e  187 (211)
                      ..+|.||..|..|--.|.++++..||.+.
T Consensus        75 ~~Le~yL~~l~~~~~l~~s~~~~~FL~~~  103 (104)
T cd06885          75 LQLEKYLQAVVQDPRIANSDIFNSFLLNA  103 (104)
T ss_pred             HHHHHHHHHHhcChhhccCHHHHHHHHhc
Confidence            34458999999999999999999999764


No 4  
>cd07284 PX_SNX7 The phosphoinositide binding Phox Homology domain of Sorting Nexin 7. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. Some SNXs are localized in early endosome structures such as clathrin-coated pits, while others are located in late structures of the endocytic pathway. SNX7 harbors a Bin/Amphiphysin/Rvs (BAR) domain, which detects membrane curvature, C-terminal to the PX domain, similar to the sorting nexins SNX1-2, SNX4-6, SNX8, SNX30,
Probab=25.24  E-value=54  Score=25.23  Aligned_cols=24  Identities=21%  Similarity=0.349  Sum_probs=21.5

Q ss_pred             HHHHHHHhhhhhhcccchhhHHHH
Q psy18227        161 TRGYLSAMTSHTAYWNNYDCAYFI  184 (211)
Q Consensus       161 ~e~ylsal~sH~sYW~s~D~a~FI  184 (211)
                      ++.||..|..|-..|.++++-.||
T Consensus        90 Le~FL~ri~~hp~L~~s~~~~~FL  113 (116)
T cd07284          90 LHKFLNRIADHPTLTFNEDFKIFL  113 (116)
T ss_pred             HHHHHHHHHcCcccccChHHHHhh
Confidence            347999999999999999999987


No 5  
>cd06865 PX_SNX_like The phosphoinositide binding Phox Homology domain of SNX-like proteins. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. Some SNXs are localized in early endosome structures such as clathrin-coated pits, while others are located in late structures of the endocytic pathway. This subfamily is composed of uncharacterized proteins, predominantly from plants, with similarity to sorting nexins. A few members show a similar domain architectu
Probab=23.11  E-value=57  Score=25.01  Aligned_cols=24  Identities=17%  Similarity=0.286  Sum_probs=21.7

Q ss_pred             HHHHHHHhhhhhhcccchhhHHHH
Q psy18227        161 TRGYLSAMTSHTAYWNNYDCAYFI  184 (211)
Q Consensus       161 ~e~ylsal~sH~sYW~s~D~a~FI  184 (211)
                      ++.||..|..|-..|.++++-.||
T Consensus        94 Le~fL~~i~~~p~l~~s~~~~~FL  117 (120)
T cd06865          94 LEKYLNRLAAHPVIGLSDELRVFL  117 (120)
T ss_pred             HHHHHHHHHcCceeecCcHHHHhc
Confidence            447999999999999999999997


No 6  
>cd06860 PX_SNX7_30_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 7 and 30. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. Some SNXs are localized in early endosome structures such as clathrin-coated pits, while others are located in late structures of the endocytic pathway. This subfamily consists of SNX7, SNX30, and similar proteins. They harbor a Bin/Amphiphysin/Rvs (BAR) domain, which detects membrane curvature, C-terminal
Probab=22.26  E-value=66  Score=24.47  Aligned_cols=25  Identities=16%  Similarity=0.255  Sum_probs=22.1

Q ss_pred             hHHHHHHHhhhhhhcccchhhHHHH
Q psy18227        160 TTRGYLSAMTSHTAYWNNYDCAYFI  184 (211)
Q Consensus       160 ~~e~ylsal~sH~sYW~s~D~a~FI  184 (211)
                      .+|.||..|..|--.|.|.++-.||
T Consensus        89 ~Le~fL~~i~~hp~l~~s~~l~~FL  113 (116)
T cd06860          89 ALHKFLNRIVEHPVLSFNEHLKVFL  113 (116)
T ss_pred             HHHHHHHHHHcCcccccCcHHHHhh
Confidence            3448999999999999999999987


No 7  
>cd06864 PX_SNX4 The phosphoinositide binding Phox Homology domain of Sorting Nexin 4. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. SNX4 is involved in recycling traffic from the sorting endosome (post-Golgi endosome) back to the late Golgi. It shows a similar domain architecture as SNX1-2, among others, containing a Bin/Amphiphysin/Rvs (BAR) domain, which detects membrane curvature, C-terminal to the PX domain. SNX4 is implicated in the regulation of
Probab=21.79  E-value=61  Score=25.28  Aligned_cols=26  Identities=12%  Similarity=0.172  Sum_probs=22.9

Q ss_pred             hHHHHHHHhhhhhhcccchhhHHHHH
Q psy18227        160 TTRGYLSAMTSHTAYWNNYDCAYFIL  185 (211)
Q Consensus       160 ~~e~ylsal~sH~sYW~s~D~a~FIL  185 (211)
                      .+|.||..|..|--.+.|+++..||-
T Consensus       102 ~Le~fL~~i~~~p~l~~s~~l~~FL~  127 (129)
T cd06864         102 GLENFLLRVAGHPELCQDKIFLEFLT  127 (129)
T ss_pred             HHHHHHHHHHcChhhhcCcHHHHhcC
Confidence            44489999999999999999999974


No 8  
>cd06859 PX_SNX1_2_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 1 and 2. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. This subfamily consists of SNX1, SNX2, and similar proteins. They harbor a Bin/Amphiphysin/Rvs (BAR) domain, which detects membrane curvature, C-terminal to the PX domain. Both domains have been shown to determine the specific membrane-targeting of SNX1. SNX1 and SNX2 are components of the retromer complex, 
Probab=21.67  E-value=58  Score=24.31  Aligned_cols=26  Identities=15%  Similarity=0.377  Sum_probs=22.8

Q ss_pred             chHHHHHHHhhhhhhcccchhhHHHH
Q psy18227        159 GTTRGYLSAMTSHTAYWNNYDCAYFI  184 (211)
Q Consensus       159 ~~~e~ylsal~sH~sYW~s~D~a~FI  184 (211)
                      ..++.||..|.+|--.+.++.+..||
T Consensus        86 ~~L~~fL~~i~~~p~l~~s~~~~~Fl  111 (114)
T cd06859          86 AALERFLRRIAAHPVLRKDPDFRLFL  111 (114)
T ss_pred             HHHHHHHHHHhcChhhccCcHHHhhc
Confidence            34558999999999999999999887


No 9  
>cd07281 PX_SNX1 The phosphoinositide binding Phox Homology domain of Sorting Nexin 1. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. SNX1 is both membrane associated and a cytosolic protein that exists as a tetramer in protein complexes. It can associate reversibly with membranes of the endosomal compartment, thereby coating these vesicles. SNX1 is a component of the retromer complex, a membrane coat multimeric complex required for endosomal retrieval 
Probab=20.89  E-value=54  Score=25.24  Aligned_cols=28  Identities=21%  Similarity=0.360  Sum_probs=24.1

Q ss_pred             chHHHHHHHhhhhhhcccchhhHHHHHH
Q psy18227        159 GTTRGYLSAMTSHTAYWNNYDCAYFILT  186 (211)
Q Consensus       159 ~~~e~ylsal~sH~sYW~s~D~a~FIL~  186 (211)
                      ..+|.||..|.+|-.-+.+.++..||-+
T Consensus        96 ~~Le~FL~~l~~~p~l~~s~~~~~FL~~  123 (124)
T cd07281          96 AALERYLQRIVSHPSLLQDPDVREFLEK  123 (124)
T ss_pred             HHHHHHHHHHhcCcccccChHHHHHhCC
Confidence            3455899999999999999999999854


No 10 
>cd06897 PX_SNARE The phosphoinositide binding Phox Homology domain of SNARE proteins from fungi. The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions such as cell signaling, vesicular trafficking, protein sorting, and lipid modification, among others. This subfamily is composed of fungal proteins similar to Saccharomyces cerevisiae Vam7p. They contain an N-terminal PX domain and a C-terminal SNARE domain. The SNARE (Soluble NSF attachment protein receptor) family of proteins are integral membrane proteins that serve as key factors for vesicular trafficking. Vam7p is anchored at the vacuolar membrane through the specific interaction of its PX domain with phosphatidylinositol-3-phosphate (PI3P) present in bilayers. It plays an essential role in vacuole fusion. The PX domain is involved in targeting of proteins to PI-enriched membranes, and may also be involved in protein-protein interaction.
Probab=18.48  E-value=90  Score=22.98  Aligned_cols=26  Identities=15%  Similarity=0.247  Sum_probs=22.7

Q ss_pred             chHHHHHHHhhhhh--hcccchhhHHHH
Q psy18227        159 GTTRGYLSAMTSHT--AYWNNYDCAYFI  184 (211)
Q Consensus       159 ~~~e~ylsal~sH~--sYW~s~D~a~FI  184 (211)
                      ..+|.||..|..|-  .++.+..+..|+
T Consensus        78 ~~Le~yL~~l~~~~~~~l~~s~~~~~FL  105 (108)
T cd06897          78 VGLEAFLRALLNDEDSRWRNSPAVKEFL  105 (108)
T ss_pred             HHHHHHHHHHHcCCccchhcCHHHHHHh
Confidence            34559999999999  999999999887


Done!