Query         psy18229
Match_columns 111
No_of_seqs    194 out of 597
Neff          6.2 
Searched_HMMs 46136
Date          Fri Aug 16 16:59:47 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy18229.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/18229hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3646|consensus               99.5 7.2E-15 1.6E-19  121.0  -0.3   49    1-49    306-354 (486)
  2 PF02932 Neur_chan_memb:  Neuro  98.7 3.4E-10 7.4E-15   78.9  -4.7   52    1-52     66-117 (237)
  3 KOG3645|consensus               98.1 4.5E-07 9.8E-12   74.9  -0.5   50    1-50    311-361 (449)
  4 TIGR00860 LIC Cation transport  98.1 2.8E-07   6E-12   76.3  -1.8   46    1-51    311-356 (459)
  5 cd06533 Glyco_transf_WecG_TagA  40.7      11 0.00024   27.1   0.5   25   19-43    137-161 (171)
  6 PF03808 Glyco_tran_WecB:  Glyc  29.4      16 0.00035   26.2  -0.2   22   22-43    142-163 (172)
  7 PF14202 TnpW:  Transposon-enco  28.2      54  0.0012   18.1   1.8   28    9-36      8-35  (37)
  8 TIGR00696 wecB_tagA_cpsF bacte  23.0      35 0.00077   24.9   0.6   25   20-44    139-163 (177)
  9 PRK03692 putative UDP-N-acetyl  22.2      31 0.00068   26.5   0.2   24   21-44    197-220 (243)
 10 PF00816 Histone_HNS:  H-NS his  19.6      59  0.0013   20.9   1.0   11   25-35     77-87  (93)

No 1  
>KOG3646|consensus
Probab=99.46  E-value=7.2e-15  Score=120.99  Aligned_cols=49  Identities=61%  Similarity=1.227  Sum_probs=47.4

Q ss_pred             CEeeheehheeeeEEEcccCCCCCCCCChhhHHhhhccccceeeeeCCC
Q psy18229          1 MFMVASSVVLTVVVLNYHHRTADSHEMPDWIRFLFLQWIPWILCMQRPH   49 (111)
Q Consensus         1 Mvlv~lSlv~Tv~VLn~h~r~~~~~~mP~WvR~l~L~~lp~lL~m~~p~   49 (111)
                      |++|++|+++||+|||+|||+|++|+|++|+|.+||+|+||+|+|+||.
T Consensus       306 m~iv~~SvvfTv~vLn~h~R~p~~h~m~p~~r~vfL~wlpwll~M~rP~  354 (486)
T KOG3646|consen  306 MFIVAASVVFTVIVLNLHHRTPETHEMSPWTRSVFLEWLPWLLRMKRPF  354 (486)
T ss_pred             HHHHHhhheeEEEEEeeeccCccccccCHHHHHHHHHHHHHHHHhcCCC
Confidence            6889999999999999999999999999999999999999999999993


No 2  
>PF02932 Neur_chan_memb:  Neurotransmitter-gated ion-channel transmembrane region ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature;  InterPro: IPR006029 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ]. Five of these ion channel receptor families have been shown to form a sequence-related superfamily:   Nicotinic acetylcholine receptor (AchR), an excitatory cation channel in vertebrates and invertebrates; in vertebrate motor endplates it is composed of alpha, beta, gamma and delta/epsilon subunits; in neurons it is composed of alpha and non-alpha (or beta) subunits []. Glycine receptor, an inhibitory chloride ion channel composed of alpha and beta subunits []. Gamma-aminobutyric acid (GABA) receptor, an inhibitory chloride ion channel; at least four types of subunits (alpha, beta, gamma and delta) are known []. Serotonin 5HT3 receptor, of which there are seven major types (5HT3-5HT7) []. Glutamate receptor, an excitatory cation channel of which at least three types have been described (kainate, N-methyl-D-aspartate (NMDA) and quisqualate) [].   These receptors possess a pentameric structure (made up of varying subunits), surrounding a central pore. All known sequences of subunits from neurotransmitter-gated ion-channels are structurally related. They are composed of a large extracellular glycosylated N-terminal ligand-binding domain, followed by three hydrophobic transmembrane regions which form the ionic channel, followed by an intracellular region of variable length. A fourth hydrophobic region is found at the C-terminal of the sequence [, ]. This domain represents four transmembrane helices of a variety of neurotransmitter-gated ion-channels.; GO: 0006811 ion transport, 0016020 membrane; PDB: 1DXZ_A 3MRA_A 1EQ8_C 1OED_C 2PR9_P 1A11_A 1CEK_A 2BG9_E 2KSR_A 2K59_B ....
Probab=98.69  E-value=3.4e-10  Score=78.94  Aligned_cols=52  Identities=44%  Similarity=0.852  Sum_probs=22.4

Q ss_pred             CEeeheehheeeeEEEcccCCCCCCCCChhhHHhhhccccceeeeeCCCCcc
Q psy18229          1 MFMVASSVVLTVVVLNYHHRTADSHEMPDWIRFLFLQWIPWILCMQRPHKKI   52 (111)
Q Consensus         1 Mvlv~lSlv~Tv~VLn~h~r~~~~~~mP~WvR~l~L~~lp~lL~m~~p~~~~   52 (111)
                      |+++++++..|++++|+||+++..++||+|+|.++++++|+++||++++...
T Consensus        66 ~~v~~~~~~~avv~~~~~~~~~~~~~~~~~~r~~~l~~l~~~l~~~~~~~~~  117 (237)
T PF02932_consen   66 MFVFSASLEFAVVVYNIHHRGPRTRPMPPWVRRLFLEKLARLLCMKRPSEKE  117 (237)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHSTTT-S--------------------------
T ss_pred             chhhhHHHHhhhhhhhhcccccccccccchhHHHHhhhhhhhhhhccccccc
Confidence            4567889999999999999999899999999999999999999999987653


No 3  
>KOG3645|consensus
Probab=98.12  E-value=4.5e-07  Score=74.89  Aligned_cols=50  Identities=50%  Similarity=0.924  Sum_probs=47.1

Q ss_pred             CEeeheehheeeeEEEcccCCCCCC-CCChhhHHhhhccccceeeeeCCCC
Q psy18229          1 MFMVASSVVLTVVVLNYHHRTADSH-EMPDWIRFLFLQWIPWILCMQRPHK   50 (111)
Q Consensus         1 Mvlv~lSlv~Tv~VLn~h~r~~~~~-~mP~WvR~l~L~~lp~lL~m~~p~~   50 (111)
                      |+++++|++.|++++|+|||.+.++ +||.|++++++..+|+++++++++.
T Consensus       311 m~~~~~sv~~tv~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  361 (449)
T KOG3645|consen  311 MVLVTISVVVTVVILNLHHRSPTTHPPMPPWVRRVFLEKLPRLLLMSRPED  361 (449)
T ss_pred             HHHHHHHHHHheeEEeeecccCCCCCCCchHHHHHHHHHHHHHHhcCCccc
Confidence            5788999999999999999999998 8999999999999999999998875


No 4  
>TIGR00860 LIC Cation transporter family protein. selective while glycine receptors are anion selective).
Probab=98.11  E-value=2.8e-07  Score=76.26  Aligned_cols=46  Identities=30%  Similarity=0.512  Sum_probs=42.2

Q ss_pred             CEeeheehheeeeEEEcccCCCCCCCCChhhHHhhhccccceeeeeCCCCc
Q psy18229          1 MFMVASSVVLTVVVLNYHHRTADSHEMPDWIRFLFLQWIPWILCMQRPHKK   51 (111)
Q Consensus         1 Mvlv~lSlv~Tv~VLn~h~r~~~~~~mP~WvR~l~L~~lp~lL~m~~p~~~   51 (111)
                      |++|++|++.|++|+|+|||++.+++     |.++++++|+++||++|++.
T Consensus       311 ~~~v~~sli~tv~V~~~~~~~~~~~~-----r~~~l~~l~~~l~~~~~~~~  356 (459)
T TIGR00860       311 MAFVFLALLETAFVNYVHHKDPAQGK-----RHLLLERCAWRLCKQEPGED  356 (459)
T ss_pred             HHHHHHHHHHHHhheeEEccCCCCCc-----eehHHhhchHHhcccCcccc
Confidence            56789999999999999999998876     99999999999999999764


No 5  
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.
Probab=40.66  E-value=11  Score=27.06  Aligned_cols=25  Identities=24%  Similarity=0.597  Sum_probs=20.1

Q ss_pred             cCCCCCCCCChhhHHhhhcccccee
Q psy18229         19 HRTADSHEMPDWIRFLFLQWIPWIL   43 (111)
Q Consensus        19 ~r~~~~~~mP~WvR~l~L~~lp~lL   43 (111)
                      +-+-..++.|.|++++-|+|+-+++
T Consensus       137 ~~aG~~~raP~w~~~~glEWlyRl~  161 (171)
T cd06533         137 FLAGTVKRAPKWMQKLGLEWLYRLL  161 (171)
T ss_pred             eccCCcccCcHHHHHhCchhHHhhh
Confidence            3344456889999999999999876


No 6  
>PF03808 Glyco_tran_WecB:  Glycosyl transferase WecB/TagA/CpsF family;  InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway.; GO: 0009058 biosynthetic process
Probab=29.41  E-value=16  Score=26.21  Aligned_cols=22  Identities=32%  Similarity=0.761  Sum_probs=18.6

Q ss_pred             CCCCCCChhhHHhhhcccccee
Q psy18229         22 ADSHEMPDWIRFLFLQWIPWIL   43 (111)
Q Consensus        22 ~~~~~mP~WvR~l~L~~lp~lL   43 (111)
                      -...+.|+|++++-|+|+-+++
T Consensus       142 G~~~raP~w~~~~glEWlyRl~  163 (172)
T PF03808_consen  142 GKVKRAPKWMRRLGLEWLYRLL  163 (172)
T ss_pred             cCcCccCHHHHHcCcHHHHHHH
Confidence            3346899999999999998875


No 7  
>PF14202 TnpW:  Transposon-encoded protein TnpW
Probab=28.18  E-value=54  Score=18.11  Aligned_cols=28  Identities=25%  Similarity=0.236  Sum_probs=20.7

Q ss_pred             heeeeEEEcccCCCCCCCCChhhHHhhh
Q psy18229          9 VLTVVVLNYHHRTADSHEMPDWIRFLFL   36 (111)
Q Consensus         9 v~Tv~VLn~h~r~~~~~~mP~WvR~l~L   36 (111)
                      --|++++++||....+..|-.-+++++.
T Consensus         8 G~Tty~V~~~F~~~s~et~~DKi~rli~   35 (37)
T PF14202_consen    8 GKTTYVVEVHFSETSKETMQDKIKRLIR   35 (37)
T ss_pred             CCEEEEEEEEECCCccccHHHHHHHHHh
Confidence            4588999999977776677766666653


No 8  
>TIGR00696 wecB_tagA_cpsF bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family. The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway.
Probab=23.04  E-value=35  Score=24.92  Aligned_cols=25  Identities=20%  Similarity=0.401  Sum_probs=20.1

Q ss_pred             CCCCCCCCChhhHHhhhccccceee
Q psy18229         20 RTADSHEMPDWIRFLFLQWIPWILC   44 (111)
Q Consensus        20 r~~~~~~mP~WvR~l~L~~lp~lL~   44 (111)
                      -+-..++-|+|++++=|+|+=+++.
T Consensus       139 ~aG~~~rAP~w~~~~gLEWlyRl~~  163 (177)
T TIGR00696       139 FSGLVKRAPRWLMRLGLEWLYRLRM  163 (177)
T ss_pred             cccCcCcCCHHHHHhCchHHHHhhh
Confidence            3444568999999999999988763


No 9  
>PRK03692 putative UDP-N-acetyl-D-mannosaminuronic acid transferase; Provisional
Probab=22.23  E-value=31  Score=26.54  Aligned_cols=24  Identities=25%  Similarity=0.408  Sum_probs=19.7

Q ss_pred             CCCCCCCChhhHHhhhccccceee
Q psy18229         21 TADSHEMPDWIRFLFLQWIPWILC   44 (111)
Q Consensus        21 ~~~~~~mP~WvR~l~L~~lp~lL~   44 (111)
                      .-..++-|+|++++-|+|+=+++.
T Consensus       197 aG~~~RAP~w~~~~gLEWlyRl~~  220 (243)
T PRK03692        197 TGHVKRAPKIWQNLGLEWLYRLLS  220 (243)
T ss_pred             cCCcCcCcHHHHHhChHHHHHhHh
Confidence            334568999999999999998763


No 10 
>PF00816 Histone_HNS:  H-NS histone family Partial NMR structure.;  InterPro: IPR001801 The histone-like nucleoid-structuring (H-NS) protein belongs to a family of bacterial proteins that play a role in the formation of nucleoid structure and affect gene expression under certain conditions [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 2LEV_A 1HNS_A 1LR1_B 1HNR_A 1NI8_A 1OV9_A 2JR1_A 3NR7_A 2L93_A 2L92_A.
Probab=19.64  E-value=59  Score=20.89  Aligned_cols=11  Identities=18%  Similarity=0.667  Sum_probs=9.0

Q ss_pred             CCCChhhHHhh
Q psy18229         25 HEMPDWIRFLF   35 (111)
Q Consensus        25 ~~mP~WvR~l~   35 (111)
                      +++|.|++-.+
T Consensus        77 Gr~P~Wl~~~~   87 (93)
T PF00816_consen   77 GRRPKWLKEAL   87 (93)
T ss_dssp             SSSSHHHHHHH
T ss_pred             CCCCHHHHHHH
Confidence            68999998754


Done!